RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] (111 letters) >1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Length = 97 Score = 94.8 bits (236), Expect = 4e-21 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68 +RP RV+V+R + E K+A G I++ + + K + GE++ VG G + ++G+V +V Sbjct: 3 IRPLHDRVIVKRKEVETKSAGG-IVLTGSAAAKST--RGEVLAVGNGRILENGEVKPLDV 59 Query: 69 SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104 GDIV+F G + + D EE L+M ESDI+ IV Sbjct: 60 KVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIV 95 >3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Length = 95 Score = 89.8 bits (223), Expect = 1e-19 Identities = 34/96 (35%), Positives = 62/96 (64%), Gaps = 4/96 (4%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68 ++P RVVV+ ++++ +A G I+IPD+ EK + GE++ +GAG +G + P V Sbjct: 3 IKPLHDRVVVKPIEADEVSAGG-IVIPDSAKEKST--KGEVVAIGAGKPLDNGSLHAPVV 59 Query: 69 SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104 GD V++G+++G+ K +G EY V++E DI+ ++ Sbjct: 60 KVGDKVIYGQYAGSSYKS-EGVEYKVLREDDILAVI 94 >1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Length = 99 Score = 86.4 bits (214), Expect = 1e-18 Identities = 37/99 (37%), Positives = 65/99 (65%), Gaps = 5/99 (5%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67 ++P +++V+ ++E TA+G ++IPDT EKP G ++ VG G D+ G+ P + Sbjct: 5 IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 61 Query: 68 VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106 V++GD V++ K+ GTEIK +GEEYL++ D++ +V + Sbjct: 62 VAEGDTVIYSKYGGTEIKY-NGEEYLILSARDVLAVVSK 99 >1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Length = 100 Score = 82.7 bits (204), Expect = 2e-17 Identities = 43/102 (42%), Positives = 70/102 (68%), Gaps = 4/102 (3%) Query: 3 GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62 E K ++P RVVV+R++ E KT G I++PDT EKP G+++ VG G + ++G+ Sbjct: 2 AEVKTVIKPLGDRVVVKRIEEEPKTK-GGIVLPDTAKEKPQ--KGKVIAVGTGRVLENGQ 58 Query: 63 VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104 + EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++ Sbjct: 59 RVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 99 >2kr0_A Proteasomal ubiquitin receptor ADRM1; proteasome, 19S regulator, protein binding; NMR {Homo sapiens} Length = 411 Score = 31.1 bits (69), Expect = 0.064 Identities = 13/48 (27%), Positives = 20/48 (41%) Query: 29 TGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLF 76 T L P V AS+ ++ AG M G + P+ KG + + Sbjct: 7 TSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQ 54 >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Score = 30.2 bits (67), Expect = 0.11 Identities = 15/64 (23%), Positives = 26/64 (40%), Gaps = 18/64 (28%) Query: 21 LQSEIKTATGNILIPDTVSEKPSASSGEIMW------------------VGAGVMDQSGK 62 + + +K TG ++ P T+S+ S + +I W +G G SG Sbjct: 400 IPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGT 459 Query: 63 VIEP 66 V +P Sbjct: 460 VTQP 463 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 30.3 bits (68), Expect = 0.12 Identities = 15/122 (12%), Positives = 28/122 (22%), Gaps = 66/122 (54%) Query: 5 HKNYLRPTRGRVVVRRLQSEIK------------TATG--------NILIPDTVS----- 39 H + L P + +++ + T G +I V Sbjct: 428 HSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSI-SERIVDCIIRL 486 Query: 40 ----EK-------------PSASSGEIMWVG----------------AGVMDQSGKVIEP 66 E P +SG +G AG +D + + Sbjct: 487 PVKWETTTQFKATHILDFGPGGASG----LGVLTHRNKDGTGVRVIVAGTLDIN---PDD 539 Query: 67 EV 68 + Sbjct: 540 DY 541 >1iqv_A Ribosomal protein S7; RNA-binding, decoding center, helix-turn- helix, ribosome; 2.10A {Pyrococcus horikoshii} SCOP: a.75.1.1 Length = 218 Score = 29.8 bits (67), Expect = 0.15 Identities = 6/24 (25%), Positives = 13/24 (54%) Query: 65 EPEVSKGDIVLFGKWSGTEIKLND 88 E +I + G+WS ++++ D Sbjct: 10 ERFFIPHEIKVMGRWSTEDVEVKD 33 >2zkq_g 40S ribosomal protein S5E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 204 Score = 27.6 bits (61), Expect = 0.68 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 62 KVIEPEVSK-GDIVLFGKWSGTEIKLND 88 + P V++ DI LFGKWS ++++ND Sbjct: 5 ETAAPAVAETPDIKLFGKWSTDDVQIND 32 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.5 bits (57), Expect = 1.5 Identities = 6/26 (23%), Positives = 12/26 (46%), Gaps = 8/26 (30%) Query: 18 VRRLQSEIKTATGNILIPDTVSEKPS 43 +++LQ+ +K L D P+ Sbjct: 22 LKKLQASLK------LYAD--DSAPA 39 >2r2y_A Protein ADRM1; proteasome, ubiquitin, PH-domain, 