HHsearch alignment for GI: 254780849 and conserved domain: TIGR02345

>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit; InterPro: IPR012720 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT eta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=806.70  Aligned_cols=481  Identities=23%  Similarity=0.289  Sum_probs=421.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             99999999999999773678986359888589983883208887776034785225788999999986625518866679
Q gi|254780849|r   13 RDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTA   92 (551)
Q Consensus        13 ~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGTTtv   92 (551)
T Consensus        20 ~~SNi~AC~~I~E~l~~TLGPrGMDKLi~~~~~ka~vsNDGATIlk~LDivHP----AA~~LVDiaksQD~EvGDGTTSV   95 (537)
T TIGR02345        20 LISNINACVAIAEILKTTLGPRGMDKLIVGKNGKATVSNDGATILKLLDIVHP----AAKTLVDIAKSQDSEVGDGTTSV   95 (537)
T ss_pred             EEHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCEEEECCHHHHHHHCCCCCC----HHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             31147899989998613688864400024589732786566889834476473----68899999974023338850678


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC------------CCHHHHHHHHHHHHHH-----
Q ss_conf             99999999999999976988999999898644777767653222127------------6024222122555334-----
Q gi|254780849|r   93 TCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG------------SREEIIQVATISANGD-----  155 (551)
Q Consensus        93 vvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~------------~~~~L~~vA~tS~~~~-----  155 (551)
T Consensus        96 ~~La~elL~~~kp~ie~g~hp~~I~~~y~~a~~~a~~kl~e~~v~~~~~~pg~~gf~~~~Re~L~~cA~T~l~SKli~~~  175 (537)
T TIGR02345        96 VVLAGELLKEAKPFIEEGVHPQLIIRCYREALKLAIEKLKEIAVTIDEKEPGNTGFKGEQREVLEKCAATALSSKLISHE  175 (537)
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHH
T ss_conf             88889999863137651788015688899999999998766100001357766665703579999999888641100100


Q ss_pred             -HHHHHHHHHHHHHCCCCC----HHHHCC-CCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             -568889999998424320----001101-46552033330232001122476542331013444113102201356441
Q gi|254780849|r  156 -REIGEKIAYAMEQIGPHG----IITIDQ-AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISA  229 (551)
Q Consensus       156 -~~l~~li~~A~~~i~~d~----vi~i~~-~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~  229 (551)
T Consensus       176 k~fFs~M~VDAV~~L~~d~~~~~lIGvKkV~GGsl~DS~~V~GVAFkKTFsYAGf----EqqPK~~~NPkI~~LNvELEl  251 (537)
T TIGR02345       176 KEFFSKMIVDAVLQLDIDDLDLKLIGVKKVQGGSLEDSVLVNGVAFKKTFSYAGF----EQQPKKFANPKILLLNVELEL  251 (537)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEECCEEECCCCCCCCC----CCCCCCCCCCEEEEEHHHHHH
T ss_conf             2221313788999986876750276335403873215504346101225465652----368850267604520012432


Q ss_pred             CCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCC
Q ss_conf             00111467753111621222223335888865312135683232222123056766998865211011233210106322
Q gi|254780849|r  230 LQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKL  309 (551)
Q Consensus       230 ~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l  309 (551)
T Consensus       252 KAEkdNAEiRv~~~e~yq~iV--DAEW~iI~~KL~~i~~sGA~vVLS~lp-IGD~ATQyFAD~~iFCAGRV~~ED----~  324 (537)
T TIGR02345       252 KAEKDNAEIRVEDVEDYQAIV--DAEWAIIFRKLEKIVESGANVVLSKLP-IGDLATQYFADHDIFCAGRVSDED----L  324 (537)
T ss_pred             HCCCCCCEEEECCHHHHHHHH--HHHHHHHHHHHHHHHHCCCEEEECCCC-CCCCHHHHHHCCCCCCCCCCCHHH----H
T ss_conf             117888658708815677898--899999999999998659959971677-454202342317850037888777----8


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHH-HHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHH
Q ss_conf             112222244102789804673013774217777654-3346776541356311110122210233443212567653146
Q gi|254780849|r  310 EKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGR-INEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAA  388 (551)
Q Consensus       310 ~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~-i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~  388 (551)
T Consensus       325 ~Rv~~~~GgsI~s~~~-----------~l~~~~LG~rC~----~FEE~Q~G~~RyN~F~g~p~--~~~cT~iLRGGAeqf  387 (537)
T TIGR02345       325 KRVVKATGGSILSTVS-----------DLEADVLGTRCA----LFEERQIGSERYNLFTGCPH--AKTCTIILRGGAEQF  387 (537)
T ss_pred             HHHHHHHCCEEEHHHH-----------HHCHHHCCCHHH----HHHHHHCCCCCCCCCCCCCC--CCEEEEEEECCHHHH
T ss_conf             9999860871110002-----------103110453111----02333046312522058798--636778860877899


Q ss_pred             HHHHHHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             898988778899998754027-8105553799999999745089--9689999999999999999999997799989999
Q gi|254780849|r  389 LGEKKDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIV  465 (551)
Q Consensus       389 ~~E~~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i  465 (551)
T Consensus       388 ~~E~eRSlHDAimiVRrA~~~~~~V~GGGaiEm~lS~~Lr~~s~~~~GK~qli~~A~a~ALE~IP~~L~~NAGfDs~~~L  467 (537)
T TIGR02345       388 LEEAERSLHDAIMIVRRALKAKKIVAGGGAIEMELSKILREHSKKIDGKQQLIIEAFAKALEVIPRSLCENAGFDSIEIL  467 (537)
T ss_pred             HHHHCCCHHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99750334246788488522885425874588999999999734743078999999999987757988510481379999


Q ss_pred             HHHHHCC------C--CCEEEECCCCC-EEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9998168------9--86658866872-72138839837047899999999999998660999971587
Q gi|254780849|r  466 SKIQESK------T--ANYGYNAQKSV-FGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP  525 (551)
Q Consensus       466 ~~l~~~~------~--~~~G~d~~~g~-i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~  525 (551)
T Consensus       468 ~~LR~~H~~~~~~~~v~w~GVdI~~~~~i~d~~~~fvWEP~~Vk~Nal~Aa~eAA~~IlsiDeTi~~~~  536 (537)
T TIGR02345       468 NKLRSRHAKEIKGGSVKWYGVDINTEDKIGDNFEAFVWEPLLVKKNALKAAFEAACTILSIDETIKNPK  536 (537)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             999998877514893688744762765088887731546078998787888998876415020012689