BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] (113 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] gi|254040521|gb|ACT57317.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 228 bits (582), Expect = 2e-58, Method: Composition-based stats. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL Sbjct: 1 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60 Query: 61 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF Sbjct: 61 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113 >gi|315122731|ref|YP_004063220.1| hypothetical protein CKC_04915 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496133|gb|ADR52732.1| hypothetical protein CKC_04915 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 105 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 7/109 (6%) Query: 3 LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVG 62 +R + ++ C+L +Q FCS A + ++ S T+ PL Q Sbjct: 1 MRFVHKKMIFCVLILQYWAAFCSYSIALQTHEIASESATIGEENF----PLERADGQKEK 56 Query: 63 ATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYY 111 + S+ + ++ SN++D + PK T++IL+ FPLP PP +YY Sbjct: 57 PSYQSKKDVINKNILVLSNKKDLK---KPKNTESILDTFPLPPPPAKYY 102 >gi|77165579|ref|YP_344104.1| hypothetical protein Noc_2114 [Nitrosococcus oceani ATCC 19707] gi|254434205|ref|ZP_05047713.1| conserved hypothetical protein [Nitrosococcus oceani AFC27] gi|76883893|gb|ABA58574.1| Protein of unknown function DUF1631 [Nitrosococcus oceani ATCC 19707] gi|207090538|gb|EDZ67809.1| conserved hypothetical protein [Nitrosococcus oceani AFC27] Length = 787 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%) Query: 66 HSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPL 105 +S ++ +HD+P SS + + G PSP+K K + EL +PL Sbjct: 665 NSRSREETHDIPLSSPIKQKSGPPSPEKDKYLQELAAVPL 704 >gi|308497664|ref|XP_003111019.1| hypothetical protein CRE_04544 [Caenorhabditis remanei] gi|308242899|gb|EFO86851.1| hypothetical protein CRE_04544 [Caenorhabditis remanei] Length = 587 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 9/71 (12%) Query: 42 VALNVLSPLAPLGDGCEQL-----VGATVHSEGKKRSHD----VPSSSNQEDQRGSPSPK 92 +A +VL P P+G+ L V + G+ SH + +S++Q +R SPSP+ Sbjct: 186 LAEDVLEPEQPIGNTSPSLKYDYVVIQPQVNHGRTSSHQTHQPIQNSASQYSRRKSPSPR 245 Query: 93 KTKNILELFPL 103 +T+ I+ +PL Sbjct: 246 ETEAIVRTYPL 256 >gi|52080235|ref|YP_079026.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580] gi|52785612|ref|YP_091441.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580] gi|319645986|ref|ZP_08000216.1| FliY protein [Bacillus sp. BT1B_CT2] gi|52003446|gb|AAU23388.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580] gi|52348114|gb|AAU40748.1| FliY [Bacillus licheniformis ATCC 14580] gi|317391736|gb|EFV72533.1| FliY protein [Bacillus sp. BT1B_CT2] Length = 377 Score = 34.6 bits (78), Expect = 3.9, Method: Composition-based stats. Identities = 19/76 (25%), Positives = 36/76 (47%) Query: 38 YPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNI 97 YP T A +++ L G E + V + +++ P+S+ + QR P+PK+ Sbjct: 207 YPLTFAKDLIDELTNQDGGEEPVKTEEVQTPVQEKPAPNPNSAPAQTQRQEPAPKRQGTA 266 Query: 98 LELFPLPLPPTQYYSF 113 P+ + P ++ SF Sbjct: 267 KVSEPVQVAPAEFQSF 282 >gi|320588768|gb|EFX01236.1| transporter protein smf2 [Grosmannia clavigera kw1407] Length = 651 Score = 34.6 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 3 LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGC 57 L ACR L C L++ VL +EI A T +ALN+L P PL GC Sbjct: 223 LAEACRAFLPCWLNVTLYVL--AEIAIIATDIAEVIGTAIALNLLQPKIPLVAGC 275 >gi|296227920|ref|XP_002759573.1| PREDICTED: 5'-3' exoribonuclease 1 isoform 2 [Callithrix jacchus] Length = 1706 Score = 34.3 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 67 SEGKKRSHDVPSSSNQEDQRGSPS-PKKTKNILELFPLPLPPTQYYS 112 +E K+ H++P SSN+ D+ G PS PK+ K + P +Y++ Sbjct: 1375 NEMKQIGHEIPVSSNRRDEYGLPSQPKQNKKLASYVNKPHSANEYHN 1421 >gi|296227918|ref|XP_002759572.1| PREDICTED: 5'-3' exoribonuclease 1 isoform 1 [Callithrix jacchus] Length = 1694 Score = 34.3 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 67 SEGKKRSHDVPSSSNQEDQRGSPS-PKKTKNILELFPLPLPPTQYYS 112 +E K+ H++P SSN+ D+ G PS PK+ K + P +Y++ Sbjct: 1376 NEMKQIGHEIPVSSNRRDEYGLPSQPKQNKKLASYVNKPHSANEYHN 1422 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.136 0.412 Lambda K H 0.267 0.0419 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,145,938,904 Number of Sequences: 14124377 Number of extensions: 46679618 Number of successful extensions: 118116 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 118108 Number of HSP's gapped (non-prelim): 12 length of query: 113 length of database: 4,842,793,630 effective HSP length: 81 effective length of query: 32 effective length of database: 3,698,719,093 effective search space: 118359010976 effective search space used: 118359010976 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 75 (33.5 bits)