HHsearch alignment for GI: 254780849 and conserved domain: TIGR02344

>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit; InterPro: IPR012719 The TCP-1 protein , (Tailless Complex Polypeptide 1) was first identified in mice where it is especially abundant in testis but present in all cell types. It has since been found and characterised in many other animal species, as well as in yeast, plants and protists. TCP-1 is a highly conserved protein of about 60 kDa (556 to 560 residues) which participates in a hetero-oligomeric 900 kDa double-torus shaped particle with 6 to 8 other different subunits. These subunits, the chaperonin containing TCP-1 (CCT) subunit beta, gamma, delta, epsilon, zeta and eta are evolutionary related to TCP-1 itself , . The CCT is known to act as a molecular chaperone for tubulin, actin and probably some other proteins. The TCP-1 family of proteins are weakly, but significantly , related to the cpn60/groEL chaperonin family (see IPR001844 from INTERPRO). Proteins in this entry consist exclusively of the CCT gamma chain from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=704.02  Aligned_cols=464  Identities=19%  Similarity=0.305  Sum_probs=379.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
T Consensus        13 ~G~k~q~~NI~AakAvaDiirttLGP~~MLKMLLDP~GGiV~TNDGnaILREi~v~HP----AAKSmiElsR~qDEEVGD   88 (527)
T TIGR02344        13 SGRKAQLSNIQAAKAVADIIRTTLGPRSMLKMLLDPMGGIVLTNDGNAILREIDVAHP----AAKSMIELSRTQDEEVGD   88 (527)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCEEEEECCCEEEEEEECCCC----HHHHHHHHHCCCCCCCCC
T ss_conf             5303435556888899999861476568999963004948986078657755312785----245688762145741257


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             6667999999999999999976988999999898644777767653222127--6024222122555334------5688
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
T Consensus        89 GTTSViiLAGE~L~~A~~f~~~~iHP~ii~~ay~~AL~d~l~~~~~~~~~vDV~d~~~~~~~~~scigTK~~~rw~~l~~  168 (527)
T TIGR02344        89 GTTSVIILAGEMLSAAEPFLEQNIHPTIIIRAYKKALEDALSVLEEISIPVDVNDSAAMLKLIKSCIGTKFVSRWSDLIC  168 (527)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             50212344689999999987238996650557999999999987660310145867899999974565557888899999


Q ss_pred             HHHHHHHHHCCCCC------------HHHHCCCCC-CCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             89999998424320------------001101465-52033330232001122476542331013444113102201356
Q gi|254780849|r  160 EKIAYAMEQIGPHG------------IITIDQAKT-ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       160 ~li~~A~~~i~~d~------------vi~i~~~~~-~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
T Consensus       169 ~lAL~Av~tv~~~~~~~~~~e~DIKrYakVEKiPGG~i~dS~VL~GVm~NKDvthP-------KMrR~I~NPRi~LLDcp  241 (527)
T TIGR02344       169 DLALDAVRTVKRDEGNGRKLEIDIKRYAKVEKIPGGEIEDSCVLKGVMINKDVTHP-------KMRRRIENPRIVLLDCP  241 (527)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEEEEEEEEECCCCCCCCCEEECCEEECCCCCCC-------CCCCEECCCEEEEECCC
T ss_conf             99999998875205675156556531478963489811243232131323453586-------44103138737984688


Q ss_pred             CCCCCCC--HHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHH---------------
Q ss_conf             4410011--14677531116212222233358888653121356832322221230567669988---------------
Q gi|254780849|r  227 ISALQPL--LPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVL---------------  289 (551)
Q Consensus       227 Le~~~~~--~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L---------------  289 (551)
T Consensus       242 LEYKKGESqTn~Ei~~E~d~~~~L~~Eee~v~~~C~~Ii~~K-----PD~ViTEKGvSDLAqHYL~K~ni~aiRR~RKtD  316 (527)
T TIGR02344       242 LEYKKGESQTNVEITKEEDWNRLLQIEEEYVQRMCEDIIAVK-----PDLVITEKGVSDLAQHYLLKANISAIRRVRKTD  316 (527)
T ss_pred             CCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCEEEECCCCHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             400136775440320653589999988999999999998418-----988996276026899999867922886023130


Q ss_pred             -HHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEE-EECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             -65211011233210106322112222244102789-8046730137742177776543346776541356311110122
Q gi|254780849|r  290 -RDIAAVVGATVISEEIGLKLEKATIADLGSAKKVV-MSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       290 -~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~-i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
T Consensus       317 nnRiaR~~GA~IVn-----R~Eel~E~DvGt~cGLFe~~k-----iG------------DeYf~F~~~------------  362 (527)
T TIGR02344       317 NNRIARACGATIVN-----RPEELRESDVGTGCGLFEVKK-----IG------------DEYFTFLTE------------  362 (527)
T ss_pred             HHHHHHHHCCEEEC-----CCCCCEECCCCCCCCEEEEEE-----CC------------CHHHHHHHC------------
T ss_conf             14667750871525-----611051044467654033210-----21------------146688524------------


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHH
Q ss_conf             210233443212567653146898988778899998754-02781055537999999997450899--689999999999
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAA-SDEGIVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRK  444 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~-~~~~vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~  444 (551)
T Consensus       363 --Ck~PkA-CTilLRG~SKDvLnE~ERNL~Dam~varN~~~~P~L~pGGGA~Em~Vs~~L~~~~~~~eg~~~~py~AVA~  439 (527)
T TIGR02344       363 --CKDPKA-CTILLRGASKDVLNEVERNLQDAMAVARNVLLEPKLLPGGGATEMAVSVKLAKKAKKLEGVEQWPYRAVAD  439 (527)
T ss_pred             --CCCCCC-CEEEECCCCCHHHHHHHHHHHHHHHHHHHEEECCEECCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             --889762-24774278601333433117779988441020773348874588999999999876413300136899999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCCCC-----CEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999997799989999999816898-----665886687272138839837047899999999999998660999
Q gi|254780849|r  445 ALSYPCRQIIKNAGDESELIVSKIQESKTA-----NYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEA  519 (551)
Q Consensus       445 AL~~ip~~La~NaG~d~~~~i~~l~~~~~~-----~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~  519 (551)
T Consensus       440 AlE~IPrtL~QNcG~~~ir~~t~LraKH~~~~~~~~~GIdG~~G~ivdm~~~~iWep~~VK~Q~~KTAiE~A~llLRiDD  519 (527)
T TIGR02344       440 ALEIIPRTLAQNCGVNVIRTLTELRAKHAQEYNNKTWGIDGETGKIVDMKEKGIWEPLAVKLQTYKTAIESACLLLRIDD  519 (527)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCEEEEEECCCCCHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             97453467764258728888898777762278841453327732168620036654023201102568999999874200


Q ss_pred             HHHCC
Q ss_conf             97158
Q gi|254780849|r  520 VVVDA  524 (551)
Q Consensus       520 iI~~~  524 (551)
T Consensus       520 iVSG~  524 (527)
T TIGR02344       520 IVSGV  524 (527)
T ss_pred             EECCC
T ss_conf             00475