>TIGR01675 plant-AP plant acid phosphatase; InterPro: IPR010028 This entry represents a family of acid phosphatase , from plants which are closely related to the class B non-specific acid phosphatase OlpA (IPR006423 from INTERPRO, which is believed to be a 5'-nucleotide phosphatase) and somewhat more distantly to another class B phosphatase, AphA (IPR010025 from INTERPRO). Together these three clades define a subfamily of Acid phosphatase (Class B), which corresponds to the IIIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate nucleophile hydrolases. It has been reported that the best substrates were purine 5'-nucleoside phosphates . This is in concordance with the assignment of the Haemophilus influenzae hel protein (from IPR006423 from INTERPRO) as a 5'-nucleotidase, however there is presently no other evidence to support this specific function for this family of plant phosphatases. Many genes from this family have been annotated as vegetative storage proteins (VSPs) due to their close homology with these earlier-characterised gene products which are highly expressed in leaves. There are significant differences however, including expression levels and distribution . The most important difference is the lack in authentic VSPs of the nucleophilic aspartate residue, which is instead replaced by serine, glycine or asparagine. Thus these proteins can not be expected to be active phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP . In 1994 this assertion was refuted by the separation of the activity from the VSP. This entry explicitly excludes the VSPs which lack the nucleophilic aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases.; GO: 0003993 acid phosphatase activity.

Probab=90.21  E-value=0.67  Score=26.18  Aligned_cols=67  Identities=22%  Similarity=0.412  Sum_probs=52.0

Q ss_pred             H-CCCE---EEEECCCEEEE---------------------------CCC--CCCCHHHHHHHHHHCCCCEEEECCCC--
Q ss_conf             4-1799---99927443231---------------------------881--48627999999998798199985989--
Q gi|254780847|r   13 P-YYDV---ILCDVWGVLHN---------------------------GQK--FLPGTIPALKEARENGLKVILFTNSP--   57 (282)
Q Consensus        13 ~-~yd~---~lfD~DGvL~~---------------------------g~~--~ipgA~e~l~~L~~~g~~~~~lTN~s--   57 (282)
T Consensus        79 DPg~DanatWIFDvDdTlLS~~pYY~k~gfyG~e~~D~~~F~~W~~~G~atPAlp~~l~LY~~~~~lG~K~flls~R~et  158 (245)
T TIGR01675        79 DPGMDANATWIFDVDDTLLSNVPYYKKHGFYGLEKTDPTAFEEWLEKGKATPALPEVLKLYQKILELGIKVFLLSGRKET  158 (245)
T ss_pred             CCCCCCCCEEEECCCHHHHCCCCHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             87765540355102001134761111376215765785468999865867888632679999999818708897178721


Q ss_pred             -C-CHHHHHHHHHHCCCCCHHCCCCC
Q ss_conf             -9-95899998751277700001356
Q gi|254780847|r   58 -R-PSASVISQIQSLGSSSQFWDDII   81 (282)
Q Consensus        58 -~-~~~~~~~~L~~lG~~~~~~d~I~   81 (282)
T Consensus       159 P~tlR~aT~~NL~~~Gf~~--W~~LI  182 (245)
T TIGR01675       159 PETLRSATVDNLINAGFTG--WEKLI  182 (245)
T ss_pred             CHHHHHHHHHHHHHCCCCH--HHHHC
T ss_conf             0467888899988534113--66603