RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780834|ref|YP_003065247.1| DNA primase [Candidatus Liberibacter asiaticus str. psy62] (648 letters) >gnl|CDD|30707 COG0358, DnaG, DNA primase (bacterial type) [DNA replication, recombination, and repair]. Length = 568 Score = 358 bits (919), Expect = 3e-99 Identities = 204/604 (33%), Positives = 294/604 (48%), Gaps = 53/604 (8%) Query: 3 YPRDFIKDLLIHIPISNLIGQYVDWDRRKTNAVKGDYWACCPFHDEKTPSFHCNDSKGFY 62 PR+FI +L I I ++IG+YV K +Y CPFH EKTPSF + KGFY Sbjct: 2 IPREFIDELRERIDIVDVIGEYV-----KLKKQGANYTGLCPFHAEKTPSFTVSPEKGFY 56 Query: 63 YCFSCHVKGDHLSFLSALLGCSFIESVQRLAAIAGVPLPVVDPKIEKKEKIQTDLIRLIE 122 +CF C GD + FL LLG SF E+V +LA AG+ LP K +K + L E Sbjct: 57 HCFGCGAGGDAIKFLMELLGLSFDEAVLQLAGRAGIELPYEKGKRIEKRQ---KLYDGKE 113 Query: 123 VATDFFHHSLKNARDKRLHYYLDERGIDSHAIEMFKLGYAPDSRYSLREHLRQKGFSEEK 182 A F+ SL L YL+ RG+ + I F+LGYAP + SL L +K + EEK Sbjct: 114 EAAIFYQSSLDPEGAAAL-KYLETRGLAAELIAHFRLGYAPPND-SLLPFLAKKEYREEK 171 Query: 183 IIEAGLLIDGDNSATSYDRFRNRLIFPIRSSRGQVIAFGGRTLSKGESVKYLNSPETILF 242 + + GLL + YDRFRNR++FPIR RG VI FGGR L + KYLNSPET LF Sbjct: 172 LEDLGLLKRKEG--KIYDRFRNRIMFPIRDLRGDVIGFGGRVLGDDKP-KYLNSPETELF 228 Query: 243 HKGKNLYNFFGALNYLQKSIRKDVRRNSSSFIILVEGYMDVLSLCQAGVQNVVSSLGTAL 302 KG+ LY A + K + II+VEGYMDV++L +AG++N V+SLGTAL Sbjct: 229 KKGEELYGLDPARKKIAK----------ADQIIVVEGYMDVIALHKAGIKNAVASLGTAL 278 Query: 303 TEYQLRLLWKLSPRIVLCFDGDDPGLRAAYKAIDLVLCHLIPGNRVNFVLLSRGEDPDSF 362 TE ++LL + +++LCFDGD G +AA +A+ LVL G V +LL G+DPD Sbjct: 279 TEEHIKLLSRGKKKVILCFDGDRAGRKAAKRALQLVLPLDFVG--VFVILLPDGKDPDEL 336 Query: 363 IRCYGKTAFEKLI-VESLPLVDMLWKRETENRSFNTPDERAELEIHLKNCINHIKDQKLR 421 IR G A K + E LPL++ L + + + +A L I I D+ LR Sbjct: 337 IRKEGAEALRKKLPNERLPLIEFLIEYLIPSNLDT--EGKARLVEEAVPLIKVIPDEVLR 394 Query: 422 YYYSQAIRDRLQQLFQK-YITEHSGYGRYWKKNARHRDQKGPSQRLMQSSLVKGKLSKKP 480 YY Q + + L + + + + + L+Q+ ++ K Sbjct: 395 DYYLQKLAELLGISDDALLQLQVQPEKKATQSPFKQNPGRIAIALLVQNPVLAPKQPILK 454 Query: 481 SLREAALLLTLINHPAILQEQYQELADIRYDNNELQKLWSFLFSDFVEQKYFLPEEIHQR 540 +L E LL L+ +L+ D R+ + Q L+ L + V Sbjct: 455 ALLERPLLKLLLFEELLLELFGTPEIDARFLDELFQSLFEVLLEELV------------- 501 Query: 541 LCERGFGELLKQLDRQVRDAGLWSATTEANIVDVRQGYQQALALYKRFRLLSRQKEEIEK 600 ELL + A ++ I +++ QAL + + +++K + K Sbjct: 502 -------ELLDINLLVSKAAIVFDGV----ITLLQRLLDQALEKGLKNLIGAKKKSGLNK 550 Query: 601 QIAQ 604 + + Sbjct: 551 KPKE 554 >gnl|CDD|110780 pfam01807, zf-CHC2, CHC2 zinc finger. This domain is principally involved in DNA binding in DNA primases. Length = 98 Score = 115 bits (290), Expect = 5e-26 Identities = 44/99 (44%), Positives = 59/99 (59%), Gaps = 5/99 (5%) Query: 3 YPRDFIKDLLIHIPISNLIGQYVDWDRRKTNAVKGDYWACCPFHDEKTPSFHCNDSKGFY 62 P + I DL I I ++IGQYV ++ + Y CPFHDEKTPSF + K FY Sbjct: 1 IPEESIDDLKNRIDIVDIIGQYVKLKKKGRD-----YKGLCPFHDEKTPSFSVSPDKQFY 55 Query: 63 YCFSCHVKGDHLSFLSALLGCSFIESVQRLAAIAGVPLP 101 +CF C GD +SFL + SF+E+V++LA AG+ LP Sbjct: 56 HCFGCGAGGDAISFLMKIDKLSFVEAVKKLADRAGIDLP 94 >gnl|CDD|173784 cd03364, TOPRIM_DnaG_primases, TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG. Primases synthesize RNA primers for the initiation of DNA replication. DnaG type primases are often closely associated with DNA helicases in primosome assemblies. