RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] (371 letters) >gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.. Length = 161 Score = 63.0 bits (152), Expect = 1e-10 Identities = 48/176 (27%), Positives = 71/176 (40%), Gaps = 25/176 (14%) Query: 169 LDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 D++ +LDVS SM G +KL A +++ ++ S+ R GLVTF S Sbjct: 1 ADIVFLLDVSGSM------GGEKLDKAKEALKALVS---SLSASPPGDRVGLVTFGSNAR 51 Query: 229 QTFPLAWGVQH--IQEKINRLIF--GSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 PL + E I+ L G T L A + AK + + Sbjct: 52 VVLPLTTDTDKADLLEAIDALKKGLGGGTNIGAALRLALELLKSAK---------RPNAR 102 Query: 285 KYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPD 340 + II LTDGE + E+ E ++ G VY IG+ +A + LK A Sbjct: 103 RVIILLTDGEPNDGPELLAEAA---RELRKLGITVYTIGIGDDANEDELKEIADKT 155 >gnl|CDD|29223 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains . Length = 161 Score = 55.0 bits (132), Expect = 3e-08 Identities = 35/182 (19%), Positives = 71/182 (39%), Gaps = 28/182 (15%) Query: 169 LDMMMVLDVSLSM-NDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKI 227 LD++ +LD S S+ ++F + + +++ + + R GLV +S + Sbjct: 1 LDIVFLLDGSESVGPENF----------EKVKDFIEKLVEKLDIGPDKTRVGLVQYSDDV 50 Query: 228 VQTFPLA--WGVQHIQEKINRL--IFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDY 283 F L + + + L + G T + L+YA ++F ++ Sbjct: 51 RVEFSLNDYKSKDDLLKAVKNLKYLGGGGTNTGKALQYALEQLFSESNA-------RENV 103 Query: 284 KKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQF--LKNCASPDR 341 K II LTDG + + + + K G V+ +GV ++ + +C S Sbjct: 104 PKVIIVLTDGRSDDGGDPKEAAA----KLKDEGIKVFVVGVGPADEEELREIASCPSERH 159 Query: 342 FY 343 + Sbjct: 160 VF 161 >gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain. Length = 177 Score = 54.3 bits (131), Expect = 5e-08 Identities = 38/195 (19%), Positives = 76/195 (38%), Gaps = 30/195 (15%) Query: 170 DMMMVLDVSLSM-NDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 D++ +LD S S+ +F + + +++++ + R GLV +SS + Sbjct: 1 DIVFLLDGSGSIGEANF----------EKVKEFIKKLVENLDIGPDGTRVGLVQYSSDVT 50 Query: 229 QTFPL--AWGVQHIQEKINRLI--FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 F L + + R I G T + L+YA +F + + Sbjct: 51 TEFSLNDYKSKDDLLSAVLRNIYYLGGGTNTGKALKYALENLFRSAG-------SRPNAP 103 Query: 285 KYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLK----NCASPD 340 K +I LTDG+++ + + ++ G IV+ +GV + ++ L+ S Sbjct: 104 KVVILLTDGKSNDGGLVPAAAA---ALRRKVGIIVFGVGV-GDVDEEELRLIASEPCSEG 159 Query: 341 RFYSVQNSRKLHDAF 355 + V + L D Sbjct: 160 HVFYVTDFDALSDIQ 174 >gnl|CDD|29247 cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax. ATR is the cellular receptor for the anthrax protective antigen and facilitates entry of the toxin into cells. The VWA domain in ATR contains the toxin binding site and mediates interaction with protective antigen. The binding is mediated by divalent cations that binds to the MIDAS motif. These proteins are a family of vertebrate ECM receptors expressed by endothelial cells.. Length = 185 Score = 47.6 bits (113), Expect = 5e-06 Identities = 42/188 (22%), Positives = 72/188 (38%), Gaps = 32/188 (17%) Query: 168 GLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPD--VNNVVRSGLVTFSS 225 D+ VLD S S+ ++ E+ D ++ + D + +R +TFS+ Sbjct: 4 HFDLYFVLDKSGSVAANW--------------IEIYDFVEQLVDRFNSPGLRFSFITFST 