>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258 These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulphide. ; GO: 0004148 dihydrolipoyl dehydrogenase activity, 0050660 FAD binding, 0006118 electron transport.

Probab=98.63 E-value=3.7e-07 Score=71.48 Aligned_cols=58 Identities=36% Similarity=0.504 Sum_probs=42.2 Q ss_pred EEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEECH---HHHHHHHHCCCHHHHH Q ss_conf 0029999790899999999997898599982885555783688878---8999999889947888 Q gi|254780842|r 3 HFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMG---EGIDFLKEINVWDFLQ 64 (384) Q Consensus 3 ~~DV~IvGaG~aGl~lA~~L~~~g~~v~iiE~~~~~~~~r~~~l~~---~s~~~L~~lGl~~~l~ 64 (384) T Consensus 1 ~yD~vViGgGPGGYVAAIrAAQlG~KValvEK~~l----GGtCLN~GCIPtKaLL~~ae~~~~~~ 61 (481) T TIGR01350 1 EYDVVVIGGGPGGYVAAIRAAQLGLKVALVEKEKL----GGTCLNVGCIPTKALLHSAEVYDEIK 61 (481) T ss_pred CCCEEEECCCCCHHHHHHHHHHCCCEEEEEEECCC----CCEEECCCCCCCHHHHHHHHHHHHHH T ss_conf 95189987787727999999864980899980356----87487277675478877667899999

HHsearch alignment for GI: 254780842 and conserved domain: TIGR01350