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). This glutamate and two aspartates, cluster together to form a highly acid surface patch. The conserved glutamate may act as a general base in nucleotide polymerization by primases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. E. coli DnaG is a single subunit enzyme. Length = 79 Score = 113 bits (285), Expect = 2e-25 Identities = 42/80 (52%), Positives = 59/80 (73%), Gaps = 3/80 (3%) Query: 274 IILVEGYMDVLSLCQAGVQNVVSSLGTALTEYQLRLLWKLSPRIVLCFDGDDPGLRAAYK 333 +ILVEGYMDV++L QAG++NVV+SLGTALTE Q LL +L+ ++L FDGD+ G +AA + Sbjct: 3 VILVEGYMDVIALHQAGIKNVVASLGTALTEEQAELLKRLAKEVILAFDGDEAGQKAALR 62 Query: 334 AIDLVLCHLIPGNRVNFVLL 353 A++L+L G V + L Sbjct: 63 ALELLLKL---GLNVRVLTL 79 >gnl|CDD|173779 cd01029, TOPRIM_primases, TOPRIM_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of bacterial DnaG-type primases and their homologs. Primases synthesize RNA primers for the initiation of DNA replication. DnaG type primases are often closely associated with DNA helicases in primosome assemblies. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). This glutamate and two aspartates, cluster together to form a highly acid surface patch. The conserved glutamate may act as a general base in nucleotide polymerization by primases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. The prototypical bacterial primase. Escherichia coli DnaG is a single subunit enzyme. Length = 79 Score = 100 bits (251), Expect = 1e-21 Identities = 37/66 (56%), Positives = 54/66 (81%) Query: 274 IILVEGYMDVLSLCQAGVQNVVSSLGTALTEYQLRLLWKLSPRIVLCFDGDDPGLRAAYK 333 +I+VEGYMDVL+L QAG++NVV++LGTA TE QLRLL + + ++L FD D+ G +AA + Sbjct: 3 VIIVEGYMDVLALHQAGIKNVVAALGTANTEEQLRLLKRFARTVILAFDNDEAGKKAAAR 62 Query: 334 AIDLVL 339 A++L+L Sbjct: 63 ALELLL 68 >gnl|CDD|173773 cd00188, TOPRIM, Topoisomerase-primase domain. This is a nucleotidyl transferase/hydrolase domain found in type IA, type IIA and type IIB topoisomerases, bacterial DnaG-type primases, small primase-like proteins from bacteria and archaea, OLD family nucleases from bacterial and archaea, and bacterial DNA repair proteins of the RecR/M family. This domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). This glutamate and two aspartates, cluster together to form a highly acid surface patch. The conserved glutamate may act as a general base in nucleotide polymerization by primases and in strand joining in topoisomerases