Query         gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 551
No_of_seqs    135 out of 3243
Neff          8.3 
Searched_HMMs 39220
Date          Mon May 30 02:54:19 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780849.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00114 Heat shock protein 60 100.0       0       0 1000.2  44.0  547    2-550    31-579 (580)
  2 PRK00013 groEL chaperonin GroE 100.0       0       0  997.3  42.9  529    2-531     1-530 (535)
  3 PRK12849 groEL chaperonin GroE 100.0       0       0  985.4  43.3  529    2-531     1-530 (538)
  4 PRK12852 groEL chaperonin GroE 100.0       0       0  981.7  44.5  538    1-540     1-539 (542)
  5 PRK12850 groEL chaperonin GroE 100.0       0       0  972.9  46.0  542    1-547     1-543 (543)
  6 TIGR02348 GroEL chaperonin Gro 100.0       0       0  991.4  27.5  525    3-527     1-528 (528)
  7 PRK12851 groEL chaperonin GroE 100.0       0       0  969.7  43.2  536    1-537     1-537 (541)
  8 cd03344 GroEL GroEL_like type  100.0       0       0  963.6  40.5  518    4-522     1-519 (520)
  9 CHL00093 groEL chaperonin GroE 100.0       0       0  934.3  42.7  523    2-526     1-527 (527)
 10 TIGR02339 thermosome_arch ther 100.0       0       0  952.5  26.9  468    7-524    12-522 (522)
 11 COG0459 GroL Chaperonin GroEL  100.0       0       0  821.6  36.2  501    1-528     1-518 (524)
 12 TIGR02340 chap_CCT_alpha T-com 100.0       0       0  812.5  28.3  475    7-529     8-539 (540)
 13 TIGR02345 chap_CCT_eta T-compl 100.0       0       0  806.7  26.2  481   13-525    20-536 (537)
 14 TIGR02343 chap_CCT_epsi T-comp 100.0       0       0  772.1  28.2  466    8-522    24-539 (541)
 15 cd03339 TCP1_epsilon TCP-1 (CT 100.0       0       0  745.3  34.7  470    5-522    17-526 (526)
 16 TIGR02342 chap_CCT_delta T-com 100.0       0       0  756.5  24.8  465   10-523     8-525 (526)
 17 cd03340 TCP1_eta TCP-1 (CTT or 100.0       0       0  740.7  36.6  486    9-526    14-522 (522)
 18 cd00309 chaperonin_type_I_II c 100.0       0       0  738.6  36.0  443    4-522     1-464 (464)
 19 cd03342 TCP1_zeta TCP-1 (CTT o 100.0       0       0  733.7  36.0  454    8-525     9-484 (484)
 20 cd03335 TCP1_alpha TCP-1 (CTT  100.0       0       0  733.4  35.9  473    8-525     5-527 (527)
 21 cd03343 cpn60 cpn60 chaperonin 100.0       0       0  730.6  35.6  465    9-524    13-517 (517)
 22 PTZ00212 T-complex protein 1 b 100.0       0       0  727.4  37.7  479    7-530    18-532 (533)
 23 cd03338 TCP1_delta TCP-1 (CTT  100.0       0       0  729.8  35.0  464    8-523     5-515 (515)
 24 cd03336 TCP1_beta TCP-1 (CTT o 100.0       0       0  725.5  36.9  473    8-527    10-517 (517)
 25 TIGR02346 chap_CCT_theta T-com 100.0       0       0  736.7  26.4  479    6-535    13-554 (554)
 26 pfam00118 Cpn60_TCP1 TCP-1/cpn 100.0       0       0  712.6  35.9  441   23-525     1-481 (481)
 27 KOG0356 consensus              100.0       0       0  716.0  30.4  524    2-528    15-541 (550)
 28 cd03337 TCP1_gamma TCP-1 (CTT  100.0       0       0  701.1  35.9  440    8-522    13-479 (480)
 29 cd03341 TCP1_theta TCP-1 (CTT  100.0       0       0  691.1  34.2  442    9-524     5-472 (472)
 30 KOG0361 consensus              100.0       0       0  700.6  26.6  502    9-546    18-543 (543)
 31 TIGR02344 chap_CCT_gamma T-com 100.0       0       0  704.0  20.9  464    8-524    13-524 (527)
 32 TIGR02347 chap_CCT_zeta T-comp 100.0       0       0  668.4  27.9  470    9-527    14-546 (548)
 33 KOG0358 consensus              100.0       0       0  639.5  20.4  467    9-523    24-533 (534)
 34 KOG0363 consensus              100.0       0       0  620.1  23.7  471    9-530    16-525 (527)
 35 KOG0360 consensus              100.0       0       0  577.1  17.2  473    9-532    17-544 (545)
 36 KOG0362 consensus              100.0       0       0  538.8  28.6  472    9-532    24-529 (537)
 37 TIGR02341 chap_CCT_beta T-comp 100.0       0       0  517.6  25.0  469    9-528    12-519 (519)
 38 KOG0359 consensus              100.0       0       0  505.3  24.3  468   10-526    16-517 (520)
 39 KOG0364 consensus              100.0       0       0  500.5  19.5  465    9-527    17-524 (527)
 40 KOG0357 consensus              100.0       0       0  460.0  15.9  369    3-523    20-395 (400)
 41 cd03333 chaperonin_like chaper  99.9 7.8E-27   2E-31  195.2   7.7  197  141-409     1-209 (209)
 42 cd03334 Fab1_TCP TCP-1 like do  99.9 8.3E-22 2.1E-26  162.0   6.8  211  153-412    18-257 (261)
 43 KOG0230 consensus               98.3 4.6E-06 1.2E-10   58.3   8.2  214  156-419   335-577 (1598)
 44 TIGR02343 chap_CCT_epsi T-comp  94.3   0.014 3.7E-07   35.2   0.8  157  168-350   185-353 (541)
 45 PTZ00212 T-complex protein 1 b  92.2   0.084 2.1E-06   30.2   2.0  174   11-208    29-237 (533)
 46 cd03336 TCP1_beta TCP-1 (CTT o  88.4     0.3 7.6E-06   26.6   2.1   79  149-227   160-246 (517)
 47 TIGR01265 tyr_nico_aTase tyros  77.1     2.4   6E-05   20.7   2.9  105   18-167    19-130 (424)
 48 COG3962 Acetolactate synthase   74.4     1.5 3.7E-05   22.0   1.2   13   80-92    130-142 (617)
 49 TIGR01500 sepiapter_red sepiap  68.4     6.2 0.00016   17.9   3.3   86   14-118    68-156 (267)
 50 TIGR00784 citMHS citrate trans  63.5     9.1 0.00023   16.8   3.6   33   83-118   110-142 (439)
 51 TIGR00118 acolac_lg acetolacta  56.3     7.8  0.0002   17.2   2.0   14  205-218   132-145 (593)
 52 PRK12705 hypothetical protein;  53.0      11 0.00027   16.4   2.3   12  417-428   381-392 (485)
 53 PRK06555 pyrophosphate--fructo  49.2     5.4 0.00014   18.2   0.3   52   85-136   120-180 (403)
 54 PRK11595 gluconate periplasmic  49.1      15 0.00038   15.4   2.5   16  415-430   199-214 (227)
 55 TIGR02483 PFK_mixed phosphofru  47.4      12 0.00031   16.0   1.8   22  156-177    92-113 (339)
 56 COG1712 Predicted dinucleotide  45.5     8.7 0.00022   16.9   0.9   75  252-326    66-142 (255)
 57 KOG1301 consensus               44.6      18 0.00046   14.8   4.7  115   10-127    10-152 (621)
 58 TIGR02817 adh_fam_1 zinc-bindi  44.4      15 0.00038   15.4   1.9   12  279-290   161-172 (338)
 59 PRK13890 conjugal transfer pro  44.2      18 0.00045   14.9   2.3   31  438-469    49-79  (119)
 60 TIGR02313 HpaI-NOT-DapA 2,4-di  43.5      12  0.0003   16.0   1.3   21  504-524   227-247 (294)
 61 PRK05469 peptidase T; Provisio  39.9     2.2 5.5E-05   20.9  -3.0   23  151-173    27-49  (405)
 62 KOG3411 consensus               36.6      17 0.00043   15.0   1.2   41   97-137    73-113 (143)
 63 TIGR00354 polC DNA polymerase   36.0     7.7  0.0002   17.2  -0.6  103  409-519   944-1063(1173)
 64 TIGR02142 modC_ABC molybdate A  35.4      15 0.00037   15.4   0.7   44  213-256   145-194 (361)
 65 pfam07526 POX Associated with   33.8      27 0.00068   13.7   3.1   42  387-428    82-124 (138)
 66 PTZ00009 heat shock 70 kDa pro  33.1      27 0.00068   13.7   1.7   28    5-32     48-75  (657)
 67 PRK13381 peptidase T; Provisio  33.0     3.7 9.5E-05   19.3  -2.6   21  154-174    35-55  (413)
 68 PTZ00286 6-phospho-1-fructokin  30.5      30 0.00077   13.3   2.3   22  111-132   230-251 (486)
 69 TIGR00423 TIGR00423 conserved   29.9      31 0.00079   13.3   1.9   74   96-172    38-128 (331)
 70 pfam05501 DUF755 Domain of unk  29.9      31 0.00079   13.3   1.9   35   72-106    17-51  (122)
 71 KOG1588 consensus               29.8      30 0.00075   13.4   1.5   16  439-454   175-190 (259)
 72 smart00574 POX domain associat  29.0      32 0.00082   13.2   3.2   42  387-428    84-126 (140)
 73 PRK13602 putative ribosomal pr  26.9      25 0.00065   13.8   0.8   48  242-299    25-72  (82)
 74 TIGR02407 ectoine_ectB diamino  26.1      36 0.00092   12.8   1.9   16  418-433   299-315 (413)
 75 pfam03823 Neurokinin_B Neuroki  26.0      36 0.00091   12.9   1.4   10  408-417    27-36  (59)
 76 KOG2387 consensus               25.6      37 0.00094   12.8   4.0   58  390-449   348-416 (585)
 77 pfam00752 XPG_N XPG N-terminal  25.6      22 0.00057   14.2   0.3   36   83-119    45-80  (100)
 78 TIGR00032 argG argininosuccina  25.1      35 0.00089   12.9   1.2   20  154-173    97-116 (420)
 79 TIGR00644 recJ single-stranded  24.3      39 0.00099   12.6   1.7   61   70-133    44-113 (705)
 80 KOG1924 consensus               24.1      39   0.001   12.6   3.0   10  513-522   519-528 (1102)
 81 TIGR01846 type_I_sec_HlyB type  23.9      21 0.00054   14.4  -0.1  113  210-327   423-547 (703)
 82 TIGR00315 cdhB CO dehydrogenas  23.7      22 0.00056   14.3  -0.0   38  238-275    23-62  (170)
 83 COG3333 Uncharacterized protei  22.5      42  0.0011   12.4   3.9   22   70-91     58-79  (504)
 84 PRK13304 L-aspartate dehydroge  22.2      40   0.001   12.5   1.0   75  252-326    67-143 (265)
 85 KOG1593 consensus               22.2      43  0.0011   12.4   2.6   15  456-470   280-298 (349)
 86 PRK00771 signal recognition pa  22.1      43  0.0011   12.3   3.0   14  451-464   392-405 (433)
 87 TIGR02538 type_IV_pilB type IV  21.7      44  0.0011   12.3   2.2   23  378-403   328-350 (577)
 88 TIGR00904 mreB cell shape dete  21.1      45  0.0011   12.2   3.7   41  390-430   250-307 (337)
 89 TIGR02663 nifX nitrogen fixati  20.8      38 0.00098   12.7   0.7   25  308-333     9-36  (125)
 90 TIGR01082 murC UDP-N-acetylmur  20.0      25 0.00064   13.9  -0.4   21  155-175   119-139 (491)

