HHsearch results for GI: 254780836 and protein with PDBid: 3g2m_A

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*
Probab=93.79  E-value=0.098  Score=29.39  Aligned_cols=106  Identities=16%  Similarity=0.148  Sum_probs=60.6

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31176654046899999999985310053332255046666788999999989808875334566668234754579998
Q gi|254780836|r  208 TLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLF  287 (674)
Q Consensus       208 tIyDPaCGTGGmL~~a~~~i~~~~~~~~~~~~~~lyGQEin~~tyaIak~nMli~g~~~d~~~~~~~NI~~GdTL~~d~~  287 (674)
                      +|+|-.||||.++....    +    .+    ..++|.|+++...++|+.+.--.+....    ..-....||-..-+  
T Consensus        85 ~vLDlGcG~G~~~~~la----~----~g----~~v~gvD~s~~ml~~a~~~~~~~~~~~~----~~~~~~~~d~~~~~--  146 (299)
T 3g2m_A           85 PVLELAAGMGRLTFPFL----D----LG----WEVTALELSTSVLAAFRKRLAEAPADVR----DRCTLVQGDMSAFA--  146 (299)
T ss_dssp             CEEEETCTTTTTHHHHH----T----TT----CCEEEEESCHHHHHHHHHHHHTSCHHHH----TTEEEEECBTTBCC--
T ss_pred             CEEEEECCCCHHHHHHH----H----CC----CEEEEEECCHHHHHHHHHHHHHCCCCCC----CCEEEEECCHHHCC--
T ss_conf             79999166778999999----7----79----9799996999999999999986476632----20447860321067--


Q ss_pred             CCCEEEEEEECC-CCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             664189998168-56765310001112344226666535777747706599999999961466578807999738
Q gi|254780836|r  288 TGKRFHYCLSNP-PFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLS  361 (674)
Q Consensus       288 ~~~kFD~vlaNP-PFg~~Wk~~~~~v~~e~~~~~~~Rf~~glP~~sdg~~lFlqh~i~klk~~~~~ggr~aIV~n  361 (674)
                      .+.+||.|++.- -+.  +                      +|+  .....+++.+-..|+|    ||+..+-+.
T Consensus       147 ~~~~fD~v~~~~~~~~--~----------------------~~~--~~~~~~l~~~~~~L~p----gG~l~~~~~  191 (299)
T 3g2m_A          147 LDKRFGTVVISSGSIN--E----------------------LDE--ADRRGLYASVREHLEP----GGKFLLSLA  191 (299)
T ss_dssp             CSCCEEEEEECHHHHT--T----------------------SCH--HHHHHHHHHHHHHEEE----EEEEEEEEE
T ss_pred             CCCCCCEEEEEECCCC--C----------------------CCH--HHHHHHHHHHHHHCCC----CCEEEEEEE
T ss_conf             4555312489713600--3----------------------661--8899999999998487----828999987