and, as a general acid in strand cleavage by topisomerases and nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. Length = 83 Score = 65.5 bits (160), Expect = 5e-11 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Query: 272 SFIILVEGYMDVLSLCQAGV--QNVVSSLGTAL--TEYQLRLLWKLSPRIVLCFDGDDPG 327 +I+VEG D L+L QAG VV+ G AL T L+ L + +++ D D G Sbjct: 1 KKLIIVEGPSDALALAQAGGYGGAVVALGGHALNKTRELLKRLLGEAKEVIIATDADREG 60 Query: 328 LRAAYKAIDLVLCHLIP 344 A + ++L+ Sbjct: 61 EAIALRLLELLKSLGKK 77 >gnl|CDD|145089 pfam01751, Toprim, Toprim domain. This is a conserved region from DNA primase. This corresponds to the Toprim domain common to DnaG primases, topoisomerases, OLD family nucleases and RecR proteins. Both DnaG motifs IV and V are present in the alignment, the DxD (V) motif may be involved in Mg2+ binding and mutations to the conserved glutamate (IV) completely abolish DnaG type primase activity. DNA primase EC:2.7.7.6 is a nucleotidyltransferase it synthesizes the oligoribonucleotide primers required for DNA replication on the lagging strand of the replication fork; it can also prime the leading stand and has been implicated in cell division. This family also includes the atypical archaeal A subunit from type II DNA topoisomerases. Type II DNA topoisomerases catalyse the relaxation of DNA supercoiling by causing transient double strand breaks. Length = 89 Score = 56.5 bits (137), Expect = 2e-08 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 9/88 (10%) Query: 272 SFIILVEGYMDVLSLCQAGV--QNVVSSLGTA-----LTEYQLRLLWKLSPR--IVLCFD 322 +I+VEG D ++L +AG NVV+ LG LT+ QL+LL KL+ + ++L D Sbjct: 1 KVLIIVEGPSDAIALAKAGGYKGNVVALLGHLSDVIPLTKEQLKLLKKLAKKDEVILATD 60 Query: 323 GDDPGLRAAYKAIDLVLCHLIPGNRVNF 350 D G A+K ++L+ R+ Sbjct: 61 PDREGEAIAWKLLELLKPLGKKVRRIFL 88 >gnl|CDD|173777 cd01027, TOPRIM_RNase_M5_like, TOPRIM_ RNase M5_like: The topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain found in Ribonuclease M5: (RNase M5) and other small primase-like proteins from bacteria and archaea. RNase M5 catalyzes the maturation of 5S rRNA in low G+C Gram-positive bacteria. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general base in nucleotide polymerization by primases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. Length = 81 Score = 34.2 bits (79), Expect = 0.12 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Query: 274 IILVEGYMDVLSLCQAGVQ-NVVSSLGTALTEYQLRLLWKLSPRIVLCFDGDDPGLRAAY 332 +I+VEG D SL + G++ ++ + G+ + + + L+ K +++ D D G + Sbjct: 4 VIIVEGKNDTESLKKLGIEAEIIETNGSIINKETIELIKKAYRGVIILTDPDRKGEKIR- 62 Query: 333 KAIDLVLCHLIPGNRVNF 350 K + L +P + F Sbjct: 63 KKLSEYLSGPVPEIKRAF 80 >gnl|CDD|38180 KOG2969, KOG2969, KOG2969, Uncharacterized conserved protein [Function unknown]. Length = 264 Score = 30.1 bits (67), Expect = 1.7 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 