No 1  
>PTZ00114 Heat shock protein 60; Provisional
Probab=100.00  E-value=0  Score=1000.17  Aligned_cols=547  Identities=49%  Similarity=0.790  Sum_probs=523.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86634379899999999999999997736789863598885899838832088877760347852257889999999866
Q gi|254780849|r    2 AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         2 ~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      |+|+|+||++||.++++|+++||++|||||||+||||||+++.|+++|||||+||+|+|+++||++|+||||++|+|++|
T Consensus        31 ~~k~~~f~~~ar~~l~~gv~~vAdaV~tTLGPkG~~kml~~~~G~~~ITnDGvTIlk~i~l~~p~~n~gAkll~evA~~q  110 (580)
T PTZ00114         31 ISKDIRFGSDARTAMLTGCNKLADAVSVTLGPKGRNVIIEQSFGSPKITKDGVTVAKSIEFNNKLANLGAQMVKQVAANT  110 (580)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCEEECCHHHHHHHHCCCCCCHHHHHHHHHHHHHHC
T ss_conf             54316468999999999999999886268587867389786899965835535213341057854238999999999816


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276024222122555334568889
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEK  161 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~l  161 (551)
                      |+++||||||+||||+|||++|++|+++|+||+.|++||+.|++.++++|+++++|++++++|.++|.+|+|+++.++++
T Consensus       111 d~evGDGTTTavVLAgeLl~~a~~li~~gihP~~I~~G~~~A~~~a~e~L~~~a~~v~~~d~l~~vA~iSangd~~ig~l  190 (580)
T PTZ00114        111 NDKAGDGTTTATILARSIFQQGCKAVDSGMNPMDLLRGINKGVEHVLEYLNSIKKDVTTTEEIFNVASISANGDKNIGQL  190 (580)
T ss_pred             CCHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCHH
T ss_conf             51004875689999999999999998589998999999999999999999854788899899999999871798430027


Q ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999842432000110146552033330232001122476542331013444113102201356441001114677531
Q gi|254780849|r  162 IAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT  241 (551)
Q Consensus       162 i~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~  241 (551)
                      +++|+.+++.+|+++++.+++..+++++++|+.|++||+||||+++.++++++++||+|+++|.+++..+...|.++...
T Consensus       191 iadA~~~Vg~~Gvi~ve~~~~~~~~levv~G~~~d~gy~sp~fv~~~~~~~~el~np~ILi~d~~i~~~~~i~p~le~~~  270 (580)
T PTZ00114        191 IADTMKKVGKEGTITVTEGKTLQHELEIVEGIKFDRGYISPYFINNSKDQKVELDKPYILIHEKKISSVKSLLPILEHVL  270 (580)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCEEEECCHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             99999973235569961477764024456559982120161013471131686047376630322020221136788887


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCC-CCCCCE
Q ss_conf             1162122222333588886531213568323222212305676699886521101123321010632211222-224410
Q gi|254780849|r  242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATI-ADLGSA  320 (551)
Q Consensus       242 ~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~-~~LG~~  320 (551)
                      +..+|+++++++++.+++..++.|+.+.++++++++.|+|+++++++|+|++++||+++++++.+.++++... .+||+|
T Consensus       271 ~~~~~lliiaedi~~eal~~li~nk~~~~~~v~avk~pgfgd~rk~~leDiai~tGa~Vi~~~~g~~l~~~~~~~~LG~a  350 (580)
T PTZ00114        271 QNQSSLLVIAEDVDSDALATLIVNKLRLGLKICAVKAPGFGEHRKALLHDIAVMTGAKVITEEFGLKLDDPQVVSYLGKA  350 (580)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHCCC
T ss_conf             32742888887656889999987663277427998165036889999887887628815511115760255789984366


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.++++.++++++.+..+.+..|+.+++.+++...+.|+++++++|+++++|++++|++||+|+++++|.+|++||||
T Consensus       351 ~~v~v~kd~t~i~~g~g~~~~i~~r~~~l~~~i~~~~~~~e~e~l~erla~lsg~va~I~vGG~te~el~E~errl~DAL  430 (580)
T PTZ00114        351 KSINVTKDSTLIMEGEGKKEEINERCESIRNQIKENTSDYEKEKLQERLAKITGGVALIKVGGISEVEVNEIKDRIQDAL  430 (580)
T ss_pred             EEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             49997147527860788778899999999999874555267887877751147757999968872888999999998789


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             9987540278105553799999999745-089968999999999999999999999779998999999981689866588
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN  479 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~-~~~~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d  479 (551)
                      ||+|+++++|+|||||++|+++++.|.. +..+.++|+++++|++||+.|||+||+|||+||.+++.+|++.+++|||||
T Consensus       431 ~avraAveeGIVpGGGaall~as~~L~~~~~~~~~eq~gi~~~a~ALe~ppr~IaeNAG~d~~~vl~~l~~~~~~~~G~D  510 (580)
T PTZ00114        431 CATKAAVEEGIVPGGGSALLFASKELDSVQTDNYDQRVGVNIIKDACKAPIKQIAENAGHEGSVVAGNILKEKNKNIGFN  510 (580)
T ss_pred             HHHHHHHHCCEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
T ss_conf             99999976582168609999999998762258887999999999999999999999769978999999996069998486


Q ss_pred             CCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             66872721388398370478999999999999986609999715877888899989999997569889878
Q gi|254780849|r  480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMM  550 (551)
Q Consensus       480 ~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  550 (551)
                      +.+|+++||++.|||||+.||++||++|+|+|++||++|++|...|.++.+.|..|+.+  +++|++|++|
T Consensus       511 ~~tG~~~Dm~e~GIiDP~kV~~~Al~~A~svA~liLttd~~V~~~~~~~~~~~~~~~~~--~~~~~~~~~~  579 (580)
T PTZ00114        511 AQEGKYVDMIESGIIDPTKVVKTAISDAASIASLMTTTEVAIVDFKDQKEKENSSHMNS--VNSMGDMGGL  579 (580)
T ss_pred             CCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCCCCCCCCCC--CCCCCCCCCC
T ss_conf             78990735674688276498999999899999999978860036777777778899999--9998988888


No 2  
>PRK00013 groEL chaperonin GroEL; Reviewed
Probab=100.00  E-value=0  Score=997.25  Aligned_cols=529  Identities=60%  Similarity=0.909  Sum_probs=514.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86634379899999999999999997736789863598885899838832088877760347852257889999999866
Q gi|254780849|r    2 AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         2 ~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      |+|.|+||.+||.+|+.|+++||++|||||||+||||||+++.|+++|||||+|||++|+++||++|+||||++|+|++|
T Consensus         1 ~~~~~~fg~ear~~~i~~~~ava~~VrtTLGP~Gmdkmi~~~~G~~~ITnDGaTIl~~i~v~hP~~~~~Akll~e~A~~q   80 (535)
T PRK00013          1 MAKDIKFGEDARRALLRGVNKLADAVKVTLGPKGRNVVLEKSFGAPTITKDGVSIAKEIELEDPFENMGAQLVKEVASKT   80 (535)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEECCHHHHHHHCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             98524154999999999999999886057588878489887999935835689887770278904779999999999850


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276024222122555334568889
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEK  161 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~l  161 (551)
                      |+++||||||+||||++||+++++|+++|+||+.|++||++|+++++++|+++++|++++++|.++|++|+++++.++++
T Consensus        81 d~evGDGTTT~vVLag~LL~~a~~ll~~GihP~~I~~G~~~A~~~a~~~L~~~a~~v~~~~~l~~vA~is~~~d~~l~~l  160 (535)
T PRK00013         81 NDVAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGIDKAVEAVVEELKKISKPVSDKEEIAQVATISANGDEEIGKL  160 (535)
T ss_pred             CCHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHH
T ss_conf             42332863789999999999999998679988999999999999999999987741132879999988860673777799


Q ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999842432000110146552033330232001122476542331013444113102201356441001114677531
Q gi|254780849|r  162 IAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT  241 (551)
Q Consensus       162 i~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~  241 (551)
                      +++|+..++.+|++.++.+++..+++++++|+.|++||+||||+++.++|++.++||+|+++|.+|+.+++..++++.+.
T Consensus       161 i~~A~~~vg~~g~i~v~~~~~~~~~~e~v~G~~~~~g~~s~~fv~~~e~~~~~l~~p~Ill~d~~I~~~~~~~~~le~~~  240 (535)
T PRK00013        161 IAEAMEKVGKEGVITVEESKGFETELEVVEGMQFDRGYLSPYFVTDPEKMEAVLEDPYILLTDKKISNIQDLLPVLEQVA  240 (535)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCHHCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999973867759973267765126898628985362376557655308555027531002553200554578999999


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEE
Q ss_conf             11621222223335888865312135683232222123056766998865211011233210106322112222244102
Q gi|254780849|r  242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAK  321 (551)
Q Consensus       242 ~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~  321 (551)
                      +.+++++|++++++++++..++.|.+++.++++++++|+|+++|+++|+|++.+||++++++..+.++++++.++||+|.
T Consensus       241 ~~~~~llIia~~i~~~al~~l~~n~~~g~~~v~~vk~p~~g~~rk~~Ledia~~tGa~vi~~~~g~~l~~~~~~~LG~a~  320 (535)
T PRK00013        241 KSGKPLLIIAEDVEGEALATLVVNKLRGTLKVVAVKAPGFGDRRKAMLEDIAILTGGQVISEELGLKLENATLEDLGQAK  320 (535)
T ss_pred             HCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHCCHHHHCCCE
T ss_conf             64986675316616899999998641466304675076620477889987654008678510358874549999947875


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             78980467301377421777765433467765413563111101222102334432125676531468989887788999
Q gi|254780849|r  322 KVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLD  401 (551)
Q Consensus       322 ~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~  401 (551)
                      ++.+++++++++++.++...+..|+.+++.+++.+.+.|+++++++|+++|+|++++|+|||+|+.+++|.+|++|||||
T Consensus       321 ~v~v~~~~t~ii~g~~~~~~i~~ri~~l~~~~~~~~~~~e~~~l~eRi~~L~g~~avI~vgg~te~e~~E~~r~l~DAl~  400 (535)
T PRK00013        321 KVVITKDNTTIVDGAGDKEAIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKDRVEDALN  400 (535)
T ss_pred             EEEECCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             56425885389807898899999999999998736886778999999988528808999726406758999999999999


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             987540278105553799999999745089-9689999999999999999999997799989999999816898665886
Q gi|254780849|r  402 ATRAASDEGIVPGGGIALVRAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA  480 (551)
Q Consensus       402 v~~~~~~~~vvpGGGa~e~~ls~~l~~~~~-~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d~  480 (551)
                      |+|+++++|+|||||++|+++|.+|+.... ++++|+++++|++||++||++||+|||+||.+++.+|++. .+++|||+
T Consensus       401 avr~a~~~GiVpGGGa~ei~~a~~L~~~~~~~g~eq~~i~~~a~ALe~ip~tLaeNAG~dp~~vv~~l~~~-~~~~G~D~  479 (535)
T PRK00013        401 ATRAAVEEGIVPGGGVALLRAAPALAALKGLNGDEATGINIVRRALEAPLRQIAENAGLEGSVVVEKVKNG-PGGYGFNA  479 (535)
T ss_pred             HHHHHHHCCEECCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCEEEEC
T ss_conf             99999765931584199999999998730588289999999999999999999997799889999999837-99973878


