RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780839|ref|YP_003065252.1| hypothetical protein CLIBASIA_03670 [Candidatus Liberibacter asiaticus str. psy62] (32 letters) >2pqg_A Ribosome-inactivating protein 3; Pro-RIP, maize, hydrolase; 2.38A {Zea mays} PDB: 2pqi_A 2pqj_A* 2k6h_A Length = 265 Score = 25.0 bits (54), Expect = 4.7 Identities = 6/31 (19%), Positives = 12/31 (38%) Query: 2 NWGLLHFSVFKWSIIFDTGWNNPLGNGVKSK 32 W + + F+W+ + G+K K Sbjct: 219 KWDRISKAAFEWADHPTAVIPDMQKLGIKDK 249 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.141 0.519 Gapped Lambda K H 0.267 0.0538 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 312,539 Number of extensions: 5870 Number of successful extensions: 11 Number of sequences better than 10.0: 1 Number of HSP's gapped: 11 Number of HSP's successfully gapped: 1 Length of query: 32 Length of database: 5,693,230 Length adjustment: 6 Effective length of query: 26 Effective length of database: 5,547,766 Effective search space: 144241916 Effective search space used: 144241916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.5 bits)