129 HHSLKNARDKRLHYYLDERGIDSHAIEMFKL-GYAPDSRYSLREHLRQKGFSEEKIIEAG 187 +H L K +H L RG +S E K+ G + E + + GFSE+ I+E G Sbjct: 14 NHGLHICHSKPIHIALGRRGKESENYETLKISGKKALIAENALEFVPEHGFSEDAIVEGG 73 >gnl|CDD|37053 KOG1842, KOG1842, KOG1842, FYVE finger-containing protein [General function prediction only]. Length = 505 Score = 30.0 bits (67), Expect = 2.0 Identities = 17/44 (38%), Positives = 23/44 (52%) Query: 591 LSRQKEEIEKQIAQVTAKGEAEKTAILISILHEVHIQIHQIESQ 634 L Q IE I Q AK + E+ L S L E+H +IH I+ + Sbjct: 453 LYEQIFLIESFIEQAKAKRKFEEVETLESNLRELHEEIHSIQEK 496 >gnl|CDD|29626 cd01420, MoaC_PE, MoaC family, prokaryotic and eukaryotic. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine derivative to the precursor Z by inserting the carbon-8 of the purine between the 2' and 3' ribose carbon atoms, which is the first of three phases of Moco biosynthesis.. Length = 140 Score = 29.8 bits (67), Expect = 2.5 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 10/69 (14%) Query: 327 GLRAAYKAIDLV-LCHLIP--GNRVNFVLLS--RGEDPDSFIRCYGKTAFE-----KLIV 376 G+ AA + +L+ LCH +P G V+F L G ++ +R G+T E + V Sbjct: 48 GIMAAKRTSELIPLCHPLPLTGVDVDFELDEETSGVRIEATVRTTGRTGVEMEALTAVSV 107 Query: 377 ESLPLVDML 385 +L + DM Sbjct: 108 AALTIYDMC 116 >gnl|CDD|39340 KOG4137, KOG4137, KOG4137, Uncharacterized conserved protein [Function unknown]. Length = 102 Score = 29.6 bits (66), Expect = 2.5 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Query: 449 YWKKNARHRDQKGPSQRLMQSSLVKGKLSKKPSLREAALLLTLINHPAILQEQYQELADI 508 KN R + K QRL++ + PS++ A + PA + L Sbjct: 13 RRGKNMRQKILKELLQRLIEKKHTYFSIEAPPSVKPAKKYCDVTGLPAPYTDPNTGL--- 69 Query: 509 RYDNNELQKLWSFLFSDFVEQKYF 532 RY N E+ KL + SD Q+Y Sbjct: 70 RYHNAEIYKLICEMPSD-RVQEYL 92 >gnl|CDD|36427 KOG1213, KOG1213, KOG1213, Sister chromatid cohesion complex Cohesin, subunit RAD21/SCC1 [Cell cycle control, cell division, chromosome partitioning]. Length = 614 Score = 29.6 bits (66), Expect = 2.8 Identities = 18/142 (12%), Positives = 38/142 (26%), Gaps = 5/142 (3%) Query: 378 SLPLVDMLWKRETENRSFNTPDERAELEIHLKNCINHIKDQKLRYYYSQAIRDRLQQLFQ 437 S + + + T N +++ + + D + Sbjct: 466 SQDNILIPKEVPTPNPEPPLSSPFRGPGFTVESNEWESTPYGDEFPMAAEKADLEGEEGL 525 Query: 438 KYITEHSGYGRYWKKNARHRDQK-----GPSQRLMQSSLVKGKLSKKPSLREAALLLTLI 492 + R K + ++ S L+ ++K + R+ LL L Sbjct: 526 SPGGTETQEERELAKRTEQILTSIQLEPETNGQIELSELLPNGPNRKQAARKFFSLLVLK 585 Query: 493 NHPAILQEQYQELADIRYDNNE 514 AI +Q + DI Sbjct: 586 TRQAIEVKQDEPYGDIIITPGP 607 >gnl|CDD|144112 pfam00396, Granulin, Granulin. Length = 43 Score = 29.2 bits (66), Expect = 3.9 Identities = 9/36 (25%), Positives = 11/36 (30%), Gaps = 11/36 (30%) Query: 40 WACCPFH------DEKT--PS-FHCNDSKGFYYCFS 66 W CCP D P + C+ G C Sbjct: 10 WGCCPLPQAVCCSDGLHCCPQGYTCDLDAG--TCVK 43 >gnl|CDD|35533 KOG0312, KOG0312, KOG0312, Uncharacterized conserved protein [Function