Q ss_pred             CCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             687272138839837047899999999999998660999971587788889
Q gi|254780849|r  481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS  531 (551)
Q Consensus       481 ~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~  531 (551)
                      .+|++.||++.|||||+.||+++|++|+|+|+||||||++|.++|.++..+
T Consensus       480 ~~g~~~Dm~~~GV~Dp~~Vk~~al~~Ate~A~~iL~iD~vi~~~p~~~~~~  530 (535)
T PRK00013        480 ATGEYVDMIEAGIIDPTKVTRSALQNAASVAGLLLTTEAVVADKPEKKAPA  530 (535)
T ss_pred             CCCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             899374178777927689999999959999999998999984688777999


No 3  
>PRK12849 groEL chaperonin GroEL; Reviewed
Probab=100.00  E-value=0  Score=985.44  Aligned_cols=529  Identities=60%  Similarity=0.902  Sum_probs=513.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86634379899999999999999997736789863598885899838832088877760347852257889999999866
Q gi|254780849|r    2 AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         2 ~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      |+|.|.||+|||.++++|+++|+++|||||||+||||||+++.|+++|||||||||++|+++||++|+|||||+++|++|
T Consensus         1 ~~~~~~~~~~ar~~~l~g~~avad~vrtTLGP~GmdKmlv~~~G~~~ITNDGaTIl~~~~v~hP~~~~aAk~lve~a~~q   80 (538)
T PRK12849          1 MAKIIKFDEEARRALERGVNALADAVKVTLGPKGRNVVIDKSFGAPTITKDGVTIAKEIELEDPFENLGAQLVKEVASKT   80 (538)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             98503157999999999999999887457488878489888999805841799999872178932659999999999965


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276024222122555334568889
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEK  161 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~l  161 (551)
                      |+++|||||||||||++||++|++|+++|+||+.|++||++|+++++++|++++++++++++|.++|+||++++..++++
T Consensus        81 d~evGDGTTtvvvLageLL~~a~~Ll~~GihP~~I~~G~~~A~~~al~~L~~~a~~v~~~~~l~~va~ts~~~~~~l~~l  160 (538)
T PRK12849         81 NDVAGDGTTTATVLAQALVQEGLKNVAAGANPMELKRGIDKAVEAVVEELKKLAKPVSSKEDIAQVATVSANGDEEIGEL  160 (538)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCHHHHHHH
T ss_conf             44754863789999999999999998589889999999999999999998733667563278999999860217778789


Q ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999842432000110146552033330232001122476542331013444113102201356441001114677531
Q gi|254780849|r  162 IAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT  241 (551)
Q Consensus       162 i~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~  241 (551)
                      +++|+..++.|+++.++..++..+++++++|+.|+++|+||+|+++.++|++.++||+|+++|.+|+.+++..++++.+.
T Consensus       161 i~~A~~~v~~d~vi~v~~~~~~~~~~~~v~G~~~~~g~~s~~fv~~~~~~~~~l~~~~Ill~d~~i~~~~~~~~~le~~~  240 (538)
T PRK12849        161 IAEAMEKVGKDGVITVEESKSLETELEVVEGMQFDRGYLSPYFVTDPERMEAVLEDPLILLTDKKISSLQDLLPLLEKVA  240 (538)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999851666569972146666316887315526663475335561036688507045533443401355789999999


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEE
Q ss_conf             11621222223335888865312135683232222123056766998865211011233210106322112222244102
Q gi|254780849|r  242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAK  321 (551)
Q Consensus       242 ~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~  321 (551)
                      +.+++++|++++++.+++..++.|..+++++++.+++|.|+++++++|+|++++||++++++..+..+++++.++||+|.
T Consensus       241 ~~~~~lli~a~~i~~~~l~~l~~n~~~~~~~~~~vk~~~~g~~r~~~l~dia~~tGa~vi~~~~g~~l~~~~~~~LG~a~  320 (538)
T PRK12849        241 QSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEDLGLKLEEVTLDDLGRAK  320 (538)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCEEECCCCCCCHHHCCHHHHCCCE
T ss_conf             74995799715644899999998651266524786061366677765520233217645401025675657998808801


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             78980467301377421777765433467765413563111101222102334432125676531468989887788999
Q gi|254780849|r  322 KVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLD  401 (551)
Q Consensus       322 ~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~  401 (551)
                      ++.++++++.++.+.+.+..+..|+.+++.+++.+.+.|+++++.+|+++++|++++|++||+|+++++|++|++|||||
T Consensus       321 ~v~v~~~~~~iv~~~~~~~~v~~r~~~l~~~~~~~~s~~~~~~l~eri~~l~gg~a~I~vgG~t~~~l~E~er~l~DAl~  400 (538)
T PRK12849        321 RVTITKDNTTIVDGAGDKEAIEARVAQIRRQIEETTSDYDREKLQERLAKLAGGVAVIKVGAATETELKERKLRVEDALN  400 (538)
T ss_pred             EEEECCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             58625785699806887889998999999999745870667889888766338822454156506689889998999999


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             987540278105553799999999745089-9689999999999999999999997799989999999816898665886
Q gi|254780849|r  402 ATRAASDEGIVPGGGIALVRAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA  480 (551)
Q Consensus       402 v~~~~~~~~vvpGGGa~e~~ls~~l~~~~~-~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d~  480 (551)
                      |+|+++++|+||||||+|+++|++|+.++. ++++|+++++||+|||+||||||+|||+||.+++++|++. ..++|+|+
T Consensus       401 av~~ai~~gvvpGGGa~ei~la~~L~~~~~~~g~eq~ai~afA~ALe~iPrtLAeNAG~d~~~vv~~l~~~-~~~~G~d~  479 (538)
T PRK12849        401 ATRAAVEEGIVPGGGVALLRAAKALDELAGLNGDQKTGVEIVRRALEAPLRQIATNAGLDGSVVVAKVLEL-EGGFGFNA  479 (538)
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCCEEC
T ss_conf             99999636887784699999999999750588689999999999999999999997799889999999955-99847646


Q ss_pred             CCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             687272138839837047899999999999998660999971587788889
Q gi|254780849|r  481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS  531 (551)
Q Consensus       481 ~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~  531 (551)
                      .+|++.||++.|||||+.||+++|++|+|+|++|||||++|+++|+++.+.
T Consensus       480 ~tg~~~Dm~~~GV~Dp~~Vk~~al~~A~e~A~~iLriD~iI~~~p~~~~~~  530 (538)
T PRK12849        480 ATGEYGDLVAAGIIDPVKVTRSALQNAASVAGLLLTTEALVADKPEKEDAA  530 (538)
T ss_pred             CCCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             799177488776834799999999959999999999999985698788999


No 4  
>PRK12852 groEL chaperonin GroEL; Reviewed
Probab=100.00  E-value=0  Score=981.73  Aligned_cols=538  Identities=59%  Similarity=0.905  Sum_probs=520.2

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98663437989999999999999999773678986359888589983883208887776034785225788999999986
Q gi|254780849|r    1 MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATN   80 (551)
Q Consensus         1 ~~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~   80 (551)
                      |+||+|+||+|||..|+.|+++||++|||||||+||||||+++.|+++|||||||||++|++.||++|+|||||+++|++
T Consensus         1 ~~~~~~~f~~~ar~~~i~a~~~vAd~VrtTLGPkGmdKmlv~~~G~~~ITNDGaTILk~~~v~d~~ehpaAkllve~A~~   80 (542)
T PRK12852          1 MAAKDVKFSGDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK   80 (542)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEECCHHHHHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             98542106899999999999999989726758887848988799982384369999998058885648468999999986


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             62551886667999999999999999976988999999898644777767653222127602422212255533456888
Q gi|254780849|r   81 TEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGE  160 (551)
Q Consensus        81 qd~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~  160 (551)
                      ||+++|||||||||||+|||++|++|+++|+||+.|++||++|+++++++|+++++++.+.+++.+++++|.+++..+++
T Consensus        81 Qd~evGDGTTTvvVLAgeLL~~a~~Ll~~gihP~~Ii~Gy~~A~~~a~~~L~~~a~~v~~~~~~~~v~~~s~~~d~~l~~  160 (542)
T PRK12852         81 TNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDIAVAAVVKDIEKRAKPVASSAEIAQVGTISANGDAAIGK  160 (542)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCH
T ss_conf             67885675578999999999999999867998899999999999999887765344258779999999887417630012


Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             99999984243200011014655203333023200112247654233101344411310220135644100111467753
Q gi|254780849|r  161 KIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA  240 (551)
Q Consensus       161 li~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~  240 (551)
                      ++++|+..++.++++.++..+....++++++|+.+++||++|+|+++.++|++++++|+|++++.++...+...+.++..
T Consensus       161 li~~a~~~v~~~~vi~v~~~~~~~~~~~~v~g~~~~~g~~~~~~~~~~~~~~~~~~~~~il~~~~~i~~~~~~~~~~e~~  240 (542)
T PRK12852        161 MIAQAMQKVGNEGVITVEENKSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDAYILLHEKKLSGLQAMLPVLEAV  240 (542)
T ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCHHHHCCHHHHCCCHHHHCHHHHHHHHHHH
T ss_conf             27877764276307996137665521467511325887126635457000313322313312201110002118899999


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCE
Q ss_conf             11162122222333588886531213568323222212305676699886521101123321010632211222224410
Q gi|254780849|r  241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSA  320 (551)
Q Consensus       241 ~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~  320 (551)
                      .+.++|+++++++++.+++..++.|..++++++++++.|+|+++++++|+|++++||++++++..+..+++.+..+||++
T Consensus       241 ~~~~~~l~i~~~~~e~~~l~~l~~n~~~~~~~v~~v~~~~~~d~~~~~l~dl~i~~g~~v~~~~~~~~l~~~~~~~Lg~~  320 (542)
T PRK12852        241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQLISEDLGIKLENVTLKMLGRA  320 (542)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHCCCCCCCCCEEECHHHHCCHHHCCHHHCCCC
T ss_conf             72586056888737899999998764058526898844431479998741422025863343121015765788761654


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.++++.++++.+.+....+..++..++..+++....|+++++++|++++.|+++||++||+|+++++|++|++||||
T Consensus       321 ~~v~i~~~~~~~~~g~~~~~~i~~ri~~~~~~~~e~~~~~d~~~~~er~~~~~g~~~tI~vgG~t~~~~~E~er~l~DAl  400 (542)
T PRK12852        321 KKVVIDKENTTIVNGAGKKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDAL  400 (542)
T ss_pred             CEEECCCCCEEEECCCCCHHHHHHHHHHHHHHEECCCCCCCCEEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             22431677507964777556677788878763200236643013211100237862799966774458999999999999


