HHsearch alignment for GI: 254780836 and conserved domain: COG4123

>COG4123 Predicted O-methyltransferase [General function prediction only].
Probab=98.42  E-value=1.4e-06  Score=62.35  Aligned_cols=124  Identities=17%  Similarity=0.224  Sum_probs=70.0

Q ss_pred             CEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             4031176654046899999999985310053332255046666788999999989808875334566668234754579-
Q gi|254780836|r  206 IRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSK-  284 (674)
Q Consensus       206 ~~tIyDPaCGTGGmL~~a~~~i~~~~~~~~~~~~~~lyGQEin~~tyaIak~nMli~g~~~d~~~~~~~NI~~GdTL~~-  284 (674)
T Consensus        45 ~~~IlDlGaG~G~l~L~la---------~r~~-~a~I~~VEiq~~~a~~A~~nv~ln~l~~r------i~v~~~Di~~~~  108 (248)
T COG4123          45 KGRILDLGAGNGALGLLLA---------QRTE-KAKIVGVEIQEEAAEMAQRNVALNPLEER------IQVIEADIKEFL  108 (248)
T ss_pred             CCEEEEECCCCCHHHHHHH---------CCCC-CCCEEEEEECHHHHHHHHHHHHHCCCHHH------EEEEHHHHHHHH
T ss_conf             8769883689468999974---------5587-78079998179999999998861861340------167643088765


Q ss_pred             CCCCCCEEEEEEECCCCCCCCCC-CHHHHHHHHHCCCCCCCCCCCCCCCHHHH-HHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             99866418999816856765310-00111234422666653577774770659-9999999961466578807999738
Q gi|254780836|r  285 DLFTGKRFHYCLSNPPFGKKWEK-DKDAVEKEHKNGELGRFGPGLPKISDGSM-LFLMHLANKLELPPNGGGRAAIVLS  361 (674)
Q Consensus       285 d~~~~~kFD~vlaNPPFg~~Wk~-~~~~v~~e~~~~~~~Rf~~glP~~sdg~~-lFlqh~i~klk~~~~~ggr~aIV~n  361 (674)
T Consensus       109 ~~~~~~~fD~Ii~NPPyf~~~~~~~~~~~~~------~Ar~e~~------~~le~~i~~a~~~lk----~~G~l~~V~r  171 (248)
T COG4123         109 KALVFASFDLIICNPPYFKQGSRLNENPLRA------IARHEIT------LDLEDLIRAAAKLLK----PGGRLAFVHR  171 (248)
T ss_pred             HCCCCCCCCEEEECCCCCCCCCCCCCCHHHH------HHHHHHC------CCHHHHHHHHHHHCC----CCCEEEEEEC
T ss_conf             4236565478995989878753348674665------5663222------889999999999746----7978999955