unknown]. Length = 563 Score = 29.0 bits (64), Expect = 4.1 Identities = 29/138 (21%), Positives = 52/138 (37%), Gaps = 24/138 (17%) Query: 389 ETENRSFNTPDERAELEIHLKNCINHIKDQKLRYYYSQAIRDRLQQ-LFQKYITEHSG-- 445 E+ R+ +R +E +K I+ RY + +RDR+ + K E SG Sbjct: 400 ESLERTMQQQTQR-VMEWKVK-----IRSDGTRYITKRPVRDRILKERALKVFEERSGMT 453 Query: 446 ----------YGRYWKKNARHRDQKGP-SQRLMQSSLVKGKLSK-KPSLREAALLLTLIN 493 GRYW K R + QR + +++ +L K S ++ N Sbjct: 454 TDDDAMSEMKMGRYWSKEERKQHLVAAKEQRRRREFMMQSRLECLKESPQQNTTNPKEAN 513 Query: 494 HPAILQEQYQELADIRYD 511 I + ++++ R Sbjct: 514 ---ITELSHKKMMKKRNK 528 >gnl|CDD|113242 pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerisation of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid. Length = 186 Score = 29.2 bits (66), Expect = 4.2 Identities = 13/70 (18%), Positives = 21/70 (30%), Gaps = 6/70 (8%) Query: 224 TLSKGESVKYLNSPETILFHK----GKNLYNFFGALNYLQKSIRKDVRRNSSSFIILVEG 279 T + + K Y L+ L + + R +S +I V Sbjct: 19 TFRDDGYYSAGSILFNLDLEKLLEKLGENYVILVKLHPLVSNSIINKRYDS--DVIDVSD 76 Query: 280 YMDVLSLCQA 289 Y D+ L A Sbjct: 77 YSDIQDLFLA 86 >gnl|CDD|38845 KOG3639, KOG3639, KOG3639, C2 Ca2+-binding motif-containing protein [General function prediction only]. Length = 1239 Score = 28.6 bits (63), Expect = 5.9 Identities = 22/100 (22%), Positives = 33/100 (33%), Gaps = 11/100 (11%) Query: 143 YLDERGIDSHA-IEMFKLGYAPDSRYSLREHLRQKGFSEEKIIEAGLLIDGDNSATSYDR 201 ERGI + E G D + R + F +EK++EA Sbjct: 844 DDRERGIGIESRFEKHLFGCQIDPFSQIEFQARFESFEDEKLLEA----------CEKFE 893 Query: 202 FRNRLIFPIRSSRGQVIAFGGRTLSKGESVKYLNSPETIL 241 FP R VI G + +K + P+ +L Sbjct: 894 AECAEKFPKRICLPLVIDINGHSTFCTRYLKPIAPPQELL 933 >gnl|CDD|38418 KOG3208, KOG3208, KOG3208, SNARE protein GS28 [Intracellular trafficking, secretion, and vesicular transport]. Length = 231 Score = 28.4 bits (63), Expect = 6.0 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 12/80 (15%) Query: 485 AALLLTLINHPAILQEQYQELADIRYDNNELQKLWSFLFS------------DFVEQKYF 532 AA++ TL H ILQ+ QE IR + + ++ S L S F + + Sbjct: 85 AAVMHTLQRHREILQDYTQEFRRIRSNIDAKRERESLLESVRADISSYPSASGFNRGEMY 144 Query: 533 LPEEIHQRLCERGFGELLKQ 552 L E H R EL+ Q Sbjct: 145 LKEHDHINNSIRLVDELISQ 164 >gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 300 Score = 28.3 bits (63), Expect = 7.6 Identities = 18/97 (18%), Positives = 41/97 (42%), Gaps = 19/97 (19%) Query: 532 FLPEEIHQRLCERGFGELLKQLDRQVRDAGLWSATTEANIVDVRQGYQQALALYKRFRLL 591 +LPEE RG + D+ A L + + ++ A +R ++ Sbjct: 76 YLPEE-------RGLYPKMTVEDQLKYLAELKG-------MPKAEIQKKLQAWLERLEIV 121 Query: 592 SRQKEEIEKQIAQVTAKGEAEKTAILISILHEVHIQI 628 ++ ++I++ +KG +K + +++HE + I Sbjct: 122 GKKTKKIKE-----LSKGNQQKIQFISAVIHEPELLI 153 >gnl|CDD|37202 KOG1991, KOG1991, KOG1991, Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure, Intracellular trafficking, secretion, and vesicular transport]. Length = 1010 Score = 