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             9987540278105553799999999745089-968999999999999999999999779998999999981689866588
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN  479 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~~~~-~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d  479 (551)
                      ||+|+++++|+|||||++|++++++|+.++. +.++|+++++||+||++|||+||+|||+||.+++++|++.|.+|+|+|
T Consensus       401 ~avr~a~~~gvvpGGGa~e~~~~~~l~~~~~~~~~~q~~i~a~a~ALe~ip~tLaeNAG~d~~~vv~~l~~~~~~~~GiD  480 (542)
T PRK12852        401 NATRAAVQEGIVPGGGVALLRAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD  480 (542)
T ss_pred             HHHHHHHHCCEEECCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
T ss_conf             99998722795615579999999999987355862899999999999999999998779988999999984489988487


Q ss_pred             CCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             6687272138839837047899999999999998660999971587788889998999999
Q gi|254780849|r  480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM  540 (551)
Q Consensus       480 ~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~~~~~~  540 (551)
                      +.+|++.||++.|||||+.||+++|++|||+|+||||||++|.+.|+++  .|++|++|||
T Consensus       481 ~~~G~~~Dm~~~gV~dp~~vk~~ai~~AteaA~~iLriDdiI~~~p~~~--~~~~~~~~~~  539 (542)
T PRK12852        481 AQTEEYVDMVAKGIVDPAKVVRTALQDAASVAGLLVTTEAMVAELPKDA--APAMPAGGGM  539 (542)
T ss_pred             CCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCCCCC
T ss_conf             7899270368677856789999999849999999998999983688777--8999999999


No 5  
>PRK12850 groEL chaperonin GroEL; Reviewed
Probab=100.00  E-value=0  Score=972.94  Aligned_cols=542  Identities=61%  Similarity=0.922  Sum_probs=518.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98663437989999999999999999773678986359888589983883208887776034785225788999999986
Q gi|254780849|r    1 MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATN   80 (551)
Q Consensus         1 ~~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~   80 (551)
                      |++|+|+||+|||..|+.|+++||++|||||||+||||||+++.|+++|||||+|||++|+++||++|+|||||+++|++
T Consensus         1 ~~~~~~~~g~dar~~~i~g~~~vad~VrtTLGP~GmdKMLv~~~G~~~ITNDGaTILk~~~v~hP~~~~aAkllve~A~~   80 (543)
T PRK12850          1 MAAKEIKFSTDARDRLLRGVNILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVKEVASK   80 (543)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             98441317899999999999999988616848887808988799982794449999987137795455899999999996


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             62551886667999999999999999976988999999898644777767653222127602422212255533456888
Q gi|254780849|r   81 TEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGE  160 (551)
Q Consensus        81 qd~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~  160 (551)
                      ||+++|||||||||||+|||++|++|+++|+||+.|++||++|+++++++|+++++++++.+++.+++++++++++.+++
T Consensus        81 Qd~evGDGTTtvvvLageLL~~a~~Ll~~GiHP~~Ii~Gy~~A~~~ale~L~~~a~~v~~~~~l~~ia~~s~~~~~~~~~  160 (543)
T PRK12850         81 TNDLAGDGTTTATVLAQAIVREGAKYVAAGMNPMDLKRGIDLAVAAVVDELKKIAKKVTTSSEIAQVATISANGDESIGQ  160 (543)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCHHHH
T ss_conf             65675487678999999999999999877987798999999999999999984277889899999999987468611015


Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             99999984243200011014655203333023200112247654233101344411310220135644100111467753
Q gi|254780849|r  161 KIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA  240 (551)
Q Consensus       161 li~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~  240 (551)
                      ++++|+..++.++++.++..++...++++++|+.|+++|++|+|++++++|+..++||+|+++|.+++..+...+.++..
T Consensus       161 li~~a~~~v~~~~v~~v~~~~~~~~~~~~v~G~~~~~g~~~~~~~~~~~~~~~~l~~~~Ill~~~~i~~~~~~~~~~e~~  240 (543)
T PRK12850        161 RIAEAMDKVGKEGVITVEEAKTLGTELDVVEGMQFDRGYLSPYFVTNPEKMEAELEDPYILLHEKKISNLQDLLPLLEAV  240 (543)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHH
T ss_conf             77788874077438997204567641688611332676136733568654446650551001010022366554467887


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCE
Q ss_conf             11162122222333588886531213568323222212305676699886521101123321010632211222224410
Q gi|254780849|r  241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSA  320 (551)
Q Consensus       241 ~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~  320 (551)
                      .+..+++++++++++.+++..++.|++++++++++++.|+|+++++++|+|++++||++++++..+.++++.+.++||+|
T Consensus       241 ~~~~~~l~i~~~~~e~~~~~~l~~n~i~~~~~~~~v~~~~~~d~~~~~l~dia~~~g~~~i~~~~~~~l~~~~~~~Lg~~  320 (543)
T PRK12850        241 VQSGRPLLIIAEDVEGEALATLVVNNIRGGLKSVAVKAPGFGDRRKAMLEDIAILTGGQVISEDTGIKLENVTLDMLGRA  320 (543)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHCCHHHHCCC
T ss_conf             50686032777654499999998877605651232216406899887775332212878874134566665889883775


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.+.++.++++.+.+....+..++.+++.++++..+.|+++.+.+|+++++|+++||++||+|+++++|.+|++||||
T Consensus       321 ~~v~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~l~~r~~~~~g~~~tI~v~Gst~~~l~E~er~l~DAl  400 (543)
T PRK12850        321 KRVVVTKENTTIVDGAGDKKNIEARVKQIRVQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAL  400 (543)
T ss_pred             EEEEECCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             26884378608981678656666579999999986036410331332101037863688736885889999999999999


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             998754027810555379999999974508-9968999999999999999999999779998999999981689866588
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN  479 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~~~-~~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d  479 (551)
                      |++|+++++|+|||||++|+++++.++... .++++|+++++||+|||+||||||+|||+||.+++++|++. ..++|||
T Consensus       401 ~a~~~~~~~gvvpGGGa~~~~a~~~l~~~~~~~g~eqlai~afA~ALe~iprtLa~NAG~d~~~~v~~l~~~-~~~~G~d  479 (543)
T PRK12850        401 HATRAAVEEGIVPGGGVALLRARQALDGLKGANADQAAGIDIVRRALEEPLRQIATNAGFEGSVVVGKVAEL-PGNFGFN  479 (543)
T ss_pred             HHHHHHHHCCEECCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCEEEE
T ss_conf             999997128974462999999999999742378279999999999999999999997699889999999817-9997465


Q ss_pred             CCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             66872721388398370478999999999999986609999715877888899989999997569889
Q gi|254780849|r  480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGM  547 (551)
Q Consensus       480 ~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~~~~~~~~~~~~~  547 (551)
                      +.+|++.||++.|||||+.||+|+|++|+|+|+||||||+||+++|++++++| +|.||   +|||||
T Consensus       480 ~~~G~~~Dm~~~gV~dp~~vk~~ai~~A~eaA~~iLriDdiI~~~p~~~~~~~-~~~~~---~~~~~~  543 (543)
T PRK12850        480 AQTGEYGDMVEAGIIDPTKVTRTALQNAASVAALLITTEAMVAEAPKKAAAAA-APGGG---GGGPGM  543 (543)
T ss_pred             CCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-CCCCC---CCCCCC
T ss_conf             78997704887769167999999998499999999999999955888899999-99999---999999


No 6  
>TIGR02348 GroEL chaperonin GroL; InterPro: IPR012723   Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism. Folding of newly synthesised polypeptides in the crowded cellular environment requires the assistance of molecular chaperone proteins, such as the large bacterial chaperonins GroEL and GroES.    GroEL and GroES prevent aggregation by encapsulating individual chains within the so-called Anfinsen cage provided by the GroELGroES complex, where they can fold in isolation from one another . GroEL consists of two heptameric rings of identical ATPase subunits stacked back to back, containing a cage in each ring. Each subunit consists of three domains. The equatorial domain contains the nucleotide binding site and is connected by a flexible intermediate domain with the apical domain. The latter presents several hydrophobic amino-acid side chains at the top of the ring, orientated towards the cavity of the cage. These side chains are involved in binding either a partially folded polypeptide chain or a single molecule of GroES.   This family consists of GroEL, found in bacteria, organelles derived from bacteria, and occasionally in archaeal species. The bacterial GroEL/GroES group I chaperonin is replaced by a group II chaperonin, usually called the thermosome in archaeal species, and CCT (chaperone-containing TCP) in eukaryotes. GroEL, thermosome subunits, and CCT subunits all fall under the scope of IPR002423 from INTERPRO.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=991.44  Aligned_cols=525  Identities=60%  Similarity=0.902  Sum_probs=517.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             66343798999999999999999977367898635988858998388320888777603478522578899999998662
Q gi|254780849|r    3 AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTE   82 (551)
Q Consensus         3 ~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd   82 (551)
                      +|.|.|+++||.++.+|+.+||++||.|||||||+++|..++|.|.|||||+||+|||+++|||+|+||+|++|+|..+.
T Consensus         1 AK~i~F~~eAR~~L~~GV~~LA~AVkvTLGPKGRNVvl~K~fGaP~itkDGVtvAKEIEL~d~fENmGA~Lv~EVA~KT~   80 (528)
T TIGR02348         1 AKQIKFDEEARKALERGVDKLADAVKVTLGPKGRNVVLEKSFGAPTITKDGVTVAKEIELEDKFENMGAQLVKEVASKTN   80 (528)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCEEECCCCCCCEEEEECCCCCCEEEECCCEEEEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             97444218899999987888750013244897335786232488824737842787763388720124899999996246


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55188666799999999999999997698899999989864477776765322212760242221225553345688899
Q gi|254780849|r   83 DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKI  162 (551)
Q Consensus        83 ~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~li  162 (551)
                      +..||||||++|||.+|.+++++.+..|.+|..+.+|+++|.+.+++.|+++|+++++.+++.+||++|+|+|.++++++
T Consensus        81 D~AGDGTTTATVLA~ai~~eGLK~vaAGaNP~~lKrGIekAv~~~v~~L~~~s~~v~~~~~i~~VA~iSAnnD~eIG~lI  160 (528)
T TIGR02348        81 DVAGDGTTTATVLAQAIVKEGLKNVAAGANPIELKRGIEKAVEAVVEELKKLSKKVKGKEEIAQVATISANNDEEIGSLI  160 (528)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             77888426899999999852520265377566654328999999999998607667867777655322017834689999


Q ss_pred             HHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99998424320001101465520333302320011224765423310134441131022013564410011146775311
Q gi|254780849|r  163 AYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ  242 (551)
Q Consensus       163 ~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~~  242 (551)
                      ++|..+||.||||+|+++++..+++++++||+|||||+||||+++.++|.+.|+||+|||+|.+|+..++++|+||++.+
T Consensus       161 A~AM~kVG~dGVITVEE~k~~~T~le~veGMqFDrGY~SPYfvTd~e~m~~~LenP~ILi~DKKiS~~kdllP~LE~v~~  240 (528)
T TIGR02348       161 AEAMEKVGKDGVITVEESKSLETELEVVEGMQFDRGYISPYFVTDAEKMEVELENPYILITDKKISNVKDLLPLLEKVVQ  240 (528)
T ss_pred             HHHHHHHCCCCEEECCCCCCCCEEEEEEECEECCCCCCCCCEEECCCCEEEEECCCEEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             99999727896285026877211440230500256755763151786318986486066410116446544378899996