19S regulator, receptor, ubiquitin-proteasome-degradation pathway; 1.70A {Mus musculus} PDB: 2z59_A Length = 153 Score = 26.3 bits (58), Expect = 1.6 Identities = 12/50 (24%), Positives = 21/50 (42%) Query: 27 TATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLF 76 + T L P V +S+ ++ AG M G + P+ KG + + Sbjct: 4 STTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQ 53 >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, cytoplasm, DNA-binding, transcription; HET: PAM; 1.90A {Vibrio cholerae O395} Length = 276 Score = 25.5 bits (55), Expect = 3.2 Identities = 6/33 (18%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Query: 48 EIMWV--GAGVMDQSGKVIEPEVSKGDIVLFGK 78 ++ W+ G + ++ E++ I+L K Sbjct: 31 KMFWIDSGIAKLIDKNCLVSYEINSSSIILLKK 63 >3euk_L Chromosome partition protein MUKE; MUKB, MUKF, chromosome condensation, condensin, SMC, non-SMC subunit, ABC-type ATPase, WHD, ATP; HET: ATG; 4.00A {Haemophilus ducreyi} Length = 238 Score = 25.2 bits (55), Expect = 3.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 8 YLRPTRGRVVVRRLQSEIKTATGNIL 33 YLRP ++ R SE++ G +L Sbjct: 73 YLRPKASTLIARSAMSEMEMLVGKVL 98 >3euh_C MUKE, chromosome partition protein MUKF; chromosome condensation, condensin, non-SMC subunit, kleisin, calcium, cell cycle, cell division; 2.90A {Escherichia coli} Length = 234 Score = 25.2 bits (55), Expect = 3.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 8 YLRPTRGRVVVRRLQSEIKTATGNIL 33 YLRP ++ R + SE+ G IL Sbjct: 74 YLRPRSTTLIPRSVLSELDMMVGKIL 99 >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Score = 24.6 bits (53), Expect = 5.7 Identities = 14/51 (27%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Query: 24 EIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74 I N+ V K S+ +GA + G V E +VS G+ V Sbjct: 1054 RIYIKDENVHTNANVKPKADKSNPSH--IGAQM---PGSVTEVKVSVGETV 1099 >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Length = 1165 Score = 24.3 bits (52), Expect = 6.1 Identities = 10/40 (25%), Positives = 14/40 (35%), Gaps = 3/40 (7%) Query: 35 PDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74 + + A G VGA + G + VS G V Sbjct: 1081 ATGAAVRRKAEPGNAAHVGAPM---PGVISRVFVSSGQAV 1117 >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Score = 24.4 bits (52), Expect = 6.6 Identities = 11/51 (21%), Positives = 16/51 (31%), Gaps = 5/51 (9%) Query: 24 EIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74 I + K +GA + GKVI+ +V G V Sbjct: 626 SILVKDTQAMKEMHFHPKALKDVKGQ--IGAPM---PGKVIDIKVVAGAKV 671 >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Score = 23.8 bits (51), Expect = 8.9 Identities = 7/36 (19%), Positives = 14/36 (38%) Query: 43 SASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGK 78 S SSG ++ V D + +V+ + + Sbjct: 3 SGSSGMLITVYCVRRDLTEVTFSLQVNPDFELSNFR 38 >2psb_A YERB protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, unknown function; 2.10A {Bacillus subtilis} SCOP: c.153.1.1 Length = 320 Score = 23.8 bits (51), Expect = 8.9 Identities = 18/90 (20%), Positives = 31/90 (34%), Gaps = 6/90 (6%) Query: 4 EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSG--EIMWVGAG--VMDQ 59 + + Y R + G + R + NI I S G +I G ++ Q Sbjct: 204 KAEFYTRSSDGVITTDRETGKPVAMQ-NIFI-VEASHHIIDQDGRRDIDLESGGKGLLFQ 261 Query: 60 SGKVIEPEVSKGDIVLFGKWSGTEIKLNDG 89 G VIE + + + + G + G Sbjct: 262 HGNVIETDWKQVNGRIVPVKDGKWLPFVPG 291 >3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage on PAIR of basic residues, complement alternate pathway, complement pathway; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 1xwe_A Length = 1676 Score = 23.7 bits (50), Expect = 10.0 Identities = 9/30 (30%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 67 EVSKGDIVLF-GKWSGTEIKLNDGEEYLVM 95 K + F K + T +L G +YL+M Sbjct: 1591 VAEKDSEITFIKKVTCTNAELVKGRQYLIM 1620 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.311 0.132 0.371 Gapped Lambda K H 0.267 0.0648 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 962,018 Number of extensions: 39836 Number of successful extensions: 99 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 26 Length of query: 111 Length of database: 5,693,230 Length adjustment: 75 Effective length of query: 36 Effective length of database: 3,874,930 Effective search space: 139497480 Effective search space used: 139497480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.2 bits)