27.9 bits (62), Expect = 7.6 Identities = 25/108 (23%), Positives = 37/108 (34%), Gaps = 10/108 (9%) Query: 466 LMQSSLVKGKLSKKPSLREAALLLTLINHPAILQEQYQELADIRYDNNELQKL-----WS 520 L L K KK R+ P ILQ L+ Y + ELQKL S Sbjct: 149 LCLYQLFKTYEWKKDEERQPLGEAVEELFPDILQIFNGLLSQESYQSVELQKLILKIFKS 208 Query: 521 FLFSD----FVEQKYFLP-EEIHQRLCERGFGELLKQLDRQVRDAGLW 563 ++ + + F E+ + R + LD + R + W Sbjct: 209 LIYYELPLELSAPETFTSWMELFLSILNRPVPVEVLSLDPEDRSSWPW 256 >gnl|CDD|31581 COG1391, GlnE, Glutamine synthetase adenylyltransferase [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms]. Length = 963 Score = 28.0 bits (62), Expect = 8.7 Identities = 20/112 (17%), Positives = 39/112 (34%), Gaps = 8/112 (7%) Query: 481 SLREAALLLTLINH--PAILQEQYQELADIRYDNNELQKLWSF-LFSDFVEQKYFLPEEI 537 +L EA L + H I EQ L + + L + F ++ F E E Sbjct: 386 NLTEAYEFLRRLEHRLQLIADEQTHTLPEDEEERRRLARAMGFADWAAFSEAL-----EE 440 Query: 538 HQRLCERGFGELLKQLDRQVRDAGLWSATTEANIVDVRQGYQQALALYKRFR 589 H + R F +L+ + + + + + E + + A ++ Sbjct: 441 HLKKVRRVFSQLIGDEEEESLLSEIGNLVWEGDEDEEDTLRTLAALGFEDPE 492 >gnl|CDD|145708 pfam02698, DUF218, DUF218 domain. This large family of proteins contains several highly conserved charged amino acids, suggesting this may be an enzymatic domain (Bateman A pers. obs). The family includes SanA, which is involved in Vancomycin resistance. This protein may be involved in murein synthesis. Length = 148 Score = 28.0 bits (63), Expect = 9.1 Identities = 11/47 (23%), Positives = 18/47 (38%), Gaps = 14/47 (29%) Query: 152 HAIEMFKLGYAP----------DSRYS----LREHLRQKGFSEEKII 184 A E+++ G AP S +R +L + G E I+ Sbjct: 21 AAAELYRAGPAPRIIVSGGAGGGEPVSEAEVMRRYLVELGVPAEAIL 67 >gnl|CDD|38409 KOG3199, KOG3199, KOG3199, Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism]. Length = 234 Score = 27.6 bits (61), Expect = 9.6 Identities = 27/112 (24%), Positives = 43/112 (38%), Gaps = 9/112 (8%) Query: 344 PGNRVNFVLLSRGEDPDSFIRCYGKTAFEKL--IVESLPLVDMLWKRETENRSFNTPDER 401 + V +LL G+ +SF E L I+ LV + + ++ D Sbjct: 119 TKSDVKVMLLCGGDLIESFGEPNLVWKDEDLRTILGEYGLVCVTREGSDVENFLSSHDII 178 Query: 402 AELE---IHLKN--CINHIKDQKLRYYYS--QAIRDRLQQLFQKYITEHSGY 446 E +H+KN N I KLR Q+++ +YI EH+ Y Sbjct: 179 LEKRRNILHIKNEIVPNDISSTKLRQAIRRGQSVKYLTPDSVIEYIREHNLY 230 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.413 Gapped Lambda K H 0.267 0.0741 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 8,076,040 Number of extensions: 442649 Number of successful extensions: 1247 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1237 Number of HSP's successfully gapped: 37 Length of query: 648 Length of database: 6,263,737 Length adjustment: 100 Effective length of query: 548 Effective length of database: 4,102,837 Effective search space: 2248354676 Effective search space used: 2248354676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (27.3 bits)