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEE
Q ss_conf             16212222233358888653121356832322221230567669988652110112332101063221122222441027
Q gi|254780849|r  243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKK  322 (551)
Q Consensus       243 ~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~  322 (551)
                      .++||+||+||++.++|++|++|++++.+++|+||+|+|||||+.+|+|||++||+++||++.+++|++.+.++||+|.+
T Consensus       241 ~G~PLLIIAEDveGEALaTLVvNklRG~l~v~AVKAPGFGdRRKamLeDIAiLTGG~vISEe~G~~LE~~~~~~LG~A~~  320 (528)
T TIGR02348       241 SGKPLLIIAEDVEGEALATLVVNKLRGTLNVCAVKAPGFGDRRKAMLEDIAILTGGQVISEELGLKLEEVTLDDLGKAKK  320 (528)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEHHHCCCCCCCCHHHCCCCEE
T ss_conf             18981798514563589999998416625799984599765789988323303188588730055112457624787005


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89804673013774217777654334677654135631111012221023344321256765314689898877889999
Q gi|254780849|r  323 VVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDA  402 (551)
Q Consensus       323 v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v  402 (551)
                      |.++||+|+|+.+.|.++.|..||.+++.+|+++.|+|+|++|+||++||+|||++|.||++||.++.|.+.|++|||+|
T Consensus       321 v~v~Kd~TtIv~g~G~~~~i~~Rv~qIk~qi~~t~SdYDrEKL~ERLAKL~GGVAVIkVGAaTEtElKekK~RvEDAL~A  400 (528)
T TIGR02348       321 VTVDKDNTTIVEGAGKKEAIKARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIKVGAATETELKEKKLRVEDALNA  400 (528)
T ss_pred             EEEECCCEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCEEEEEECCCCCHHHHCCCCCHHHHHHH
T ss_conf             89860634798789998899999999999986204620067899887876098589972674304331257736777898


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHH-CC-CCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             87540278105553799999999745-08-996-8999999999999999999999779998999999981689866588
Q gi|254780849|r  403 TRAASDEGIVPGGGIALVRAAQALSV-KG-DNE-DQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN  479 (551)
Q Consensus       403 ~~~~~~~~vvpGGGa~e~~ls~~l~~-~~-~~~-~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d  479 (551)
                      +|+|+++|+|||||.++++++..|.. .. .+. +++.|+++..+||+.|.|++|+|||+|+.-++.++++....++|||
T Consensus       401 TrAAvEEGiVpGGG~aL~~~~~~l~~~~~~~~~~D~~~G~~Iv~~A~~aP~rqIA~NaG~~G~Vv~e~v~~~~~~~~Gfn  480 (528)
T TIGR02348       401 TRAAVEEGIVPGGGVALLRAAAALEGSLKEDSEGDEKIGVKIVKRALEAPLRQIAENAGKDGAVVVEKVKESKDENFGFN  480 (528)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCC
T ss_conf             88887447546647899999999999986126445788799999998735899998548886799999982378874754


Q ss_pred             CCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             668727213883983704789999999999999866099997158778
Q gi|254780849|r  480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD  527 (551)
Q Consensus       480 ~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~  527 (551)
                      ..+++|.||.+.||+||..|.|+||+.|.++|.|||+++.+|...|++
T Consensus       481 A~~~~y~dl~~aGiIDP~KVtR~AL~NAASiAgllLTTEa~vad~pe~  528 (528)
T TIGR02348       481 AATGEYEDLVEAGIIDPAKVTRSALQNAASIAGLLLTTEAVVADKPEE  528 (528)
T ss_pred             CCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHEEEECCCCC
T ss_conf             666517879764874761677777765799999987553021148899


No 7  
>PRK12851 groEL chaperonin GroEL; Reviewed
Probab=100.00  E-value=0  Score=969.65  Aligned_cols=536  Identities=60%  Similarity=0.922  Sum_probs=516.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98663437989999999999999999773678986359888589983883208887776034785225788999999986
Q gi|254780849|r    1 MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATN   80 (551)
Q Consensus         1 ~~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~   80 (551)
                      |++|+|+||+|||..|+.|+++|+++|||||||+||||||+++.|+++|||||+|||++|+++||++|+|||||+++|++
T Consensus         1 ~~~~~~~~g~~ar~~~i~a~~avad~vrtTLGP~GmdKmlv~~~G~~~ITNDGaTILk~~~v~hP~~~~aAk~lve~a~~   80 (541)
T PRK12851          1 MAAKEVKFHVEAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASK   80 (541)
T ss_pred             CCCCEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             98543107899999999999999988616758887818988799982795449999987438797613899999999984


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             62551886667999999999999999976988999999898644777767653222127602422212255533456888
Q gi|254780849|r   81 TEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGE  160 (551)
Q Consensus        81 qd~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~  160 (551)
                      ||+++|||||||||||+|||++|++|+++|+||+.|++||+.|++.++++|+++++++++.+++.+++.++.++++.+++
T Consensus        81 qd~evGDGTTtvvvLageLL~~a~~Ll~~GihP~~I~~G~~~A~~~al~~L~~~s~~v~~~~~~~~va~~~~~~~~~~~~  160 (541)
T PRK12851         81 TNDVAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAAVVEELKKNARKVTTNREIAQVGTISANGDAEIGR  160 (541)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCH
T ss_conf             67786686799999999999999999977998899999999999999999985057646589999999864247711121


Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             99999984243200011014655203333023200112247654233101344411310220135644100111467753
Q gi|254780849|r  161 KIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA  240 (551)
Q Consensus       161 li~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~  240 (551)
                      ++++|+..++.++++.++..++...++++++|+.+++||++|+|+.+.++|+..++||+|+++|.+++..++..+.++..
T Consensus       161 ~~~~a~~~i~~~~~~~v~~~~~~~~~~~~v~G~~l~~g~~~~~~~~~~~~~~~~~~~~~Il~~~~~l~~~~~~~~~~e~~  240 (541)
T PRK12851        161 FLAEAMDKVGNEGVITVEEAKTFETELEVVEGMQFDRGYLSPYFVTDADKMRVELEDPYILIHEKKISNLQELLPVLEAV  240 (541)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCCCEECCCCCCCHHHCEEEECCCEEEEECCCCCHHHHHCCHHHEE
T ss_conf             67888876265545872047777615898303304786205644435420558630535886223201033200113113


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCE
Q ss_conf             11162122222333588886531213568323222212305676699886521101123321010632211222224410
Q gi|254780849|r  241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSA  320 (551)
Q Consensus       241 ~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~  320 (551)
                      .+.++++++++++++.+++..++.|.+++++++++++.|+|+++++++|+|++++||+++++.+.+.++++++.++||+|
T Consensus       241 ~~~~~~l~i~~~~~e~~~l~~~~~n~i~~~~~~~~v~~~~~~d~~~~~l~d~~~~~g~~~i~~~~~~~l~~~~~~~Lg~~  320 (541)
T PRK12851        241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLENVTLEMLGRA  320 (541)
T ss_pred             EECCCEEEEHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCHHHHCCC
T ss_conf             21585023114305689999999752246421455405213789998851010025872551101344111789882865


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.+.++.++++.+.+....+.+++.+++.++++....|+++++++|+++++|++++|++||+|+++++|.+|++||||
T Consensus       321 ~~v~i~~~~~~~~~~~~~~~~i~~~~~~i~~~i~~~~~~~~~~~l~~r~~~l~g~~~~I~vgG~t~~~l~E~er~l~DAl  400 (541)
T PRK12851        321 KKVVVEKENTTIVDGAGSKTEIEGRVAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGASTEVEVKEKKDRVDDAL  400 (541)
T ss_pred             CEEEECCCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             33674477517970677667653159999999874157510234346410147863899960686889999999999889


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             998754027810555379999999974508-9968999999999999999999999779998999999981689866588
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN  479 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~~~-~~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d  479 (551)
                      |++|+++++|+|||||++|++++++|+.+. .++++|+++++||+||++||++||+|||+||.+++++|++. ..++|+|
T Consensus       401 ~~vr~~i~~gvVpGGGa~e~~~a~~l~~~~~~~g~eqlav~afa~ALe~ip~tLaeNaG~d~~~vl~~L~~~-~~~~G~d  479 (541)
T PRK12851        401 HATRAAVEEGIVPGGGVALLRAVKALDKLTTANGDQRTGVEIVRRALEAPARQIAENAGAEGSVVVGKVREK-PESYGFN  479 (541)
T ss_pred             HHHHHHHHCCEECCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCEEEE
T ss_conf             999997438876077799999999998613687689999999999999999999997699989999999827-9998486


Q ss_pred             CCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             6687272138839837047899999999999998660999971587788889998999
Q gi|254780849|r  480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG  537 (551)
Q Consensus       480 ~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~~~  537 (551)
                      +.+|++.||++.|||||+.||+|+|++|||+|+||||||+||+++|+++++++++|.+
T Consensus       480 ~~~g~~~dm~~~gV~dp~~vk~~al~~Ate~A~~iLriD~iI~~~p~~~~~~~~~~~~  537 (541)
T PRK12851        480 AATGEYGDLYATGVIDPAKVVRTALQNAASIAGLLLTTEAMVAEKPKKEPAPAAPPGG  537 (541)
T ss_pred             CCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             7899571177776826889999999959999999998999996587789999988999


No 8  
>cd03344 GroEL GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis.
Probab=100.00  E-value=0  Score=963.60  Aligned_cols=518  Identities=62%  Similarity=0.924  Sum_probs=503.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             63437989999999999999999773678986359888589983883208887776034785225788999999986625
Q gi|254780849|r    4 KDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTED   83 (551)
Q Consensus         4 ~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~   83 (551)
                      |+|+||++||.+|+.||++++++|||||||+||||||+++.|+++|||||+|||++|+++||++|+||||++++|++||+
T Consensus         1 ~~~~~g~~a~~~ni~a~~ala~~vktTLGP~GmdKmi~~~~G~i~ITnDGaTIlk~~~v~hP~~~~aAkllve~a~~qd~   80 (520)
T cd03344           1 KDIKFGEEARKALLRGVNKLADAVKVTLGPKGRNVVIEKSFGSPKITKDGVTVAKEIELEDPFENMGAQLVKEVASKTND   80 (520)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             97623099999999999999988745749887849988799982683269999877007695354899999999997777


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             51886667999999999999999976988999999898644777767653222127602422212255533456888999
Q gi|254780849|r   84 SSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIA  163 (551)
Q Consensus        84 ~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~li~  163 (551)
                      +||||||||||||+|||++|++|+++|+||+.|++||++|++.++++|++++++++++++|.++|+||+++|+.++++++
T Consensus        81 evGDGTTtvvvLageLL~~a~~ll~~gihP~~I~~G~~~A~~~al~~L~~~a~~v~~~~~l~~vA~~s~~~d~~l~~lv~  160 (520)
T cd03344          81 VAGDGTTTATVLARAIIKEGLKAVAAGANPMDLKRGIEKAVEAVVEELKKLSKPVKTKEEIAQVATISANGDEEIGELIA  160 (520)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             85686569999999999999999867988899999999999999999987205666287999999997089646789999


Q ss_pred             HHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHC
Q ss_conf             99984243200011014655203333023200112247654233101344411310220135644100111467753111
Q gi|254780849|r  164 YAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQS  243 (551)
Q Consensus       164 ~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~~~  243 (551)
                      +|+..++.|+++.++.+++..+++++++|++|+++|+||+|+++.++|+++++||+|+++|.+|+..++..++++...+.
T Consensus       161 eA~~~v~~dg~i~v~~~~~~~~~~~~i~G~~~~~g~~~p~~~~~~~~~~~~~~~~~Ill~d~~i~~~~~~~~~le~~~~~  240 (520)
T cd03344         161 EAMEKVGKDGVITVEEGKTLETELEVVEGMQFDRGYLSPYFVTDPEKMEVELENPYILLTDKKISSIQELLPILELVAKA  240 (520)
T ss_pred             HHHHHHCCCCEEEEECCCCCCEEEEEEEEEEECCCCCCCCCCCCHHCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99986286765997337875315887201560567247534767203858853605444223232267678899999964