49 Query: 226 KIVQTFPLAWGVQHIQ---EKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDD 282 + + PL I E + ++ T GLE A +IF+ G + Sbjct: 50 RATKILPLTDDSSAIIKGLEVLKKVTPSGQTYIHEGLENANEQIFNRN-------GGGRE 102 Query: 283 YKKYIIFLTDGENSS--PNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPD 340 II LTDG+ E+ +++ GAIVY +GV Q + S + Sbjct: 103 TVSVIIALTDGQLLLNGHKYPEHEA----KLSRKLGAIVYCVGVTDFLKSQLINIADSKE 158 Query: 341 RFYSVQNS 348 + V + Sbjct: 159 YVFPVTSG 166 >gnl|CDD|29240 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses. In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup are bacterial in origin. They are typified by the presence of a MIDAS motif.. Length = 180 Score = 47.5 bits (113), Expect = 6e-06 Identities = 45/197 (22%), Positives = 76/197 (38%), Gaps = 24/197 (12%) Query: 168 GLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKI 227 G D+M+ LDVS SM +L A + + +D + D R GLV F+ Sbjct: 2 GRDIMIALDVSGSMLAQDFVKPSRLEAAKEVLSDFID--RREND-----RIGLVVFAGAA 54 Query: 228 VQTFPLAWGVQHIQEKINRLIFGSTTKSTP---GLEYAYNKIFDAKEKLEHIAKGHDDYK 284 PL + ++E + + G + T + A ++ +++ K + Sbjct: 55 FTQAPLTLDRESLKELLEDIKIGLAGQGTAIGDAIGLAIKRLKNSEAK-----------E 103 Query: 285 KYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYS 344 + I+ LTDGEN++ ID + AK +G +Y IGV + D Sbjct: 104 RVIVLLTDGENNAGEIDPATA---AELAKNKGVRIYTIGVGKSGSGPKPDGSTILDEDSL 160 Query: 345 VQNSRKLHDAFLRIGKE 361 V+ + K R Sbjct: 161 VEIADKTGGRIFRALDG 177 >gnl|CDD|33968 COG4245, TerY, Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only]. Length = 207 Score = 46.5 bits (110), Expect = 1e-05 Identities = 41/162 (25%), Positives = 61/162 (37%), Gaps = 14/162 (8%) Query: 169 LDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 L ++LD S SM G ++ L ++ M+D +K P V +VTF Sbjct: 4 LPCYLLLDTSGSMI---GEPIEALNAG---LQMMIDTLKQDPYALERVELSIVTFGGPAR 57 Query: 229 QTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYII 288 P L T L A + I + K K + KG DY+ ++ Sbjct: 58 VIQPF---TDAANFNPPILTAQGGTPLGAALTLALDMIEERKRKYDANGKG--DYRPWVF 112 Query: 289 FLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAAD 330 +TDGE P D + + +RR V A V + AD Sbjct: 113 LITDGE---PTDDWQAGAALVFQGERRAKSVAAFSVGVQGAD 151 >gnl|CDD|29229 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Not much is known about the function of the members of this subgroup. All members of this subgroup however have a conserved MIDAS motif. . Length = 206 Score = 45.8 bits (108), Expect = 2e-05 Identities = 38/169 (22%), Positives = 60/169 (35%), Gaps = 18/169 (10%) Query: 171 MMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQT 230 + +VLD S SM + G G +L A ++ E + +PD + GL TFS Sbjct: 23 VAIVLDNSGSMREVDGGGETRLDNAKAALDETANA---LPDGTRL---GLWTFSGD--GD 74 Query: 231 FPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFD-------AKEKLEHIAKGHDDY 283 PL V + + + G + L+ A N + A E A Sbjct: 75 NPLDVRVLVPKGCLTAPVNGFPSAQRSALDAALNSLQTPTGWTPLAAALAEAAAYVDPGR 134 Query: 284 KKYIIFLTDGENSSPNID---NKESLFYCNEAKRRGAIVYAIGVQAEAA 329 ++ +TDGE++ +E A V G A+ A Sbjct: 135 VNVVVLITDGEDTCGPDPCEVARELAKRRTPAPPIKVNVIDFGGDADRA 183 >gnl|CDD|29237 cd01464, vWA_subfamily, VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup have no assigned function. This subfamily is typified by the presence of a conserved MIDAS motif.. Length = 176 Score = 42.2 bits (99), Expect = 2e-04 Identities = 37/162 (22%), Positives = 61/162 (37%), Gaps = 14/162 (8%) Query: 173 MVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFP 232 ++LD S SM G ++ L ++ + ++ P V ++TF S P Sbjct: 8 LLLDTSGSMA---GEPIEALNQG---LQMLQSELRQDPYALESVEISVITFDSAARVIVP 61 Query: 233 LAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTD 292 L + RL T LE A + I + + A D++ ++ LTD Sbjct: 62 L---TPLESFQPPRLTASGGTSMGAALELALDCI--DRRVQRYRADQKGDWRPWVFLLTD 116 Query: 293 GENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLK 334 GE P D ++ EA+ + A V +A LK Sbjct: 117 GE---PTDDLTAAIERIKEARDSKGRIVACAVGPKADLDTLK 155 >gnl|CDD|29248 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity. Some members of the matrilin family are expressed specifically in developing cartilage rudiments. The matrilin family consists of at least four members. All the members of the matrilin family contain VWA domains, EGF-like domains and a heptad repeat coiled-coiled domain at the carboxy terminus which is responsible for the oligomerization of the matrilins. The VWA domains have been shown to be essential for matrilin network formation by interacting with matrix ligands.. Length = 224 Score = 39.9 bits (93), Expect = 0.001 Identities = 38/159 (23%), Positives = 65/159 (40%), Gaps = 26/159 (16%) Query: 195 ATRSIRE---------MLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKIN 245 ++RS+R + II S+ + R GLV +SS + Q FPL G + + Sbjct: 11 SSRSVRPENFELVKQFLNQIIDSLDVGPDATRVGLVQYSSTVKQEFPL--GRFKSKADLK 68 Query: 246 RLI-----FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNI 300 R + + T + ++YA N F E G + + I +TDG Sbjct: 69 RAVRRMEYLETGTMTGLAIQYAMNNAFSEAEGAR---PGSERVPRVGIVVTDGRPQDDVS 125 Query: 301 DNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASP 339 + +A+ G ++A+GV A ++ L+ AS Sbjct: 126 E------VAAKARALGIEMFAVGVG-RADEEELREIASE 157 >gnl|CDD|29245 cd01472, vWA_collagen, von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins. This domain has a variety of functions including: intermolecular adhesion, cell migration, signalling, transcription, and DNA repair. In integrins these domains form heterodimers while in vWF it forms homodimers and multimers. There are different interaction surfaces of this domain as seen by its complexes with collagen with either integrin or human vWFA. In integrins collagen binding occurs via the metal ion-dependent adhesion site (MIDAS) and involves three surface loops located on the upper surface of the molecule. In human vWFA, collagen binding is thought to occur on the bottom of the molecule and does not involve the vestigial MIDAS motif.. Length = 164 Score = 39.0 bits (91), Expect = 0.002 Identities = 31/160 (19%), Positives = 66/160 (41%), Gaps = 28/160 (17%) Query: 170 DMMMVLDVSLSM-NDHFGPGMDKLGVATRSIREML-DIIKSIPDVNNVVRSGLVTFSSKI 227 D++ ++D S S+ +F +++ + +++ + + VR G+V +S Sbjct: 2 DIVFLVDGSESIGLSNF-----------NLVKDFVKRVVERLDIGPDGVRVGVVQYSDDP 50 Query: 228 VQTFPLAW--GVQHIQEKINRL-IFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 F L + E + L G T + L+Y +F + + Sbjct: 51 RTEFYLNTYRSKDDVLEAVKNLRYIGGGTNTGKALKYVRENLF------TEASGSREGVP 104 Query: 285 KYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGV 324 K ++ +TDG+ S + + ++ E K+ G V+A+GV Sbjct: 105 