RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780841|ref|YP_003065254.1| phosphatidylcholine synthase protein [Candidatus Liberibacter asiaticus str. psy62] (246 letters) >gnl|CDD|161896 TIGR00473, pssA, CDP-diacylglycerol--serine O-phosphatidyltransferase. This enzyme, CDP-diacylglycerol--serine O-phosphatidyltransferase, is involved in phospholipid biosynthesis catalyzing the reaction CDP-diacylglycerol + L-serine = CMP + L-1-phosphatidylserine. Members of this family do not bear any significant sequence similarity to the corresponding E.coli protein. Length = 151 Score = 36.7 bits (85), Expect = 0.006 Identities = 38/150 (25%), Positives = 66/150 (44%), Gaps = 8/150 (5%) Query: 24 TAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDN 83 T +F FL + + +Y IV + + L++ D DG +ARK G LD+ Sbjct: 1 TMLNAFSGFLSILSLLRYTIVRACFLILLSMFFDFLDGRVARKTNRVSDF----GKELDS 56 Query: 84 IIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKT-EEHFFSGFPA 142 + D +++ V PA Y + G VAA + + + A N+ + F G P Sbjct: 57 LADVVSFGVAPAALAYSIGNFQ-TIGILVAA-LFFLCGILRLARFNVLNVKLPSFIGLPI 114 Query: 143 -VWNMVVFSLIALNASVLVSTIVITTSVIL 171 ++V SL+ L + +L + SV++ Sbjct: 115 PFAALLVVSLVLLYSYLLAAIAACLLSVLM 144 >gnl|CDD|149172 pfam07948, Nairovirus_M, Nairovirus M polyprotein-like. The sequences in this family are similar to the Dugbe virus M polyprotein precursor, which includes glycoproteins G1 and G2. Both are thought to be inserted in the membrane of the Golgi complex of the infected host cell, and G1 is known to have a role in infection of vertebrate hosts. Length = 645 Score = 27.5 bits (61), Expect = 3.4 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 215 WFSFAFSVCGIYLYSIGAILQIFPNLGKK-RQY 246 WFSF + + I+ + +L + LGKK +QY Sbjct: 457 WFSFGYVITCIFCKVLFYLLIVIGTLGKKLKQY 489 >gnl|CDD|178545 PLN02960, PLN02960, alpha-amylase. Length = 897 Score = 27.1 bits (60), Expect = 4.1 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 6/55 (10%) Query: 162 TIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFV----CWCLL--GFYALISNF 210 T + S L F+ F HP RV R N F F W LL G +A + +F Sbjct: 722 TFTLGGSAYLNFMGNEFGHPERVEFPRASNNFSFSLANRRWDLLEDGVHAHLFSF 776 >gnl|CDD|173384 PTZ00090, PTZ00090, 40S ribosomal protein S11; Provisional. Length = 233 Score = 27.2 bits (60), Expect = 4.6 Identities = 24/72 (33%), Positives = 29/72 (40%), Gaps = 6/72 (8%) Query: 8 KNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQ------YRIVDMFWWLGLALIIDGFDG 61 KN H +V S + T FGSF +G Q YRI + L I D Sbjct: 127 KNNVHAQVVNKSKNYKTVFGSFAGNVGFRKKLQQSERCAYRIGENIAKKCRRLGIFAVDI 186 Query: 62 PIARKMRVKEVL 73 R MRV+ VL Sbjct: 187 KFRRIMRVETVL 198 >gnl|CDD|161876 TIGR00433, bioB, biotin synthetase. Catalyzes the last step of the biotin biosynthesis pathway. Length = 296 Score = 26.6 bits (59), Expect = 6.1 Identities = 8/26 (30%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Query: 174 VPVNFLHPIRVVRL---RPLNFFVFV 196 VP+NFL I+ L + L+ + Sbjct: 204 VPINFLVKIKGTPLADNKELSADDAL 229 >gnl|CDD|178468 PLN02880, PLN02880, tyrosine decarboxylase. Length = 490 Score = 26.4 bits (58), Expect = 6.7 Identities = 28/116 (24%), Positives = 46/116 (39%), Gaps = 25/116 (21%) Query: 69 VKEVLPNWSG---DTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYY 125 ++E+LP+ + +TLD ++D + +LP +Q S Y+ Sbjct: 47 LRELLPDSAPNQPETLDQVLDDVQAKILPGVTHWQ--------------------SPNYF 86 Query: 126 AY--TNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFL 179 AY +N A N+V FS I A+ + IV+ L +P FL Sbjct: 87 AYYPSNSSVAGFLGEMLSAGLNIVGFSWITSPAATELEMIVLDWLAKLLNLPEQFL 142 >gnl|CDD|163327 TIGR03564, F420_MSMEG_4879, F420-dependent oxidoreductase, MSMEG_4879 family. Coenzyme F420 is produced by methanogenic archaea, a number of the Actinomycetes (including Mycobacterium tuberculosis), and rare members of other lineages. The resulting information-rich phylogenetic profile identifies candidate F420-dependent oxidoreductases within the family of luciferase-like enzymes (pfam00296), where the species range for the subfamily encompasses many F420-positive genomes without straying beyond. This family is uncharacterized, and named for member MSMEG_4879 from Mycobacterium smegmatis. Length = 265 Score = 26.5 bits (59), Expect = 7.1 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Query: 139 GFPAVWNMVVFSLIALNASVL----VSTIVITTSVILTFVPVNFLHPI 182 G + W V+ AL A L V I + T+V VP HP+ Sbjct: 12 GLDSAWLGQVYGYDALTALALVGRAVPGIELGTAV----VPTYPRHPL 55 >gnl|CDD|152843 pfam12409, P_ATPase, P-type ATPase transporter. This domain family is found in eukaryotes, and is typically between 110 and 126 amino acids in length. The family is found in association with pfam00122, pfam00702. P-type ATPases comprise a large superfamily of proteins, present in both prokaryotes and eukaryotes, that transport inorganic cations and other substrates across cell membranes. Length = 114 Score = 26.4 bits (59), Expect = 7.8 Identities = 7/25 (28%), Positives = 10/25 (40%), Gaps = 5/25 (20%) Query: 192 FFVFVCWCLLGFYALISNFQVCRWF 216 + +C LG L+ RWF Sbjct: 19 LYYLLCVLTLGLLYLL-----LRWF 38 >gnl|CDD|180492 PRK06256, PRK06256, biotin synthase; Validated. Length = 336 Score = 25.9 bits (58), Expect = 9.3 Identities = 6/9 (66%), Positives = 9/9 (100%) Query: 174 VPVNFLHPI 182 +P+NFL+PI Sbjct: 233 IPINFLNPI 241 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.331 0.142 0.451 Gapped Lambda K H 0.267 0.0708 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,066,782 Number of extensions: 260340 Number of successful extensions: 727 Number of sequences better than 10.0: 1 Number of HSP's gapped: 724 Number of HSP's successfully gapped: 40 Length of query: 246 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 155 Effective length of database: 4,028,145 Effective search space: 624362475 Effective search space used: 624362475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 56 (25.4 bits)