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEE
Q ss_conf             62122222333588886531213568323222212305676699886521101123321010632211222224410278
Q gi|254780849|r  244 GRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKV  323 (551)
Q Consensus       244 ~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v  323 (551)
                      ++++++++++++.+++..++.|+.+++++++++++|+|+++++++|+|++.+||++++++..+.++++++.++||+|.++
T Consensus       241 ~~~lliia~~i~~~~l~~l~~n~~~~~~~v~~v~~p~~g~~~~~~l~dia~~tG~~~v~~~~~~~l~~~~~~~LG~a~~v  320 (520)
T cd03344         241 GRPLLIIAEDVEGEALATLVVNKLRGGLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEELGLKLEDVTLEDLGRAKKV  320 (520)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCEEECCCCCCCHHHCCHHHHCCEEEE
T ss_conf             98368763654589999999865415653699957871157777777766413876751455677333888871832799


Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98046730137742177776543346776541356311110122210233443212567653146898988778899998
Q gi|254780849|r  324 VMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDAT  403 (551)
Q Consensus       324 ~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~  403 (551)
                      .+++++++++++.++...+..|+.+++.+++.+.+.|+++++.+|+++++|+++||++||+|+++++|++|+++|||||+
T Consensus       321 ~v~~~~~~ii~~~~~~~~i~~r~~~l~~~~~~~~~~~e~~~l~eR~~~l~g~~~tI~v~G~t~~~~~E~~r~l~DAl~av  400 (520)
T cd03344         321 VVTKDDTTIIGGAGDKAAIKARIAQIRKQIEETTSDYDKEKLQERLAKLSGGVAVIKVGGATEVELKEKKDRVEDALNAT  400 (520)
T ss_pred             EECCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             62588669992789889999999889999985287777878999999854883232116537889999999999999999


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             7540278105553799999999745089-968999999999999999999999779998999999981689866588668
Q gi|254780849|r  404 RAASDEGIVPGGGIALVRAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQK  482 (551)
Q Consensus       404 ~~~~~~~vvpGGGa~e~~ls~~l~~~~~-~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~d~~~  482 (551)
                      |+++++|+||||||+|+++|++|+.... ++++|+++++||+|||+|||+||+|||+||.+++.+|++ +++++|||+.+
T Consensus       401 k~a~~~gvvpGGGa~e~~~a~~l~~~~~~~g~eq~~i~afa~ALe~iprtLa~NaG~d~~~v~~~l~~-~~~~~Gid~~~  479 (520)
T cd03344         401 RAAVEEGIVPGGGVALLRASPALDKLKALNGDEKLGIEIVRRALEAPLRQIAENAGVDGSVVVEKVLE-SPDGFGYDAAT  479 (520)
T ss_pred             HHHHHCCEECCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH-CCCCEEEECCC
T ss_conf             99964794418469999999999976437868899999999999999999999779988999999983-79998076889


Q ss_pred             CCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7272138839837047899999999999998660999971
Q gi|254780849|r  483 SVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV  522 (551)
Q Consensus       483 g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~  522 (551)
                      |++.||++.|||||+.||+++|++|+|+|+||||||++|.
T Consensus       480 g~~~Dm~~~GI~Dp~~Vk~~al~~A~e~A~~iL~~d~iI~  519 (520)
T cd03344         480 GEYVDMIEAGIIDPTKVVRSALQNAASVASLLLTTEALVV  519 (520)
T ss_pred             CCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHEEE
T ss_conf             9574178776834799999999969999999984402563


No 9  
>CHL00093 groEL chaperonin GroEL
Probab=100.00  E-value=0  Score=934.27  Aligned_cols=523  Identities=49%  Similarity=0.784  Sum_probs=503.0

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86634379899999999999999997736789863598885899838832088877760347852257889999999866
Q gi|254780849|r    2 AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         2 ~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      |+|.|+||+|||..|+.|+++||++|||||||+||||||+++.|+++|||||+||||+|+++||+++++|+|++++|++|
T Consensus         1 ~~~~~~~g~~ar~~~~~g~~~vA~~VrtTLGPrGmdKmLv~~~G~~~ITNDGaTIlk~~~l~~p~~~~~a~li~~aa~~q   80 (527)
T CHL00093          1 MAKKILYQDDARRALERGMDILAEAVSVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKT   80 (527)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             98524168999999999999999987257588878389888999806842699998872466801308999999999723


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276024222122555334568889
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEK  161 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~l  161 (551)
                      |+++|||||||||||++||++|++|+++|+||+.|++||++|++.+++.|+++++++++.+.+.+++++|++++..++++
T Consensus        81 d~~vGDGTTTvvVLag~LL~~a~~ll~~gihP~~I~~G~~~A~~~al~~L~~~a~~v~d~~~l~~va~~s~~~~~~~~~l  160 (527)
T CHL00093         81 NDVAGDGTTTATVLAYAMVKQGMKNVAAGANPIALKRGIEKATQFVVSKIAEYAKPVEDTQAITQVASISAGNDDEVGKM  160 (527)
T ss_pred             CCHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCHHHH
T ss_conf             53213863689999999999999998679878999999999999999987642456589999999999971797300147


Q ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCC-CHHHHHHH
Q ss_conf             99999842432000110146552033330232001122476542331013444113102201356441001-11467753
Q gi|254780849|r  162 IAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQP-LLPILESA  240 (551)
Q Consensus       162 i~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~-~~~~le~~  240 (551)
                      +++|+.+++.|+++.++..+++.+++++++|+.|+++|++|+|+++.++|++.++||+|+++|.+++..++ ..+.++..
T Consensus       161 i~da~~~v~~d~vi~v~~~~~~~~~~~~~~G~~~d~g~~~~~~~~~~~~~~~~~~n~~ili~d~~i~~~~~~~~~~~~~~  240 (527)
T CHL00093        161 IADAIEKVGKEGVISLEEGKSTSTELEITEGMRFEKGFISPYFVTDTERMEVVQENPYILLTDKKITLVQQDLLPILEQI  240 (527)
T ss_pred             HHHHHHHHCCCCCEEECCCCCCCEEEEECCCEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999984013723101477653378741560025787677413462220587227520134542121177767899999


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCE
Q ss_conf             11162122222333588886531213568323222212305676699886521101123321010632211222224410
Q gi|254780849|r  241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSA  320 (551)
Q Consensus       241 ~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~  320 (551)
                      .+.++++++++++++.+++..++.|..++++++++++.|+|++.++++|+|++++||++++.++.+..++++..++||++
T Consensus       241 ~~~~~~lli~~~~~~~~~l~~l~~n~~~~~~~v~~v~~~~~~d~~~~~l~diai~tg~~vi~~~~~~~~~~~~~~~lg~a  320 (527)
T CHL00093        241 AKTKRPLLIIAEDVEKEALATLVVNKLRGIVNVVAVRAPGFGDRRKAMLEDIAILTGGQVITEDAGLSLETIQLDMLGQA  320 (527)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCHHHHHHHHHHCCCCCCEECCHHCCCCHHHCCHHHHCCC
T ss_conf             86274377887888899999999988606532000138885468998876331255774210221687665789772551


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.+.++.+.++. .+....+..+|.+++.+++.....++++++.+|+++++|+++||++||+|+++++|.+|++||||
T Consensus       321 ~~v~~~~~~~~~~~-~~~~~~v~~~~~~l~~~~~~~~~~~~~~~~~~r~~~l~g~~~tI~vgg~t~~~~~E~~r~l~DAl  399 (527)
T CHL00093        321 RRVIVTKDSTTIIA-DGNEQQVKARCEQIRRQIEIADSSYEKEKLQERLAKLSGGVAVIKVGAATETEMKDKKLRLEDAI  399 (527)
T ss_pred             EEEEECCCCEEEEE-CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHEECCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             14772478438982-58689999899999999861355123320011110037872035438874568999999998899


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHCCC---CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             9987540278105553799999999745089---9689999999999999999999997799989999999816898665
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSVKGD---NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYG  477 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~~~~---~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G  477 (551)
                      ||+|+++++|+||||||+|+++|++|+.++.   +++||+++++||+||++||+|||+|||+||.+++.+|++. .+++|
T Consensus       400 ~avr~ai~~gvVpGGGa~e~~la~~L~~~a~~~~~g~eq~~i~afa~ALe~ip~tLaeNAG~d~~~~~~~l~~~-~~~~G  478 (527)
T CHL00093        400 NATKAAVEEGIVPGGGTTLAHLSEELKTWAKNNLKEDELIGALIVERALTAPLKRIAENAGQNGSVIIEKVKNK-EFNIG  478 (527)
T ss_pred             HHHHHHHHCCEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCC
T ss_conf             99999975585507609999999999998745685589999999999999989999997799889999999807-99964


Q ss_pred             EECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8866872721388398370478999999999999986609999715877
Q gi|254780849|r  478 YNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK  526 (551)
Q Consensus       478 ~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~  526 (551)
                      ||+.+|++.||++.|||||+.||+++|++|+|+|+||||||+||+++|.
T Consensus       479 iD~~~g~~~Dm~~~gV~dp~~vk~~al~~Ate~A~~iLriDdiI~~kp~  527 (527)
T CHL00093        479 YNAANGEFVDMYEAGIIDPAKVTRSALQNAASIASMILTTECIIVDKPE  527 (527)
T ss_pred             EECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             7778993615886859476899999999799999999989999972889


No 10 
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal; InterPro: IPR012714    Thermosome is the name given to the archaeal rather than eukaryotic form of the group II chaperonin (counterpart to the group I chaperonin, GroEL/GroES, in bacteria), a toroidal, ATP-dependent molecular chaperone that assists in the folding or refolding of nascent or denatured proteins. Various homologous subunits, one to five per archaeal genome, may be designated alpha, beta, etc., but phylogenetic analysis does not show distinct alpha subunit and beta subunit lineages traceable to ancient paralogs.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=952.47  Aligned_cols=468  Identities=26%  Similarity=0.369  Sum_probs=414.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             37989999999999999999773678986359888589983883208887776034785225788999999986625518
Q gi|254780849|r    7 KLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSG   86 (551)
Q Consensus         7 ~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~G   86 (551)
                      -.|.||+..|+.|+++|+++||||||||||||||||+.|+++||||||||||+|++|||    +||||+|.|++||.|+|
T Consensus        12 t~GrDA~~~NI~AAkavaE~vkStLGPrGMDKMLVDs~GDVtITNDGATILkeMDieHP----aAKmlVEVAktQd~EvG   87 (522)
T TIGR02339        12 TKGRDAQRNNIAAAKAVAEAVKSTLGPRGMDKMLVDSLGDVTITNDGATILKEMDIEHP----AAKMLVEVAKTQDAEVG   87 (522)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHCCCCCCCEEECCCCCEEECCCCCCCH----HHHHHHHHHHHHHHHCC
T ss_conf             45679988538999999999874278888701131778887984886343135678785----78999999986300006