KVLVVITDGK--SQDDVEEPAV----ELKQAGIEVFAVGV 138 >gnl|CDD|37564 KOG2353, KOG2353, KOG2353, L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1104 Score = 37.2 bits (86), Expect = 0.007 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 15/129 (11%) Query: 170 DMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIK-----SIPDVNNVVRSGLVTFS 224 D++++LDVS SM+ G +D +A +++ E+LD + +I N+ V F+ Sbjct: 227 DIVILLDVSGSMS---GLRLD---LAKQTVNEILDTLSDNDFVNILTFNSEVNPVSPCFN 280 Query: 225 SKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 +VQ + +E I L T LEYA++ + D + Sbjct: 281 GTLVQATMR--NKKVFKEAIETLDAKGIANYTAALEYAFSLLRDYNDSR--ANTQRSPCN 336 Query: 285 KYIIFLTDG 293 + I+ +TDG Sbjct: 337 QAIMLITDG 345 >gnl|CDD|34274 COG4655, COG4655, Predicted membrane protein [Function unknown]. Length = 565 Score = 35.4 bits (81), Expect = 0.027 Identities = 9/54 (16%), Positives = 28/54 (51%) Query: 14 KGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQE 67 + + +LTA+ +P+ + L ++ + + + +L + D + + A+ + + E Sbjct: 9 RSMVGVLTALFVPLALATLLLGVDYGYLYLEQRELQRVADLAAIAAASNLDDAE 62 >gnl|CDD|143482 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein. Length = 362 Score = 34.4 bits (80), Expect = 0.046 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Query: 246 RLIFGSTTKSTPGLEYAYNK-----IFDAKEKLEHIAKGHDDYKKYIIFLTDGENS 296 R+IF + KS + YA FD++++LE IAK K + TD + Sbjct: 71 RIIFANPCKSISDIRYAAELGVRLFTFDSEDELEKIAKHAPGAKLLLRIATDDSGA 126 >gnl|CDD|29249 cd01476, VWA_integrin_invertebrates, VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions. Because of their involvement in many biologically important adhesion processes, integrins are conserved across a wide range of multicellular animals. Integrins from invertebrates have been identified from six phyla. There are no data to date to suggest any immunological functions for the invertebrate integrins. The members of this sub-group have the conserved MIDAS motif that is charateristic of this domain suggesting the involvement of the integrins in the recognition and binding of multi-ligands.. Length = 163 Score = 34.5 bits (79), Expect = 0.055 Identities = 26/133 (19%), Positives = 49/133 (36%), Gaps = 28/133 (21%) Query: 169 LDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 LD++ VLD S S+ F + + + I++ + R L+T+S + Sbjct: 1 LDLLFVLDSSGSVRGKF----------EKYKKYIERIVEGLEIGPTATRVALITYSGRGR 50 Query: 229 QTFPLAWGVQHIQEKINRLI-----FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGH--- 280 Q + E++ + G TT + +E A L+ + Sbjct: 51 QRVRFNLPKHNDGEELLEKVDNLRFIGGTTATGAAIEVA----------LQQLDPSEGRR 100 Query: 281 DDYKKYIIFLTDG 293 + K ++ LTDG Sbjct: 101 EGIPKVVVVLTDG 113 >gnl|CDD|34193 COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism]. Length = 637 Score = 30.3 bits (68), Expect = 0.86 Identities = 35/215 (16%), Positives = 74/215 (34%), Gaps = 37/215 (17%) Query: 165 SDIGLDMMMVLDVSLSMNDHFGP---GMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLV 221 S L +++DVS S + +D A + + D+ Sbjct: 443 SAHDLAFTLLVDVSASTDAKMDETRRVIDLFHEALLVLAHGHQALGDSEDIL-------- 494 Query: 222 TFSSK-----IVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHI 276 F+S+ + T V+ E + + PG Y + A Sbjct: 495 DFTSRRRPWVRINT------VKDFDESMGETVGPRIMALEPGY---YTRDGAAIRHASAK 545 Query: 277 AKGHDDYKKYIIFLTDGENSSPN--------IDNKESLFYCNEAKRRGAIVYAIGVQAEA 