RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780840|ref|YP_003065253.1| hypothetical protein CLIBASIA_03675 [Candidatus Liberibacter asiaticus str. psy62] (52 letters) >gnl|CDD|180941 PRK07352, PRK07352, F0F1 ATP synthase subunit B; Validated. Length = 174 Score = 29.2 bits (66), Expect = 0.22 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Query: 15 GIGLFLWDVLDGRVFQFYRVVVRIALIFEYGRRFIGNI 52 G GL L ++L+ + + + I L++ +GR F+G I Sbjct: 14 GFGLNL-NLLETNLIN---LAIVIGLLYYFGRGFLGKI 47 >gnl|CDD|185461 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional. Length = 400 Score = 24.6 bits (54), Expect = 5.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 12 ISHGIGLFLWDVLDGRVFQF 31 + G G+F+WDV + + F Sbjct: 17 LKRGKGVFVWDVEGKKYYDF 36 >gnl|CDD|162251 TIGR01209, TIGR01209, RNA ligase, Pab1020 family. Members of this family are found, so far, in a single copy per genome and largely in thermophiles, of which only Aquifex aeolicus is bacterial rather than archaeal. PSI-BLAST converges after a single iteration to the whole of this family and reveals no convincing similarity to any other protein. The member protein Pab1020 has been characterized as an RNA ligase with circularization activity. Length = 374 Score = 24.7 bits (54), Expect = 5.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Query: 4 YPFYFWGKISHGIGLFLWDVLDGRVFQFYRVVVRIALIFEYG 45 Y ++ ++ +G FL+D+ +G+ + V R+ L +YG Sbjct: 146 YTPEYYPEVKEDLGFFLFDIREGKTNRSLPVEERLELAEKYG 187 >gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional. Length = 431 Score = 24.2 bits (53), Expect = 8.0 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Query: 4 YPFYFWGKISHGIGLFLWDVLDGRVFQFY 32 YP G I G G +WDV DG + Y Sbjct: 26 YPELAPGFIQRGSGAHVWDV-DGNEYIEY 53 >gnl|CDD|150861 pfam10255, Paf67, RNA polymerase I-associated factor PAF67. RNA polymerase I is a multisubunit enzyme and its transcription competence is dependent on the presence of PAF67. This family of proteins is conserved from worms to humans. Length = 402 Score = 24.2 bits (53), Expect = 8.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 19 FLWDVLDGRVFQFY 32 +LWD++D V+QF Sbjct: 32 WLWDIIDEFVYQFQ 45 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.339 0.159 0.552 Gapped Lambda K H 0.267 0.0754 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 974,755 Number of extensions: 45044 Number of successful extensions: 142 Number of sequences better than 10.0: 1 Number of HSP's gapped: 142 Number of HSP's successfully gapped: 12 Length of query: 52 Length of database: 5,994,473 Length adjustment: 25 Effective length of query: 27 Effective length of database: 5,454,273 Effective search space: 147265371 Effective search space used: 147265371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 50 (23.0 bits)