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH-------HH
Q ss_conf             86667999999999999999976988999999898644777767653222127--6024222122555334-------56
Q gi|254780849|r   87 DGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD-------RE  157 (551)
Q Consensus        87 DGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~-------~~  157 (551)
                      |||||+|||||+||++|++||+++|||+.|++||++|.++|++.|++++.+++  |++.|.++|.||++||       .+
T Consensus        88 DGTTTAVVLAG~LL~kAEdLL~~~iHPTvI~~GYr~A~~~A~~~id~iA~~i~~~D~~~L~K~A~Ts~tgK~~ae~~~d~  167 (522)
T TIGR02339        88 DGTTTAVVLAGELLEKAEDLLEQDIHPTVIIEGYRKAAEKALEIIDEIATKIDVEDRDLLKKVAETSLTGKASAEETKDK  167 (522)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             73488999998999999986207998458733158889999999986246489885999999987623313445688999


Q ss_pred             HHHHHHHHHHHC-----------CCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             888999999842-----------432000110146552033330232001122476542331013444113102201356
Q gi|254780849|r  158 IGEKIAYAMEQI-----------GPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       158 l~~li~~A~~~i-----------~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
                      |++++++|++.+           +.|.+...++.|++..||+||+|+++||..+||       +||++++||+|+++|.|
T Consensus       168 La~lvv~AV~~v~e~~~dg~y~vDld~I~i~K~~Ggs~~Dt~Lv~GiV~DKE~Vh~-------gMP~~V~nAkialLD~p  240 (522)
T TIGR02339       168 LANLVVEAVKQVAEKREDGKYYVDLDNIKIEKKTGGSIEDTELVEGIVVDKEVVHP-------GMPKRVENAKIALLDAP  240 (522)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEECCCCEEEEECCCCEEECCEEEEEEEEEECCCCC-------CCCCEECCCCEEEECCC
T ss_conf             99999999998863048887773344337861458701111236505985103582-------36930348324675564


Q ss_pred             CCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCC-------------CCHHHHHH--HHHHHH
Q ss_conf             441001114677531116212222233358888653121356832322221-------------23056766--998865
Q gi|254780849|r  227 ISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVK-------------APAFGDRR--KEVLRD  291 (551)
Q Consensus       227 Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk-------------~~~~~~~~--~~~L~d  291 (551)
                      ||..||.......+....+=-.++  +-|...|+..++.+...|.||+.|+             .++++-||  |++++.
T Consensus       241 LEv~KtE~~a~i~I~~P~Qi~~Fl--dqEe~~Lke~VD~i~~~GAnVVfCQKGIDD~Aq~yLak~GIlAvRRVKkSDi~~  318 (522)
T TIGR02339       241 LEVEKTEIDAEISITSPDQIKKFL--DQEEAMLKEMVDKIADAGANVVFCQKGIDDLAQHYLAKAGILAVRRVKKSDIEK  318 (522)
T ss_pred             CCCCCCCCCCEEEECCHHHHHHHH--HHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHCCEEEECCCCHHHHHH
T ss_conf             314477433403307889999999--999999999988999828987982288689999987105602204335337999


Q ss_pred             HHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC
Q ss_conf             21101123321010632211222224410278980467301377421777765433467765413563111101222102
Q gi|254780849|r  292 IAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAK  371 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~  371 (551)
                      |+.+|||++++     ++++++.+|||++..|...+.                              ..++..| -+.|+
T Consensus       319 LarATGA~i~s-----~i~e~~~~DLG~A~lVE~r~v------------------------------G~~~m~F-veg~k  362 (522)
T TIGR02339       319 LARATGAKIVS-----SIKEITESDLGYAELVEERKV------------------------------GDDKMVF-VEGCK  362 (522)
T ss_pred             HHHHCCCCEEC-----CHHHCCHHHCCCEEEEEEEEE------------------------------CCCEEEE-EEECC
T ss_conf             98731884125-----731169636761422686542------------------------------6862388-84079


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHH
Q ss_conf             334432125676531468989887788999987540278-1055537999999997450899--6899999999999999
Q gi|254780849|r  372 LAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRKALSY  448 (551)
Q Consensus       372 l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~AL~~  448 (551)
                      .+++|++++|| +|||++||.||+++|||+|+++++++| +||||||+|+++|.+||.|+.+  ++||+++++||+|||.
T Consensus       363 npKAVtiLlRG-gtehVVDE~ERsl~DAL~VV~~~l~dg~~VAGGGA~E~E~A~RlR~yA~~~~GrEQLA~eaFAdALE~  441 (522)
T TIGR02339       363 NPKAVTILLRG-GTEHVVDELERSLQDALHVVASALEDGKVVAGGGAVEIELALRLRSYARSIGGREQLAIEAFADALEE  441 (522)
T ss_pred             CCCEEEEEEEC-CCCEEHHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             98357899965-87501021346688899999998608977228845999999987887356887036888999999888


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHCCC----CCEEEECCCCCEEE-HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999779998999999981689----86658866872721-388398370478999999999999986609999715
Q gi|254780849|r  449 PCRQIIKNAGDESELIVSKIQESKT----ANYGYNAQKSVFGD-MFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD  523 (551)
Q Consensus       449 ip~~La~NaG~d~~~~i~~l~~~~~----~~~G~d~~~g~i~d-~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~  523 (551)
                      ||++|||||||||++.|.+||+.|.    +|||+|+.+|+|.| |+++|||||+.||.|+|++|||+|+|||||||+|-+
T Consensus       442 iP~~LAENAGlDPID~Lv~LR~~He~~G~~~aG~nV~~G~ieD~M~e~gV~ePl~VK~qaI~SAtEAA~miLRIDD~IAA  521 (522)
T TIGR02339       442 IPRILAENAGLDPIDALVELRAKHEKEGNKNAGLNVFTGEIEDDMLELGVIEPLRVKEQAIKSATEAATMILRIDDVIAA  521 (522)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEECCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999863386888999999998522485166540322223325555486663788799999999999988625345317


Q ss_pred             C
Q ss_conf             8
Q gi|254780849|r  524 A  524 (551)
Q Consensus       524 ~  524 (551)
                      +
T Consensus       522 ~  522 (522)
T TIGR02339       522 K  522 (522)
T ss_pred             C
T ss_conf             9


No 11 
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=0  Score=821.61  Aligned_cols=501  Identities=46%  Similarity=0.687  Sum_probs=465.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98663437989999999999999999773678986359888589983883208887776034785225788999999986
Q gi|254780849|r    1 MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATN   80 (551)
Q Consensus         1 ~~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~   80 (551)
                      |+++...||.+||.+|+.|+++++++|||||||+||||||+++.|+++|||||+||+|+|+++||    +|||++++|++
T Consensus         1 ~~~~~~~~~~~a~~~~~~~~~~la~~vkttLGPkG~~k~l~~~~g~~~iTnDG~tIlkeielehp----~akll~eva~~   76 (524)
T COG0459           1 MMGKERKFGEDARRSNIRAARALADAVKTTLGPKGRNKMLVDSGGDITITNDGVTILKEIELEHP----GAKLLVEVAKK   76 (524)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEECCCCEEHHHHHCCCC----HHHHHHHHHHH
T ss_conf             98542004098999999999999999873569877717887599987883596075255522481----56999999997


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHHHHHH
Q ss_conf             62551886667999999999999999976988999999898644777767653222127602-----4222122555334
Q gi|254780849|r   81 TEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSRE-----EIIQVATISANGD  155 (551)
Q Consensus        81 qd~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~-----~L~~vA~tS~~~~  155 (551)
                      ||+++||||||+||||++||++|.+++++|+||+.|++||++|.+.++++|++.++++.+.+     ...++++.+++++
T Consensus        77 qd~e~GDGTTtavVLa~all~ea~~li~~gi~P~~I~~G~~~A~~~~~e~l~~~a~~v~~~~~~~~~~~t~v~sk~~~~~  156 (524)
T COG0459          77 QDDEAGDGTTTAVVLAGALLKEAEKLIAAGIHPTVIKRGYRLAVEKAVEELKEIAKPVSDSEEELKIAITSVASKSANSD  156 (524)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHEEEEEECCCCH
T ss_conf             67776486367999999999989999986998799999999999999999998604577640443320103554301670


Q ss_pred             HHHHHHHHHHHHHCCC-----CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             5688899999984243-----20001101465520333302320011224765423310134441131022013564410
Q gi|254780849|r  156 REIGEKIAYAMEQIGP-----HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL  230 (551)
Q Consensus       156 ~~l~~li~~A~~~i~~-----d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~  230 (551)
                      +.+++++++|+.+++.     ++++.++..+++.+++++++|++||+||.+|||+.+     +.++||+|+++|++|+..
T Consensus       157 ~~i~~lv~~Av~~v~~~~~d~~~i~~vk~~gg~~~e~~vveG~~~dkg~~s~~~~~~-----~~~e~~~Ili~d~~l~~~  231 (524)
T COG0459         157 EEIGELVVEAVEKVGKEQSDLDGIIIVKESGGSETELEVVEGMVFDKGYLSPYFMPD-----KRLENPKILLLDKKLEIK  231 (524)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCC-----CCCCCCEEEEECCCCCCC
T ss_conf             789999999999853345676775999946987521078842794477678778875-----402564289972666656


Q ss_pred             CCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCC
Q ss_conf             01114677531116212222233358888653121356832322221230567669988652110112332101063221
Q gi|254780849|r  231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLE  310 (551)
Q Consensus       231 ~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~  310 (551)
                      ++.+| ++...+..++|++++++++.+++.++++|+.+.|+++++++.|+|+|+++++|+|++++|+.++..++.+   .
T Consensus       232 k~~l~-~e~~i~~~~~l~~i~e~ee~e~l~~~v~ni~~~g~~~vvv~~~gi~D~~~~~L~d~~Ilt~~~v~~~dl~---~  307 (524)
T COG0459         232 KPELP-LEIVISSGKPLLIIAEDEEGEALATLVVNILRGGANVVVVKAPGIDDLAKAYLEDIAILTGRRVKKEDLG---E  307 (524)
T ss_pred             CCCCC-CEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEECCEECCHHHH---H
T ss_conf             54576-0478458307999999998999999999998558978999799876899999986272342222303267---8


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHC-CCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHH
Q ss_conf             1222224410278980467301377421777765433467765413-563111101222102334432125676531468
Q gi|254780849|r  311 KATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDT-KSDYDRDKLKERLAKLAGGVAVLEVGDVTEAAL  389 (551)
Q Consensus       311 ~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~-~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~  389 (551)
                        ....++.+.++...++.+....+.+          . ..++++. .++|...++.+|..+ .++++||++||+|++++
T Consensus       308 --~l~~~~ga~~v~~~~d~t~~~~G~~----------~-~~~ve~~~~~~~~~~~~~~~~~~-~~~~~tI~vrgate~~l  373 (524)
T COG0459         308 --RLAKLGGAKIVSVLKDLTTIVLGEG----------A-AGLVEETKTGDYDMEKLQERKAK-AGGVATILVRGATEVEL  373 (524)
T ss_pred             --HHHHHCCCEEEEECCCCCCCCCCCC----------C-CCEEEEEECCCCCEEHEEEHHHC-CCCEEEEEECCCCHHHH
T ss_conf             --9997259448844477751004655----------1-00589972176100000001304-89738999787637789


