HHsearch alignment for GI: 254780849 and conserved domain: PTZ00212

>PTZ00212 T-complex protein 1 beta subunit; Provisional.
Probab=100.00  E-value=0  Score=727.37  Aligned_cols=479  Identities=22%  Similarity=0.307  Sum_probs=376.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE-----CCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             37989999999999999999773678986359888-----5899838832088877760347852257889999999866
Q gi|254780849|r    7 KLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIG-----NSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         7 ~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~-----~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
T Consensus        18 ~~G~~ar~~~i~g~~~ladaV~tTLGPkG~nk~i~~~~~~~~~G~~~ITnDGvTIak~i~le~p----~Akll~e~a~~q   93 (533)
T PTZ00212         18 EKGETARLQSFVGAIAVADLVKTTLGPKGMDKILQPMNEGPRSQHVTVTNDGATILKSVWVDNP----AAKILIDISKTQ   93 (533)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHH
T ss_conf             2659999999999999998873887988785999836777888983796429999887518598----999999999977


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276-----0242221225553345
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS-----REEIIQVATISANGDR  156 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~-----~~~L~~vA~tS~~~~~  156 (551)
T Consensus        94 ~~~aGDGTTTavvLa~~ll~~~~~ll~~G~~p~~I~~G~~~A~~~~~~~L~~~s~~~~~~~~~~~~~l~~va~ts~~sk-  172 (533)
T PTZ00212         94 DDEVGDGTTSVVVLAGELLRNAEKLLDQKIHPQTIIEGYRMALDVARKALEESAFDHDADSKKFHEDLLNIARTTLSSK-  172 (533)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHH-
T ss_conf             8886787689999999999999999987998799999999999999999998525567856777999999999887658-


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHC--CCCCCCCCCCCCCCCCCH---HHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             68889999998424320001101465520333302--320011224765423310---1344411310220135644100
Q gi|254780849|r  157 EIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQ--GMQIDRGYISPYFVTSTE---RMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       157 ~l~~li~~A~~~i~~d~vi~i~~~~~~~~d~~li~--G~~id~g~~~~~fi~~~~---~~~~~~~n~~Ili~d~~Le~~~  231 (551)
T Consensus       173 -i~~~~~~~~~~l~~~av~~~~~~-~~~d~i~i~k~~Gg~~~~s~l~~G~vl~~~~~~~~~~~~~n~~ili~~~~le~~k  250 (533)
T PTZ00212        173 -LLTVEKDHFAKLAVDAVLRLKGS-GNLDLIQIIKKPGGTLRDSYLEDGFILEKRIGIGQPKRLENAKILVANTPMDTDK  250 (533)
T ss_pred             -HHHHHHHHHHHHHHHHHHHCCCC-CCCEEEEEEEEECCEEECCEEEEEEEECCCCCCCCCEECCCHHHHHHCCCCCCCH
T ss_conf             -88989999999999999751577-8722489999839788613555545760445667841305688886325444204


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCH---------------HHHHHHHHHHHHHHHC
Q ss_conf             1114677531116212222233358888653121356832322221230---------------5676699886521101
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPA---------------FGDRRKEVLRDIAAVV  296 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~---------------~~~~~~~~L~dia~~t  296 (551)
T Consensus       251 ~~~~~~~i~i~~~~~~~~~-~~~e~~~~~~~~~~I~~~~~~v~i~~~~i~~~~~~~l~~~~i~~i~~~~~~~le~ia~~t  329 (533)
T PTZ00212        251 IKIYGAKVNVDSMEKVAEI-EAAEKEKMKNKVDKILKHGINVFINRQLIYNYPEQLFAEAGIMAIEHADFDGMERLAAAL  329 (533)
T ss_pred             HHHHCCHHCCCCHHHHHHH-HHHHHHHHHHHHHHHHHCCCCEEEEHHHCCCHHHHHHHHCCEEEEECCCHHHHHHHHHHH
T ss_conf             5410123136889999999-999999999899999845896898501133266667763683354137888899999874


Q ss_pred             CCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             12332101063221122222441027898046730137742177776543346776541356311110122210233443
Q gi|254780849|r  297 GATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGV  376 (551)
Q Consensus       297 Ga~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~  376 (551)
T Consensus       330 g~~ii~-----~~~~~~~~~lG~~~~v~e~~-----ig-------------------------~~~--~~~~~~~~~~~~  372 (533)
T PTZ00212        330 GAEIVS-----TFDTPENVKLGHCDLIEEIM-----IG-------------------------EDK--LIRFSGCKKGEA  372 (533)
T ss_pred             CCEEEE-----ECCCCCHHHHCCCCCEEEEE-----EC-------------------------CEE--EEEEECCCCCCC
T ss_conf             887986-----36878887717467149999-----87-------------------------788--887624678871


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2125676531468989887788999987540278-105553799999999745089--9689999999999999999999
Q gi|254780849|r  377 AVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQI  453 (551)
Q Consensus       377 ~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~L  453 (551)
T Consensus       373 ~tI~v~G~t~~~l~E~~r~l~DAl~a~k~ai~eg~iVpGGGa~e~~ls~~l~~~~~~~~g~e~~~i~~~a~AL~~~p~~L  452 (533)
T PTZ00212        373 CTIVLRGASSHILDEAERSLHDALCVLSETVKDTRVVLGAGCSEMLMANAVEEEAKKVQGKKSLAIEAFAKALRQIPTII  452 (533)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             69997177468999999999999999999985699762533999999999998733475089999999999999999999


Q ss_pred             HHHCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9977999899999998168---9866588668727213883983704789999999999999866099997158778888
Q gi|254780849|r  454 IKNAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA  530 (551)
Q Consensus       454 a~NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~  530 (551)
T Consensus       453 a~NAG~d~~~vv~~l~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~V~~~aL~~A~~vA~~iL~iD~iI~~~P~~~~p  532 (533)
T PTZ00212        453 ADNGGYDSAELVSKLRAEHYKGNKTAGIDMEDGDVGDVKELGITESYKVKLSVLCSATEAAEMILRVDDIIKCAPRQRTP  532 (533)
T ss_pred             HHHCCCCHHHHHHHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99779878999999999985579988797779967158758783569999999999999999999999999606888898