HHsearch alignment for GI: 254780849 and conserved domain: KOG0359

>KOG0359 consensus.
Probab=100.00  E-value=0  Score=505.25  Aligned_cols=468  Identities=20%  Similarity=0.290  Sum_probs=385.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             89999999999999999773678986359888589983883208887776034785225788999999986625518866
Q gi|254780849|r   10 TAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGT   89 (551)
Q Consensus        10 ~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGT   89 (551)
T Consensus        16 ~~al~~nis~a~glq~Vl~snlGPkgt~kmlvsgagdIkltkdgnvLl~EmQiqhPT----a~~IakaatAqdd~tGDGt   91 (520)
T KOG0359          16 QAALALNISAAIGLQSVLVLNLGPKGTEKMLVSGAGDIKLAKDGNVLLKEMQIQHPT----ASLIAKVATAQDDITGDGT   91 (520)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCEEEEECHHHHHHHHHHCCCH----HHHHHHHHHHHHCCCCCCC
T ss_conf             131100257766778877514698623554258756369973325787888634714----8889988875112357875


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH------HHHHHHHH
Q ss_conf             679999999999999999769889999998986447777676532221276024222122555334------56888999
Q gi|254780849|r   90 TTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGD------REIGEKIA  163 (551)
Q Consensus        90 TtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~------~~l~~li~  163 (551)
T Consensus        92 ts~V~ligEllkqa~~~i~eGlhprii~~gfe~a~~~~l~~L~k~~~~~-~~~~L~~va~tsl~TKv~a~la~~lt~~vv  170 (520)
T KOG0359          92 TSVVLLIGELLKQADRYISEGLHPRIITEGFEAAKNKALEFLEKVSREV-DRETLKDVARTSLRTKVHAELADVLTPIVV  170 (520)
T ss_pred             CEEEEEEHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             2189970888877998865479952210178898898886652135355-589999988876247356777768689987


Q ss_pred             HHHHHCC-------CCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHH
Q ss_conf             9998424-------320001101465520333302320011224765423310134441131022013564410011146
Q gi|254780849|r  164 YAMEQIG-------PHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPI  236 (551)
Q Consensus       164 ~A~~~i~-------~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~  236 (551)
T Consensus       171 ~aVL~i~~~~~~iDl~MvEim~Mqh~s~~dT~lv~GLvLDHG~RHp-------dMp~~~e~a~iL~~NvSLEYEK~EINs  243 (520)
T KOG0359         171 DSVLCIRRQEEPIDLFMVEIMEMQHKSLHDTSLVQGLVLDHGARHP-------DMPRRVEDAYILICNVSLEYEKPEINS  243 (520)
T ss_pred             HHHHEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCC-------CCCCCHHCCEEEEEECCCCCCCCCCCC
T ss_conf             6651110567774336887766056754666776400003789886-------651000020788741131014555665


Q ss_pred             --HHHHHHCCCHHHHHHHHHHHHHHHHHCC---C------CCCCCEE----ECCCCCCHHHHHH--HHHHHHHHHHCCCC
Q ss_conf             --7753111621222223335888865312---1------3568323----2222123056766--99886521101123
Q gi|254780849|r  237 --LESATQSGRPLCIIAEDVEGDALATLVV---N------RVRCGLP----VLAVKAPAFGDRR--KEVLRDIAAVVGAT  299 (551)
Q Consensus       237 --le~~~~~~~~l~ii~~~~e~~~l~~lv~---n------~~k~gi~----v~~vk~~~~~~~~--~~~L~dia~~tGa~  299 (551)
T Consensus       244 GffYsta~ere~L~~~ER~Fi~~r~~kiielk~~vc~fvvinqKGIDP~SLd~lA~~gIlALRRAKRRNmERL~lacGG~  323 (520)
T KOG0359         244 GFFYSTAEEREVLVLAERKFIDQRVRKIIELKRKVCEFVVINQKGIDPTSLDSLAKSGILALRRAKRRNMERLVLACGGE  323 (520)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             20004446789999999999998999999876410216885146779876102211353888777653078898761540


Q ss_pred             CCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCC
Q ss_conf             32101063221122222441027898046730137742177776543346776541356311110122210233443212
Q gi|254780849|r  300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVL  379 (551)
Q Consensus       300 vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI  379 (551)
T Consensus       324 a~n-----svdDLtpd~LG~aGlVye~t------------------------------lGEEKfTFIE~~-~-~P~SvTi  366 (520)
T KOG0359         324 AVN-----SVDDLTPDYLGYAGLVYEYT------------------------------LGEEKFTFIEKC-N-NPSSVTI  366 (520)
T ss_pred             EEC-----CCCCCCHHHCCCCCEEEEEE------------------------------CCCEEEEEEECC-C-CCCCEEE
T ss_conf             004-----40118966615111367764------------------------------065336764227-9-9870699


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5676531468989887788999987540278-10555379999999974508--99689999999999999999999997
Q gi|254780849|r  380 EVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKG--DNEDQCAGIEIVRKALSYPCRQIIKN  456 (551)
Q Consensus       380 ~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~--~~~~~~~~i~~fa~AL~~ip~~La~N  456 (551)
T Consensus       367 LikGpnkht~tQikDAirDgLrav~ntled~~~i~Gaga~eva~~~~lr~~k~~vkgra~~g~~afa~AlLvipKtLa~N  446 (520)
T KOG0359         367 LIKGPNKHTITQIKDAIRDGLRAVKNTLEDKCGIPGAGAFEVALGRHLRESKKSVKGRAYLGVKAFANALLVIPKTLAKN  446 (520)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98478621189888887667999998762325325851788999999997530367356662799986553234999875


Q ss_pred             CCCCHHHHHHHHHHCCCCC-EEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7999899999998168986-658866872721388398370478999999999999986609999715877
Q gi|254780849|r  457 AGDESELIVSKIQESKTAN-YGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK  526 (551)
Q Consensus       457 aG~d~~~~i~~l~~~~~~~-~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~  526 (551)
T Consensus       447 sg~D~qe~l~~l~~e~~~~~~g~dl~~G~~~~~~~~gi~Dny~V~~~~l~s~~viA~nlLlvDEi~rAG~~  517 (520)
T KOG0359         447 SGLDEQETLVSLKKEHEVTLRGLDLFRGEECDPSRKGIYDNYSVKKQLLRSEAVIATNLLLVDEIIRAGMS  517 (520)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             38765778988787654433053100278555555055312788887740317999988879999973563