HHsearch alignment for GI: 254780849 and conserved domain: PTZ00212

>PTZ00212 T-complex protein 1 beta subunit; Provisional.
Probab=92.21  E-value=0.084  Score=30.19  Aligned_cols=174  Identities=10%  Similarity=0.058  Sum_probs=88.7

Q ss_pred             HHHHHHHHHHHH------HHHHHHHCCCCCCCEEEEECCCC-----CEEEEEHHHHHHHHHCCCCC------C---HHHH
Q ss_conf             999999999999------99997736789863598885899-----83883208887776034785------2---2578
Q gi|254780849|r   11 AARDAIAYGVNT------LAEAVKCTLGPKGRCVIIGNSFG-----APRVTKDGVTVAKSISFKNH------F---HEVG   70 (551)
Q Consensus        11 ~a~~~~~~~~~~------ia~~i~ttlGP~G~~kmi~~~~g-----~~~iTnDGaTIlk~l~~~hp------~---~~~~   70 (551)
T Consensus        29 ~g~~~ladaV~tTLGPkG~nk~i~~~~~~~~~G~~~ITnDGvTIak~i~le~p~Akll~e~a~~q~~~aGDGTTTavvLa  108 (533)
T PTZ00212         29 VGAIAVADLVKTTLGPKGMDKILQPMNEGPRSQHVTVTNDGATILKSVWVDNPAAKILIDISKTQDDEVGDGTTSVVVLA  108 (533)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCEEEECCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             99999998873887988785999836777888983796429999887518598999999999977888678768999999


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH----HHHCC-----CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999999866255188666799999999999999----99769-----8899999989864477776765322212760
Q gi|254780849|r   71 ARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRK----YVTAG-----LNPMDIKRGIDLAVQEVVEYLKANHKKVGSR  141 (551)
Q Consensus        71 akll~~~a~~qd~~~GDGTTtvvvLa~eLL~~a~~----Li~~g-----ihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~  141 (551)
T Consensus       109 ~~ll~~~~~ll----~~G~~p~~I~~G--~~~A~~~~~~~L~~~s~~~~~~~~~~~-----------~~l~~va~ts~--  169 (533)
T PTZ00212        109 GELLRNAEKLL----DQKIHPQTIIEG--YRMALDVARKALEESAFDHDADSKKFH-----------EDLLNIARTTL--  169 (533)
T ss_pred             HHHHHHHHHHH----HCCCCHHHHHHH--HHHHHHHHHHHHHHHCCCCCCCHHHHH-----------HHHHHHHHHHH--
T ss_conf             99999999999----879987999999--999999999999985255678567779-----------99999999887--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC----CHHHHCCCCCCCCHHHHHCCCCCCCC--CCCCCCCCCC
Q ss_conf             2422212255533456888999999842432----00011014655203333023200112--2476542331
Q gi|254780849|r  142 EEIIQVATISANGDREIGEKIAYAMEQIGPH----GIITIDQAKTATTEVRVVQGMQIDRG--YISPYFVTST  208 (551)
Q Consensus       142 ~~L~~vA~tS~~~~~~l~~li~~A~~~i~~d----~vi~i~~~~~~~~d~~li~G~~id~g--~~~~~fi~~~  208 (551)
T Consensus       170 -----~ski~~~~~~~~~~l~~~av~~~~~~~~~d~i~i~k~~Gg~~~~s~l~~G~vl~~~~~~~~~~~~~n~  237 (533)
T PTZ00212        170 -----SSKLLTVEKDHFAKLAVDAVLRLKGSGNLDLIQIIKKPGGTLRDSYLEDGFILEKRIGIGQPKRLENA  237 (533)
T ss_pred             -----HHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCEEECCEEEEEEEECCCCCCCCCEECCCH
T ss_conf             -----65888989999999999999751577872248999983978861355554576044566784130568