HHsearch alignment for GI: 254780849 and conserved domain: cd03341

>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=691.08  Aligned_cols=442  Identities=20%  Similarity=0.281  Sum_probs=376.1

Q ss_pred             CH-HHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98-99999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    9 GT-AARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         9 g~-~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
T Consensus         5 ~~~~a~~~ni~a~~~la~~vk~TLGP~G~~kmi~~~~g~~~ITnDG~TI~k~i~~~~P----~a~ll~e~a~~qd~~~GD   80 (472)
T cd03341           5 GLEEAVLRNIEACKELSQITRTSYGPNGMNKMVINHLEKLFVTSDAATILRELEVQHP----AAKLLVMASQMQEEEIGD   80 (472)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             5899999999999999999737759887838988799984898858999886748498----999999999834426358


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCHHHHHHHHHHHHHH-----HHH
Q ss_conf             6667999999999999999976988999999898644777767653222----1276024222122555334-----568
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHK----KVGSREEIIQVATISANGD-----REI  158 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~----~i~~~~~L~~vA~tS~~~~-----~~l  158 (551)
T Consensus        81 GTTt~vvLa~~ll~~~~~li~~g~~p~~I~~g~~~a~~~~~~~L~~~a~~~~~~~~~~~~i~~~~~ts~~sk~~~~~~~l  160 (472)
T cd03341          81 GTNLVVVLAGELLEKAEELLRMGLHPSEIIEGYEKALKKALEILEELVVYKIEDLRNKEEVSKALKTAIASKQYGNEDFL  160 (472)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHH
T ss_conf             67799999999999999999769988999999999999999999986124588966799999999988621014637899


Q ss_pred             HHHHHHHHHHCCCC--------CHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             88999999842432--------0001101465520333302320011224765423310134441131022013564410
Q gi|254780849|r  159 GEKIAYAMEQIGPH--------GIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL  230 (551)
Q Consensus       159 ~~li~~A~~~i~~d--------~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~  230 (551)
T Consensus       161 ~~l~~~A~~~v~~~~~~~~~~~~i~i~~i~gg~~~~s~~i~G~v~~~~~---------~~~~~~~~~~ki~i~~~~~e~-  230 (472)
T cd03341         161 SPLVAEACISVLPENIGNFNVDNIRVVKILGGSLEDSKVVRGMVFKREP---------EGSVKRVKKAKVAVFSCPFDI-  230 (472)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEECCC---------CCCCEEECCCCEEEEECCCCC-
T ss_conf             9999999885204778840114789999418710011567247984354---------346413003736887234335-


Q ss_pred             CCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCC
Q ss_conf             01114677531116212222233358888653121356832322221230567669988652110112332101063221
Q gi|254780849|r  231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLE  310 (551)
Q Consensus       231 ~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~  310 (551)
T Consensus       231 -------------~~~lii~~~~i~~~a~~~l~k~------~I~av~~~~-----~~~l~ria~~tg~~~i~-----~~~  281 (472)
T cd03341         231 -------------GVNVIVAGGSVGDLALHYCNKY------GIMVIKINS-----KFELRRLCRTVGATPLP-----RLG  281 (472)
T ss_pred             -------------CCCEEEECCCCCHHHHHHHHHC------CCEEEECCC-----HHHHHHHHHHCCCEEEC-----CCC
T ss_conf             -------------8977998788669999999874------937997077-----65799999973998855-----678


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHH
Q ss_conf             12222244102789804673013774217777654334677654135631111012221023344321256765314689
Q gi|254780849|r  311 KATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALG  390 (551)
Q Consensus       311 ~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~  390 (551)
T Consensus       282 ~~~~~~lG~a~~v~~~~i~~-------------------------------~~~~~~~~~~~~~~v~tI~v~g~t~~~~~  330 (472)
T cd03341         282 APTPEEIGYCDSVYVEEIGD-------------------------------TKVVVFRQNKEDSKIATIVLRGATQNILD  330 (472)
T ss_pred             CCCHHHCCCCCCCEEEEECC-------------------------------EEEEEEEECCCCCCEEEEEECCCCHHHHH
T ss_conf             79887785367756888387-------------------------------77999994478775479997178899999


Q ss_pred             HHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89887788999987540278-105553799999999745089--968999999999999999999999779998999999
Q gi|254780849|r  391 EKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSK  467 (551)
Q Consensus       391 E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~  467 (551)
T Consensus       331 E~~r~i~DAl~~~k~a~~e~~iVpGGG~~e~~l~~~l~~~~~~~~~~~~~~i~~~a~AL~~ip~~La~NaG~d~~~vv~~  410 (472)
T cd03341         331 DVERAIDDGVNVFKSLTKDGRFVPGAGATEIELAKKLKEYGEKTPGLEQYAIKKFAEAFEVVPRTLAENAGLDATEVLSE  410 (472)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             99986201899999998558731487588999999999975228867899999999999999999999789979999999


Q ss_pred             HHHCC---CCCEEEECCCC--CEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98168---98665886687--27213883983704789999999999999866099997158
Q gi|254780849|r  468 IQESK---TANYGYNAQKS--VFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDA  524 (551)
Q Consensus       468 l~~~~---~~~~G~d~~~g--~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~  524 (551)
T Consensus       411 l~~~~~~~~~~~G~~~~~~~~~~~Dm~~~gIidP~~Vk~~al~~A~eva~~iL~iD~vI~~k  472 (472)
T cd03341         411 LYAAHQKGNKSAGVDIESGDEGTKDAKEAGIFDHLATKKWAIKLATEAAVTVLRVDQIIMAK  472 (472)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999717998007824797751657877694579999999998999999998777996179