>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family; InterPro: IPR006349 This family of sequences represent 2-phosphoglycolate phosphatase which is limited to the eukaryotic lineage. PGP is an essential enzyme in the glycolate salvage pathway in higher organisms (photorespiration in plants). Phosphoglycolate results from the oxidase activity of RubisCO in the Calvin cycle when concentrations of carbon dioxide are low relative to oxygen. In mammals, PGP is found in many tissues, notably in red blood cells where P-glycolate is and important activator of the hydrolysis of 2,3-bisphosphoglycerate, a major modifier of the oxygen affinity of hemoglobin. The PGPase enzyme described here is a member of the Haloacid dehalogenase superfamily of hydrolase enzymes. Unlike the bacterial PGP equivalog (IPR006346 from INTERPRO), which is a member of class (subfamily) I, this enzyme is a member of class (subfamily) II . These two enzymes have almost certainly arisen from convergent evolution (although these two ancestors may themselves have diverged from a more distant HAD superfamily progenitor). One of the sequences in the group comes from Chlamydomonas reinhardtii, a photosynthetic alga. The enzyme has been purified and characterised and these data are fully consistent with the assignment of function as a PGPase involved in photorespiration . Another, from Homo sapiens, is supported as a member of the family indirectly. Biochemical characterization of partially purified PGP's from various tissues including red blood cells have been performed while one gene for PGP has been localized to chromosome 16p13.3 . The Homo sapiens sequence maps to chromosome 22. There is indeed a related gene on chromosome 16 (and it is expressed, since EST's are found) which shows 46 0dentity and 59603b08ositives by BLAST2 (E=1e-66). Presumably, these two genes are isoforms and have the same catalytic function while being expressed in different tissues and may be differently regulated. The sequence from Caenorhabditis elegans, is only supported by sequence similarity. This family is closely related to a family of bacterial sequences including the Escherichia coli NagD and Bacillus subtilus AraL genes which are characterised by the ability to hydrolyze para-nitrophenylphosphate (pNPPases or NPPases). The Chlamydomonas reinhardtii PGPase does not catalyze this reaction and so presumably these two groups have different functions and substrate specificities. Many of the genes in this family have been annotated as pNPPases due to this association.; GO: 0016791 phosphoric monoester hydrolase activity, 0008152 metabolic process.

Probab=100.00 E-value=0 Score=389.39 Aligned_cols=249 Identities=25% Similarity=0.391 Sum_probs=210.5 Q ss_pred CCCEEEEECCCEEEECCCCCCCHHHHHHHHHHCCCCEEEECCCC-CCHHHHHHHHHHCCCCCHHCCCCCCHHHHHHHHHH Q ss_conf 17999992744323188148627999999998798199985989-99589999875127770000135687999999998 Q gi|254780847|r 14 YYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSP-RPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLV 92 (282) Q Consensus 14 ~yd~~lfD~DGvL~~g~~~ipgA~e~l~~L~~~g~~~~~lTN~s-~~~~~~~~~L~~lG~~~~~~d~I~ts~~~~~~~l~ 92 (282) T Consensus 1 ~~~~fiFDcDGVlWlGe~v~pG~Pelld~L~~~gK~~~fvtNNstksRa~ya~kfa~LG~n~~-ae~l~ssa~~aA~~L~ 79 (288) T TIGR01452 1 KVETFIFDCDGVLWLGEKVVPGAPELLDRLAKAGKKVLFVTNNSTKSRAEYAKKFAKLGYNSV-AEELFSSALVAAALLR 79 (288) T ss_pred CCEEEEECCCCEEECCCEECCCCHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCH-HHHHCCHHHHHHHHHH T ss_conf 920689747734635864137872789999745987999816864104899999975177602-4552267899999998 Q ss_pred HH-------CCCCCCCCCCCHHHHHHCCCCCCCCCCC-------------------CCC--EEEEECCCCCCCCHHHHHH Q ss_conf 53-------1654543872521243117973157556-------------------786--8998437710011799999 Q gi|254780847|r 93 EE-------SHNIFFIGPQRDYALLEKLNIKIVNEQH-------------------AET--ILCTGLYDDEKDKTEDYRM 144 (282) Q Consensus 93 ~~-------~~~v~viG~~~~~~~l~~~g~~~~~~~~-------------------~~~--iv~~g~~~~~~~~~~~~~~ 144 (282) T Consensus 80 ~rlPG~~~~~k~VyviGe~Glr~Eld~~Gir~~G~p~~~d~~~~~~SG~FMydi~~~~~VgAVvVGy-----d~hf~y~K 154 (288) T TIGR01452 80 RRLPGAIDANKKVYVIGEEGLREELDEKGIRYVGDPSEKDKKAARKSGEFMYDIKLDEDVGAVVVGY-----DKHFDYVK 154 (288) T ss_pred HHCCCCCCCCCEEEEECCCCHHHHHHHHCCHHCCCCCCCCCHHHHCCCCHHEECCCCCCCCEEEEEH-----HHHCCHHH T ss_conf 7377888888628997770268899871602117886010011210451010011046731489711-----12214389 Q ss_pred HHHH---HHH-CCCCEEECCCCCCCCCCC--CHHHHHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHHHHHHHCCCCCC Q ss_conf 9999---973-057403126643225663--001104899998875047-653234777025899999865431488900 Q gi|254780847|r 145 LLER---FAH-RHIPLICANPDIVANRGN--KIIPCAGALALIYQQLNG-IVKMIGKPHLPIYEMAFKKISSLCNSFNKK 217 (282) Q Consensus 145 l~~~---~~~-~~~~~i~~N~D~~~p~~~--~~~~~~G~~~~~~~~~~g-~~~~~GKP~~~~~~~a~~~l~~~~~~~~~~ 217 (282) T Consensus 155 ~~~A~~~lRenpgclfvATnrD~~~pl~dP~~~~pg~Gs~vaAi~~asgR~plvVGKPs~~mf~~I~~~~-----~i~P~ 229 (288) T TIGR01452 155 LRKASAYLRENPGCLFVATNRDEVTPLSDPESEIPGAGSLVAAIKTASGREPLVVGKPSDYMFEYIKEKL-----SIDPA 229 (288) T ss_pred HHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCEEECCCCHHHHHHHHHHH-----CCCCC T ss_conf 9999976208996379872778888897612225898850201202468724365589847899988751-----78801 Q ss_pred CEEEECCCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCEECHHH Q ss_conf 0899738857889999976996999718678777842048898899989986089884230421 Q gi|254780847|r 218 RILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQL 281 (282) Q Consensus 218 ~~lmIGD~l~tDI~gA~~~G~~silV~tG~~~~~~~~~~~~~~~~i~~~~~~~~~~P~~~~~~l 281 (282) T Consensus 230 r~~MvGDRl~TDi~FG~~~Gm~T~LvLsGv~~~E~~~e~l~--------~~~~d~vPdyv~~sl 285 (288) T TIGR01452 230 RTLMVGDRLETDILFGKDGGMKTVLVLSGVSRLEDIIEVLA--------AEDDDLVPDYVVESL 285 (288) T ss_pred CEEEECCCCHHHHHHCCCCCHHHHHHHHCCHHHHHHHHHHC--------CCCCCCCCCHHCCCC T ss_conf 26775177202245321142113454506114666899864--------888870652010000

HHsearch alignment for GI: 254780847 and conserved domain: TIGR01452