>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if

Probab=99.64 E-value=1.9e-14 Score=105.63 Aligned_cols=144 Identities=21% Similarity=0.191 Sum_probs=107.1 Q ss_pred CEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCEE-ECCCCCCHHHHHHHHHCCC Q ss_conf 069985276311566787214898999998750023355553110479878863674178-1666558789999974015 Q gi|254780833|r 170 DMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQ-TFPLAWGVQHIQEKINRLI 248 (371) Q Consensus 170 di~~viD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~-~~~lt~~~~~~~~~i~~l~ 248 (371) T Consensus 2 pvV~vlD~SGSM~G------~~~~~ak~~~~~l~~~l~~~~-----~~~~lv~F~~~~~~~~~~~~~~~~~~~~~i~~~~ 70 (152) T cd01462 2 PVILLVDQSGSMYG------APEEVAKAVALALLRIALAEN-----RDTYLILFDSEFQTKIVDKTDDLEEPVEFLSGVQ 70 (152) T ss_pred CEEEEEECCCCCCC------CHHHHHHHHHHHHHHHHHHCC-----CEEEEEEECCCCEEEECCCCCCHHHHHHHHHHCC T ss_conf 99999979999898------069999999999999732339-----8099999168735771587645999999997253 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCC Q ss_conf 68874564237889999874211012346777666169999840458888889789999999999789879999941864 Q gi|254780833|r 249 FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEA 328 (371) Q Consensus 249 ~~g~T~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~k~ivl~TDG~~~~~~~~~~~~~~~c~~~k~~gi~i~tIg~~~~~ 328 (371) T Consensus 71 ~~GGT~i~~aL~~A~~~l~~~-----------~~~~~~IvlITDG~~~~~~---~~~~~~~~~~~~~~~r~~~~~iG~~~ 136 (152) T cd01462 71 LGGGTDINKALRYALELIERR-----------DPRKADIVLITDGYEGGVS---DELLREVELKRSRVARFVALALGDHG 136 (152) T ss_pred CCCCCCHHHHHHHHHHHHHCC-----------CCCCCEEEEEECCCCCCCH---HHHHHHHHHHHHCCEEEEEEEECCCC T ss_conf 689865799999999987425-----------7656469998267567983---99999999998389199999989998 Q ss_pred CHHHHHHHCC Q ss_conf 2798998338 Q gi|254780833|r 329 ADQFLKNCAS 338 (371) Q Consensus 329 ~~~~l~~cAs 338 (371) T Consensus 137 ~p~~~~~~~~ 146 (152) T cd01462 137 NPGYDRISAE 146 (152) T ss_pred CCHHHHHHHH T ss_conf 8278787666

HHsearch alignment for GI: 254780833 and conserved domain: cd01462