HHsearch alignment for GI: 254780849 and conserved domain: KOG0360

>KOG0360 consensus.
Probab=100.00  E-value=0  Score=577.12  Aligned_cols=473  Identities=23%  Similarity=0.311  Sum_probs=388.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
T Consensus        17 g~~vr~qnv~a~~~i~nivkss~GPvGldKmlvdd~Gdvt~TndgAtiL~~l~V~HP----a~KiLvelaq~qd~evgDg   92 (545)
T KOG0360          17 GERVRTQNVMAAMAIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILSLLEVEHP----AAKVLVELAQLQDEEVGDG   92 (545)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHCCCH----HHHHHHHHHHHCCCCCCCC
T ss_conf             500444437889999988873258643354414664606884458999875420270----8999999887342112677


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             667999999999999999976988999999898644777767653-222127--6024222122555334------5688
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKA-NHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~-~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
T Consensus        93 ttsvviia~eLl~~a~~Lv~~~ihpt~ii~gyr~ac~e~~k~i~~~~~~~vd~lg~~~Lin~~ktsmsSK~i~~ds~~f~  172 (545)
T KOG0360          93 TTSVVIIAAELLKNADELVKTKIHPTRIISGYRLACIEAVKYITEGLSKPVDSLGTQILINLAKTSMSSKIIGMDSDFFT  172 (545)
T ss_pred             CEEEEEEEHHHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHHCCCEEEHHHCCHHHHHHHHHHHHCCEECCCCHHHHH
T ss_conf             04899977876525998603788642126668999999998731551002212056899999987631401124347778


Q ss_pred             HHHHHHHHHCCC-----------CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCC
Q ss_conf             899999984243-----------200011014655203333023200112247654233101344411310220135644
Q gi|254780849|r  160 EKIAYAMEQIGP-----------HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKIS  228 (551)
Q Consensus       160 ~li~~A~~~i~~-----------d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le  228 (551)
T Consensus       173 ~~Vvda~l~v~~~~~~ge~~ypi~~vnILkahG~s~~eS~l~~GyaLnc~~as-------q~m~~~i~~~Kiacld~~Lq  245 (545)
T KOG0360         173 EMVVDALLAVKILDINGEPHYPINSVNILKAHGKSQIESMLLPGYALNCSVAS-------QMMPLRIKNAKIACLDFTLQ  245 (545)
T ss_pred             HHHHHHHHHHHHCCCCCCEECCCCCEEEEECCCCCCHHHEEECCEEEECCHHH-------HCCCCCCCCCEEEEEECCCC
T ss_conf             89999997776305578520002521577647754012224446345134765-------23633343421466751220


Q ss_pred             CCCCCHHH---------HHHHHHCCCHHHHHHHHHHHHHHHHHCCC--CCCCCEEECCCC----CCHHHHHH--HHHHHH
Q ss_conf             10011146---------77531116212222233358888653121--356832322221----23056766--998865
Q gi|254780849|r  229 ALQPLLPI---------LESATQSGRPLCIIAEDVEGDALATLVVN--RVRCGLPVLAVK----APAFGDRR--KEVLRD  291 (551)
Q Consensus       229 ~~~~~~~~---------le~~~~~~~~l~ii~~~~e~~~l~~lv~n--~~k~gi~v~~vk----~~~~~~~~--~~~L~d  291 (551)
T Consensus       246 k~km~lGv~vvv~dp~kle~ir~--~e~~itkeRi~k--Il~~ganvVLtt~gIddmc~K~~veagamAVrR~~k~dlk~  321 (545)
T KOG0360         246 KTKMKLGVQVVVDDPEKLEQIRQ--REQDITKERIKK--ILATGANVVLTTGGIDDMCLKYFVEAGAMAVRRCKKEDLKR  321 (545)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHH--HHHHHHHHHHHH--HHHCCCCEEEECCCCCHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             13445661599828588899898--876767999999--98669858998587568999999872216668887988899


Q ss_pred             HHHHCCCCCCCHHHCCC-CCCCCCCCCCCEEEEEEEC---CCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             21101123321010632-2112222244102789804---6730137742177776543346776541356311110122
Q gi|254780849|r  292 IAAVVGATVISEEIGLK-LEKATIADLGSAKKVVMSK---DDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~-l~~~~~~~LG~~~~v~i~~---~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
T Consensus       322 iaKatGat~~sSla~l~geetf~~~~lG~a~evvqeri~dde~ilikg--------------------------------  369 (545)
T KOG0360         322 IAKATGATLLSSLANLEGEETFEPASLGSADEVVQERIGDDELILIKG--------------------------------  369 (545)
T ss_pred             HHHHHCCEEEEHHHCCCCCCCCCHHHCCCHHHHHHHHCCCCEEEEECC--------------------------------
T ss_conf             998618704212213466323371421545678887506642699606--------------------------------


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHH
Q ss_conf             2102334432125676531468989887788999987540278-1055537999999997450899--689999999999
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRK  444 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~  444 (551)
T Consensus       370 --~--ka~~aSiILrgaNd~~~DEmers~hdaL~VlkrtLes~~vvpGGG~vE~aLs~yle~~a~s~~srE~laiaefa~  445 (545)
T KOG0360         370 --T--KATSASIILRGANDFMLDEMERSLHDALCVLKRTLESKSVVPGGGAVETALSIYLENFATSVGSREQLAIAEFAA  445 (545)
T ss_pred             --C--CCCEEEEEEECCCCCCHHHHCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             --7--530456898268745075523443568999998703573455862899999999984234676088899999999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCCC-----------CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999779998999999981689-----------8665886687272138839837047899999999999998
Q gi|254780849|r  445 ALSYPCRQIIKNAGDESELIVSKIQESKT-----------ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGM  513 (551)
Q Consensus       445 AL~~ip~~La~NaG~d~~~~i~~l~~~~~-----------~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~  513 (551)
T Consensus       446 all~ipktla~naa~Dstelvt~lra~Hs~~q~~p~~~~~k~~GldL~ng~~~dn~~~g~~ep~~~kvksLk~ateaait  525 (545)
T KOG0360         446 ALLSIPKTLAVNAAKDSTELVTKLRAYHSVSQDNPWRLLLKQYGLDLINGKIRDNKSAGSFEPPIVKVKSLKFATEAAIT  525 (545)
T ss_pred             HHHCCHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCCCCCCHHHCCCCCCCEEECCEEEEEECCCEEEHHHHHHHHHHHHH
T ss_conf             99621387755412563100135667742440687544213307400055763240441652642320455788876666


Q ss_pred             HHHHHHHHHCCCCCCCCCC
Q ss_conf             6609999715877888899
Q gi|254780849|r  514 MLITEAVVVDAPKDETASP  532 (551)
Q Consensus       514 iLriD~iI~~~~~~~~~~p  532 (551)
T Consensus       526 iLriD~li~l~~~~~~~~~  544 (545)
T KOG0360         526 ILRIDDLIKLLPELQVAVE  544 (545)
T ss_pred             HCCHHHHHHCCCCCCCCCC
T ss_conf             4022034312866455678