328 +K +I L+DG+ + + D +E++ EA++ G V+ + + EA Sbjct: 546 LMERPQRQKLLIVLSDGKPNDFDHYEGRFGIEDTREAV---IEARKSGIEVFNVTLDREA 602 Query: 329 ADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMV 363 +L + + V+ +L A + ++++ Sbjct: 603 IS-YLPALFGQNGYAFVERVAQLPGALPPLYRKLL 636 >gnl|CDD|29236 cd01463, vWA_VGCC_like, VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta. The alpha 2 and delta subunits result from proteolytic processing of a single gene product and carries at its N-terminus the VWA and cache domains, The alpha 2 delta gene family has orthologues in D. melanogaster and C. elegans but none have been detected in aither A. thaliana or yeast. The exact biochemical function of the VWA domain is not known but the alpha 2 delta complex has been shown to regulate various functional properties of the channel complex.. Length = 190 Score = 29.9 bits (67), Expect = 1.2 Identities = 28/138 (20%), Positives = 59/138 (42%), Gaps = 23/138 (16%) Query: 170 DMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIK-----SIPDVNNVVRSGLVTFS 224 D++++LDVS SM G + +A +++ +LD + +I +N V + F+ Sbjct: 15 DIVILLDVSGSMT---GQRLH---LAKQTVSSILDTLSDNDFFNIITFSNEVNPVVPCFN 68 Query: 225 SKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 +VQ + ++E ++ L T LE+A++ + + H + Sbjct: 69 DTLVQATTS--NKKVLKEALDMLEAKGIANYTKALEFAFSLLLKNLQ------SNHSGSR 120 Query: 285 ----KYIIFLTDGENSSP 298 + I+ +TDG + Sbjct: 121 SQCNQAIMLITDGVPENY 138 >gnl|CDD|29239 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Membes of this subgroup belong to Zinc-finger family as they are found fused to RING finger domains. The MIDAS motif is not conserved in all the members of this family. The function of vWA domains however is not known.. Length = 155 Score = 29.5 bits (66), Expect = 1.4 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 25/132 (18%) Query: 169 LDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 +D++ VLDVS SM G DKL + ++R + I S+ D + R +VTFS+ Sbjct: 1 VDLVAVLDVSGSM-----AG-DKLQLVKHALRFV---ISSLGDAD---RLSIVTFSTSAK 48 Query: 229 QTFPL----AWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYK 284 + PL A G + + ++ L G T GL+ A + D ++K + Sbjct: 49 RLSPLRRMTAKGKRSAKRVVDGLQAGGGTNVVGGLKKALKVLGDRRQKNPVAS------- 101 Query: 285 KYIIFLTDGENS 296 I+ L+DG+++ Sbjct: 102 --IMLLSDGQDN 111 >gnl|CDD|143611 cd07587, ML_beta-AS, mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases). This subgroup includes mammalian-like beta-AS (EC 3.5.1.6, also known as beta-ureidopropionase or N-carbamoyl-beta-alanine amidohydrolase). This enzyme catalyzes the third and final step in the catabolic pyrimidine catabolic pathway responsible for the degradation of uracil and thymine, the hydrolysis of N-carbamyl-beta-alanine and N-carbamyl-beta-aminoisobutyrate to the beta-amino acids, beta-alanine and beta-aminoisobutyrate respectively. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 5. