>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate. 2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.

Probab=98.09 E-value=3.4e-06 Score=64.42 Aligned_cols=55 Identities=20% Similarity=0.289 Sum_probs=41.6 Q ss_pred EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEE---------EECHHHHHHHHHCCC Q ss_conf 2999979089999999999789859998288555578368---------887889999998899 Q gi|254780842|r 5 DVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTT---------MLMGEGIDFLKEINV 59 (384) Q Consensus 5 DV~IvGaG~aGl~lA~~L~~~g~~v~iiE~~~~~~~~r~~---------~l~~~s~~~L~~lGl 59 (384) T Consensus 145 rVAviGAGPAGLaCAD~L~RaGV~v~VfDRhP~iGGLLtFGIPsFKLdK~V~~~Rr~if~~MGi 208 (480) T TIGR01318 145 RVAVIGAGPAGLACADILARAGVQVVVFDRHPEIGGLLTFGIPSFKLDKAVLSRRREIFTAMGI 208 (480) T ss_pred EEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC T ss_conf 7899778860257999875178559997477030760136888511027899999999975892

HHsearch alignment for GI: 254780842 and conserved domain: TIGR01318