HHsearch alignment for GI: 254780849 and conserved domain: cd03336

>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=725.52  Aligned_cols=473  Identities=24%  Similarity=0.354  Sum_probs=381.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE--CCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             7989999999999999999773678986359888--58998388320888777603478522578899999998662551
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIG--NSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSS   85 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~--~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~   85 (551)
T Consensus        10 ~G~eAr~~~i~g~~~la~aV~~TLGPkG~nk~i~~~~~~G~~~ITnDGvTI~k~i~l~~p----~A~ll~e~A~~q~~~a   85 (517)
T cd03336          10 KGETARLSSFVGAIAIGDLVKTTLGPKGMDKILQSVGRSGGVTVTNDGATILKSIGVDNP----AAKVLVDISKVQDDEV   85 (517)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHH
T ss_conf             549999999999999998870887998785999842789983796449999886637598----9999999999767776


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-----HHHHHHHHHHHHHHHHHHH
Q ss_conf             88666799999999999999997698899999989864477776765322212760-----2422212255533456888
Q gi|254780849|r   86 GDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSR-----EEIIQVATISANGDREIGE  160 (551)
Q Consensus        86 GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~-----~~L~~vA~tS~~~~~~l~~  160 (551)
T Consensus        86 GDGTTTavvLa~~ll~~~~~li~~g~~p~~I~~G~~~A~~~~~~~L~~~a~~~~~~~~~~~~~l~~va~ts~~sK--i~~  163 (517)
T cd03336          86 GDGTTSVTVLAAELLREAEKLVAQKIHPQTIIEGYRMATAAAREALLSSAVDHSSDEEAFREDLLNIARTTLSSK--ILT  163 (517)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH--HHH
T ss_conf             888679999999999999999987998478999999999999999998464678807788999999999887768--889


Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCCCHHHHHC--CCCCCCCCCCCCCCCCCH---HHHHHHCCCHHHHCCCCCCCCCCCH-
Q ss_conf             9999998424320001101465520333302--320011224765423310---1344411310220135644100111-
Q gi|254780849|r  161 KIAYAMEQIGPHGIITIDQAKTATTEVRVVQ--GMQIDRGYISPYFVTSTE---RMTAEVENPYILIYDKKISALQPLL-  234 (551)
Q Consensus       161 li~~A~~~i~~d~vi~i~~~~~~~~d~~li~--G~~id~g~~~~~fi~~~~---~~~~~~~n~~Ili~d~~Le~~~~~~-  234 (551)
T Consensus       164 ~~~~~~~~l~~~av~~v~~-~~~~~~i~i~~~~gg~~~~~~l~~g~i~d~~~~~~~~~~~~n~~ill~~~~le~~~~~~~  242 (517)
T cd03336         164 QDKEHFAELAVDAVLRLKG-SGNLDAIQIIKKLGGSLKDSYLDEGFLLDKKIGVNQPKRIENAKILIANTPMDTDKIKIF  242 (517)
T ss_pred             HHHHHHHHHHHHHHHHCCC-CCCEEEEEEEEEECCEEEEEEEECCEEEECCCCCCCCEEECCHHHHCCCCCCCHHHHHHH
T ss_conf             9999999999999975168-886036999997187886316772578703225678535226343101676541466530


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHH----------------HHHHHHHHHHHHCCC
Q ss_conf             4677531116212222233358888653121356832322221230567----------------669988652110112
Q gi|254780849|r  235 PILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGD----------------RRKEVLRDIAAVVGA  298 (551)
Q Consensus       235 ~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~----------------~~~~~L~dia~~tGa  298 (551)
T Consensus       243 ~~~i~i~~~-~~~~~~-~~~e~~~~~~~v~~i~~~~~~~~~~~~~-i~~~~~~~l~~~~I~~~~~~~~~~le~ia~~tg~  319 (517)
T cd03336         243 GAKVRVDST-AKVAEI-EEAEKEKMKNKVEKILKHGINCFINRQL-IYNYPEQLFADAGIMAIEHADFDGVERLALVTGG  319 (517)
T ss_pred             CCHHCCCCH-HHHHHH-HHHHHHHHHHHHHHHHHCCCCEEEHHHC-CCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             112104889-999999-9999999985999998658860313320-1317889987537410045888888999998488


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             33210106322112222244102789804673013774217777654334677654135631111012221023344321
Q gi|254780849|r  299 TVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV  378 (551)
Q Consensus       299 ~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~t  378 (551)
T Consensus       320 ~ii~-----~~~~~~~~~lG~~~~v~e~~-----i~-------------------------~~~--~~~~~g~~~~~~~t  362 (517)
T cd03336         320 EIAS-----TFDHPELVKLGTCKLIEEIM-----IG-------------------------EDK--LIRFSGVAAGEACT  362 (517)
T ss_pred             EEEE-----ECCCCCHHHCCCCCCEEEEE-----EC-------------------------CEE--EEEEECCCCCCEEE
T ss_conf             7886-----45878887726467159999-----87-------------------------827--99997036787169


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25676531468989887788999987540278-105553799999999745089--968999999999999999999999
Q gi|254780849|r  379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIK  455 (551)
Q Consensus       379 I~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~  455 (551)
T Consensus       363 I~irG~t~~~~~E~~r~~~DAL~a~k~ai~e~~iVpGGG~~e~~ls~~l~~~~~~~~g~~~~~i~~~a~AL~~ip~~La~  442 (517)
T cd03336         363 IVLRGASQQILDEAERSLHDALCVLAQTVKDTRVVLGGGCSEMLMAKAVEELAKKTPGKKSLAIEAFAKALRQLPTIIAD  442 (517)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99806858999999987777999999998679877466799999999999874348547999999999999999999999


Q ss_pred             HCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             77999899999998168---9866588668727213883983704789999999999999866099997158778
Q gi|254780849|r  456 NAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD  527 (551)
Q Consensus       456 NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~  527 (551)
T Consensus       443 NAG~d~~~vv~~l~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~V~~~al~~A~~vA~~iL~iD~iI~~~P~k  517 (517)
T cd03336         443 NAGYDSAELVAQLRAAHYNGNTTAGLDMRKGTVGDMKELGITESFKVKRQVLLSASEAAEMILRVDDIIKCAPRK  517 (517)
T ss_pred             HCCCCHHHHHHHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             869979999999999984689988897679947158768693668999999997999999999999999855799