RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] (113 letters) >gnl|CDD|185234 PRK15334, PRK15334, antigen presentation protein SpaN; Provisional. Length = 336 Score = 28.6 bits (63), Expect = 0.35 Identities = 15/49 (30%), Positives = 21/49 (42%) Query: 60 LVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPT 108 + G V EG + DV + G P K K + ++ LPL PT Sbjct: 174 IAGEGVRKEGAPLARDVAPARMAAANTGKPDDKDHKKVKDVSQLPLQPT 222 >gnl|CDD|129987 TIGR00909, 2A0306, amino acid transporter. Length = 429 Score = 27.4 bits (61), Expect = 0.95 Identities = 13/62 (20%), Positives = 23/62 (37%), Gaps = 11/62 (17%) Query: 4 RSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGA 63 S N ++ +L + L+LF + + +Y +P P+G G A Sbjct: 154 ESGKVNDILVVLKVAALLLFA--ALGAIHFASNNY---------TPFMPMGFGGVGAATA 202 Query: 64 TV 65 V Sbjct: 203 LV 204 >gnl|CDD|181802 PRK09367, PRK09367, histidine ammonia-lyase; Provisional. Length = 500 Score = 26.6 bits (60), Expect = 1.4 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 5/23 (21%) Query: 67 SEGKKRSH----D-VPSSSNQED 84 SE K +H D +P+S+NQED Sbjct: 392 SENKTLAHPASVDSIPTSANQED 414 >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR). This family consists of several bovine specific leukaemia virus receptors which are thought to function as transmembrane proteins, although their exact function is unknown. Length = 561 Score = 25.8 bits (56), Expect = 2.3 Identities = 12/45 (26%), Positives = 18/45 (40%) Query: 51 APLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTK 95 A + + E + TV D P + E+ + SP KK K Sbjct: 240 ASVAEADEASLANTVSGTAPDSEPDEPKDAEAEETKKSPKHKKKK 284 >gnl|CDD|162347 TIGR01415, trpB_rel, pyridoxal-phosphate dependent TrpB-like enzyme. This model represents a family of pyridoxal-phosphate dependent enzyme (pfam00291) closely related to the beta subunit of tryptophan synthase (TIGR00263). However, the only case in which a member of this family replaces a member of TIGR00263 is in Sulfolobus species which contain two sequences which hit this model, one of which is proximal to the alpha subunit. In every other case so far, either the species appears not to make tryptophan (there is no trp synthase alpha subunit), or a trp synthase beta subunit matching TIGR00263 is also found. Length = 419 Score = 25.1 bits (55), Expect = 4.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 91 PKKTKNILELFPLPLPP 107 PK NIL P PLPP Sbjct: 2 PKHWYNILPDLPEPLPP 18 >gnl|CDD|130292 TIGR01225, hutH, histidine ammonia-lyase. This enzyme deaminates histidine to urocanic acid, the first step in histidine degradation. It is closely related to phenylalanine ammonia-lyase. Length = 506 Score = 25.0 bits (55), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Query: 59 QLVGATVHSEGKKRSH-----DVPSSSNQED 84 Q A + SE K SH +P+S+NQED Sbjct: 382 QYTAAALVSENKALSHPASVDSIPTSANQED 412 >gnl|CDD|151665 pfam11223, DUF3020, Protein of unknown function (DUF3020). This family of fungal proteins is conserved towards the C-terminus of HMG domains. The function is not known. Length = 49 Score = 24.9 bits (54), Expect = 4.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 68 EGKKRSHDVPSSSNQEDQRGSPSPKKTK 95 E KK+ + S N+++ S KK K Sbjct: 3 ERKKKWREANSERNKDNDLRSRVKKKAK 30 >gnl|CDD|163241 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate dehydrogenase, anaerobic, A subunit. Members of this protein family are the A subunit, product of the glpA gene, of a three-subunit, membrane-anchored, FAD-dependent anaerobic glycerol-3-phosphate dehydrogenase. Length = 516 Score = 24.6 bits (54), Expect = 6.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Query: 69 GKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLP 106 KK +D P + E GS P K + +L LP P Sbjct: 345 CKKLGNDRPCRTADEPLPGSEDPTAVKTLKKLISLPSP 382 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0722 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,757,562 Number of extensions: 91838 Number of successful extensions: 142 Number of sequences better than 10.0: 1 Number of HSP's gapped: 142 Number of HSP's successfully gapped: 11 Length of query: 113 Length of database: 5,994,473 Length adjustment: 78 Effective length of query: 35 Effective length of database: 4,309,049 Effective search space: 150816715 Effective search space used: 150816715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)