BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780838|ref|YP_003065251.1| hypothetical protein
CLIBASIA_03665 [Candidatus Liberibacter asiaticus str. psy62]
         (103 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780838|ref|YP_003065251.1| hypothetical protein CLIBASIA_03665 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 103

 Score =  207 bits (528), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFN 60
           MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFN
Sbjct: 1   MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFN 60

Query: 61  FASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE 103
           FASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE
Sbjct: 61  FASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE 103


>gi|254780327|ref|YP_003064740.1| preprotein translocase subunit SecA [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 890

 Score = 21.6 bits (44), Expect = 3.7,   Method: Composition-based stats.
 Identities = 7/26 (26%), Positives = 17/26 (65%)

Query: 60  NFASRSSYQQRSNILSHRKEIAIDQR 85
           NF +R +  +  ++L+ +++I  +QR
Sbjct: 635 NFETRKNLLKYDDVLNEQRKIIFEQR 660


>gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 1828

 Score = 21.2 bits (43), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 14/16 (87%)

Query: 65  SSYQQRSNILSHRKEI 80
           SSYQ+ SN++S R+++
Sbjct: 596 SSYQKVSNVISDREKL 611


>gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62]
          Length = 626

 Score = 20.8 bits (42), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 7/19 (36%), Positives = 12/19 (63%)

Query: 7   GFLAFLYAYGGSVVFSLFE 25
            F  + YA+G  +V SL++
Sbjct: 548 SFYVYAYAFGNCLVNSLYD 566


>gi|254780789|ref|YP_003065202.1| hypothetical protein CLIBASIA_03400 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 192

 Score = 20.4 bits (41), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 6/28 (21%)

Query: 18 SVVFSLFES------FFVEKEDGELFIR 39
          SV  SL E        FVE++DG + +R
Sbjct: 40 SVQISLLEEKNLLLQIFVERDDGNMTLR 67


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.326    0.140    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 63,412
Number of Sequences: 1233
Number of extensions: 2314
Number of successful extensions: 8
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of query: 103
length of database: 328,796
effective HSP length: 62
effective length of query: 41
effective length of database: 252,350
effective search space: 10346350
effective search space used: 10346350
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 32 (16.9 bits)