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Beta-ASs from this subgroup are found in various oligomeric states, dimer (human), hexamer (calf liver), decamer (Arabidopsis and Zea mays), and in the case of Drosophila melanogaster beta-AS, as a homooctamer assembled as a left-handed helical turn, with the possibility of higher order oligomers formed by adding dimers at either end. Rat beta-AS changes its oligomeric state (hexamer, trimer, dodecamer) in response to allosteric effectors. Eukaryotic Saccharomyces kluyveri beta-AS belongs to a different superfamily. Length = 363 Score = 28.5 bits (64), Expect = 2.8 Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 3/14 (21%) Query: 135 MPFIFCT---FPWC 145 MPF FCT PWC Sbjct: 115 MPFAFCTREKLPWC 128 >gnl|CDD|38652 KOG3442, KOG3442, KOG3442, Uncharacterized conserved protein [Function unknown]. Length = 132 Score = 28.4 bits (63), Expect = 3.4 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 6/62 (9%) Query: 237 VQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENS 296 + I+++ L F KS G Y +K+F AKE+L+ K K +G + Sbjct: 73 REEIEKRYEHL-FEVNDKSKGGSFYLQSKVFRAKERLDEELKIELKEKI-----GNGSPA 126 Query: 297 SP 298 P Sbjct: 127 KP 128 >gnl|CDD|29234 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin). Bikunin confers the protease-inhibitor function while the heavy chains are involved in rendering stability to the extracellular matrix by binding to hyaluronic acid. The heavy chains carry the VWA domain with a conserved MIDAS motif. Although the exact role of the VWA domains remains unknown, it has been speculated to be involved in mediating protein-protein interactions with the components of the extracellular matrix.. Length = 171 Score = 27.8 bits (62), Expect = 4.5 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 38/177 (21%) Query: 170 DMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIP--DVNNVVRSGLVTFSSKI 227 +++ V+D S SM+ G +++ A +L +K +P D N++ FS + Sbjct: 4 EVVFVIDTSGSMS---GTKIEQTKEA------LLTALKDLPPGDYFNII-----GFSDTV 49 Query: 228 VQTFPL-----AWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDD 282 + P A V E +NRL T LE A + Sbjct: 50 EEFSPSSVSATAENVAAAIEYVNRLQALGGTNMNDALEAALELL-----------NSSPG 98 Query: 283 YKKYIIFLTDGENSSPNIDNKESLFY-CNEAKRRGAIVYAIGVQAEAADQFLKNCAS 338 II LTDGE + N+ + EA ++ G+ ++ L+ A Sbjct: 99 SVPQIILLTDGE-----VTNESQILKNVREALSGRIRLFTFGIGSDVNTYLLERLAR 150 >gnl|CDD|32459 COG2304, COG2304, Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 399 Score = 27.6 bits (60), Expect = 6.2 Identities = 32/172 (18%), Positives = 53/172 (30%), Gaps = 28/172 (16%) Query: 169 LDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIV 228 ++ + +D S SM G ++ A + L N +VTF+ Sbjct: 38 ANLTLAIDTSGSMT---GALLELAKSAAIELVNGL---------NPGDLLSIVTFAGSAD 85 Query: 229 QTFPLAWGVQHIQEKINRLIFGST-----TKSTPGLEYAYNKIFDAKEKLEHIAKGHDDY 283 P +E I I S T L A A + Sbjct: 86 VLIPP--TGATNKESITAAIDQSLQAGGATAVEASLSLAVELAAKALPR---------GT 134 Query: 284 KKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKN 335 I+ LTDGEN+ +D A +G ++ +G+ + + L Sbjct: 135 LNRILLLTDGENNLGLVDPSRLSALAKLAAGKGIVLDTLGLGDDVNEDELTG 186 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0714 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,395,659 Number of extensions: 229699 Number of successful extensions: 622 Number of sequences better than 10.0: 1 Number of HSP's gapped: 609 Number of HSP's successfully gapped: 26 Length of query: 371 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 276 Effective length of database: 4,210,882 Effective search space: 1162203432 Effective search space used: 1162203432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.1 bits)