Q ss_pred             HHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHC--CCCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             989887788999987540278-1055537999999997450--8996-89999999999999999999997799989999
Q gi|254780849|r  390 GEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVK--GDNE-DQCAGIEIVRKALSYPCRQIIKNAGDESELIV  465 (551)
Q Consensus       390 ~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~--~~~~-~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i  465 (551)
                      +|.+|++||||+++|+++++| +|||||++|++++.+|+.+  ...+ ++++++++|++|||.||++||+|||+||.+++
T Consensus       374 ~E~er~i~DAL~~~~~ave~g~iV~GGGa~e~~~a~~L~~~~~~~~g~~e~~~i~~~a~Ale~~pr~La~NaG~d~~~v~  453 (524)
T COG0459         374 DEKERRIEDALNVVRAAVEEGKIVPGGGAAEIEAALRLREYAMTVEGGDEQLGIEAFARALEAPPRQLAENAGLDPIEVL  453 (524)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             88898999999999998534886747789999999999865335763789999999999999899999997798889999


Q ss_pred             HHHHHCCC-CCEEEECCCCCE-EEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99981689-866588668727-2138839837047899999999999998660999971587788
Q gi|254780849|r  466 SKIQESKT-ANYGYNAQKSVF-GDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE  528 (551)
Q Consensus       466 ~~l~~~~~-~~~G~d~~~g~i-~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~  528 (551)
                      ++|++.|. +++|||+.++++ .||++.|||||+.||+++|++|+|+|++|||+|++|.++|.+.
T Consensus       454 ~~L~~~~~~~~~G~d~~~~~~~~dm~~~GIidP~~v~~~al~~A~e~a~llL~~d~iI~~~~~~~  518 (524)
T COG0459         454 SKLRSAHATTNYGIDAFTGEYEDDMIEAGIIDPLKVKRSALKNAAEAAGLLLTIDDIIAAKPEEK  518 (524)
T ss_pred             HHHHHCCCCCCCCEEECCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCC
T ss_conf             99983546676445702686334557615747299999999869999999985766114577544


No 12 
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit; InterPro: IPR012715    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacteria, GroEL/GroES. This family consists exclusively of the CCT alpha chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=812.54  Aligned_cols=475  Identities=24%  Similarity=0.313  Sum_probs=407.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             37989999999999999999773678986359888589983883208887776034785225788999999986625518
Q gi|254780849|r    7 KLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSG   86 (551)
Q Consensus         7 ~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~G   86 (551)
                      .-|.++|.+|+.|+.+++++|||||||-|+|||+||+.|+++|||||||||+.|+++||    |||+|+|+|+-||+|+|
T Consensus         8 ~~G~~vR~~Nv~A~~a~aN~vKtSLGP~GLDKMLVDd~GdVtiTNDGATIL~~L~V~HP----AAKvLVeLA~lQD~EVG   83 (540)
T TIGR02340         8 TSGQDVRTQNVTAAMAIANIVKTSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP----AAKVLVELAQLQDREVG   83 (540)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCEEEECCHHHHHHHCCCCCC----CHHHHHHHHHHCCCCCC
T ss_conf             45457999999999998202522378877530024035866883586899834173476----02688876552470206


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHCC--CCHHHHHHHHHHHHHH------HH
Q ss_conf             86667999999999999999976988999999898644777767653-222127--6024222122555334------56
Q gi|254780849|r   87 DGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKA-NHKKVG--SREEIIQVATISANGD------RE  157 (551)
Q Consensus        87 DGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~-~s~~i~--~~~~L~~vA~tS~~~~------~~  157 (551)
                      |||||||++|+|||++|.+||.+++||+.||+|||+|+++|++|+++ ++..++  .++.|.|+|+||++||      +.
T Consensus        84 DGTTSVVi~AaeLLK~A~eLv~~~vHPT~iI~GyrlA~kEA~~YI~e~l~~~~~~Lg~~~LiN~AkTSmSSKiI~~~sd~  163 (540)
T TIGR02340        84 DGTTSVVILAAELLKRADELVKRKVHPTSIISGYRLALKEAVKYIKENLSVSVDELGREALINVAKTSMSSKIIGLDSDF  163 (540)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHEECCCHHH
T ss_conf             85068999999999868998636999724320478999999987777652204331502557787665333101677335


Q ss_pred             HHHHHHHHHHHCCC-----------CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             88899999984243-----------2000110146552033330232001122476542331013444113102201356
Q gi|254780849|r  158 IGEKIAYAMEQIGP-----------HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       158 l~~li~~A~~~i~~-----------d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
                      |++++++|+..|..           +++-.+|..|++..+|.|++|+.++.+..+       ++||+++.++||+++|+.
T Consensus       164 F~~~VVDA~~~vk~~~~~g~~~YPik~vniLKaHG~S~~eS~L~~GYALnc~~As-------q~Mp~~i~~aKIA~LDF~  236 (540)
T TIGR02340       164 FSNLVVDAVLAVKVTNEKGETKYPIKAVNILKAHGKSARESVLVKGYALNCTVAS-------QQMPKRIKKAKIACLDFN  236 (540)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEECCCCCCCEECCCCCCHHCCCCCCCCHHHHHHHH-------HCCCHHHHCCCEEEEECC
T ss_conf             7899999998764305788700770133202288843102632265113435665-------305111101130322035


Q ss_pred             CCCCCCCHHH---------HHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECC----CCCCHHHHHH--HHHHHH
Q ss_conf             4410011146---------775311162122222333588886531213568323222----2123056766--998865
Q gi|254780849|r  227 ISALQPLLPI---------LESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLA----VKAPAFGDRR--KEVLRD  291 (551)
Q Consensus       227 Le~~~~~~~~---------le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~----vk~~~~~~~~--~~~L~d  291 (551)
                      |...+..+..         ||.+++  ++..|+.++++.-.-+.-.+-+..+|++.+|    |.++.++-||  +++|.+
T Consensus       237 L~K~k~~lGv~i~v~Dp~~LE~IR~--~E~dI~k~Ri~~il~AGAnVvLTT~GIDD~c~K~fVEag~mavRR~~K~DLk~  314 (540)
T TIGR02340       237 LQKAKMALGVQIVVDDPAKLEKIRQ--READITKERIKKILKAGANVVLTTGGIDDLCLKYFVEAGAMAVRRCKKEDLKR  314 (540)
T ss_pred             HHHHHHHCCEEEEECCHHHHHHHHH--HHHHHHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHHCCEEEEECCCHHHHHH
T ss_conf             1322110533887258578899988--88889999999999749918980777456761245324604785047788898


Q ss_pred             HHHHCCCCCCCHHHCCC-CCCCCCCCCCCEEEEEE---ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             21101123321010632-21122222441027898---046730137742177776543346776541356311110122
Q gi|254780849|r  292 IAAVVGATVISEEIGLK-LEKATIADLGSAKKVVM---SKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~-l~~~~~~~LG~~~~v~i---~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
                      +|.+||++++..-...+ -+.++.+.||+|.+|..   ..|+..++.+.                               
T Consensus       315 iAKATG~~l~~tlA~leG~E~f~~s~LG~a~Ev~~eri~Dde~IlikG~-------------------------------  363 (540)
T TIGR02340       315 IAKATGGTLVSTLADLEGEETFDASYLGFADEVVEERIADDECILIKGT-------------------------------  363 (540)
T ss_pred             HHHHHCCHHHHHHCCCCCCCCCCHHHCCCCCEEEEEEECCCCEEEEECC-------------------------------
T ss_conf             8766251130132067750015720078731034434446646884178-------------------------------


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHH
Q ss_conf             2102334432125676531468989887788999987540278-1055537999999997450899--689999999999
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRK  444 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~  444 (551)
                         +-.. .+-|++||+|++.+||.|||+||||||+|.++|++ |||||||.|..+|-+|..++.+  .+||++|..||+
T Consensus       364 ---k~~~-~~SIILRGAN~~~lDEmeRSlHDaLcvVkRtLES~~VVpGGGAvE~ALS~yLE~~A~tl~srEQlAiaeFA~  439 (540)
T TIGR02340       364 ---KKRK-SASIILRGANDFMLDEMERSLHDALCVVKRTLESNSVVPGGGAVETALSIYLENFATTLGSREQLAIAEFAE  439 (540)
T ss_pred             ---CCCC-EEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             ---9763-244686166511554666777778878766213786438840999999998986514346345689999999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCC---------------CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             9999999999977999899999998168---------------9866588668727213883983704789999999999
Q gi|254780849|r  445 ALSYPCRQIIKNAGDESELIVSKIQESK---------------TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGS  509 (551)
Q Consensus       445 AL~~ip~~La~NaG~d~~~~i~~l~~~~---------------~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e  509 (551)
                      ||.+||++||-||+.|+.|.+++||+.|               .+|+|+|+.+|++.|.++.||+||...|...|++|||
T Consensus       440 ALL~IPk~LAvNAA~DsteLVA~LRa~H~~~q~~~~~~~~~~~~~~~GLDL~~G~i~dn~~aGvlEP~~sKvKsLkfAtE  519 (540)
T TIGR02340       440 ALLIIPKVLAVNAAKDSTELVAKLRAYHAAAQLKPDPAEEKKHLKWLGLDLSNGKIRDNVEAGVLEPAVSKVKSLKFATE  519 (540)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCEECCCCEEECCCEECEECCHHHHHHHHHHHHH
T ss_conf             98532468876542157899999998768974278636788622211300257724122032100423678899989999


Q ss_pred             HHHHHHHHHHHHHCCCCCCC
Q ss_conf             99986609999715877888
Q gi|254780849|r  510 LAGMMLITEAVVVDAPKDET  529 (551)
Q Consensus       510 ~a~~iLriD~iI~~~~~~~~  529 (551)
                      +|++||||||+|+-.|.++.
T Consensus       520 AAitILRIDd~I~L~p~~~~  539 (540)
T TIGR02340       520 AAITILRIDDLIKLNPEEEK  539 (540)
T ss_pred             HHHHHHHHCCEEEECCCCCC
T ss_conf             99888501353661765789


No 13 
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit; InterPro: IPR012720    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT eta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=806.70  Aligned_cols=481  Identities=23%  Similarity=0.289  Sum_probs=421.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             99999999999999773678986359888589983883208887776034785225788999999986625518866679
Q gi|254780849|r   13 RDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTA   92 (551)
Q Consensus        13 ~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGTTtv   92 (551)
                      .-+|+.||.+|+++|+||||||||||||+++.+..+|||||||||+.|++-||    |||+||++|++||+|+|||||||
T Consensus        20 ~~SNi~AC~~I~E~l~~TLGPrGMDKLi~~~~~ka~vsNDGATIlk~LDivHP----AA~~LVDiaksQD~EvGDGTTSV   95 (537)
T TIGR02345        20 LISNINACVAIAEILKTTLGPRGMDKLIVGKNGKATVSNDGATILKLLDIVHP----AAKTLVDIAKSQDSEVGDGTTSV   95 (537)
T ss_pred             EEHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCEEEECCHHHHHHHCCCCCC----HHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             31147899989998613688864400024589732786566889834476473----68899999974023338850678


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC------------CCHHHHHHHHHHHHHH-----
Q ss_conf             99999999999999976988999999898644777767653222127------------6024222122555334-----
Q gi|254780849|r   93 TCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG------------SREEIIQVATISANGD-----  155 (551)
Q Consensus        93 vvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~------------~~~~L~~vA~tS~~~~-----  155 (551)
                      ||||+|||+++.+||+.|+||+.|+++|+.|+..|++.|++++..+.            .++.|+++|.|+++||     
T Consensus        96 ~~La~elL~~~kp~ie~g~hp~~I~~~y~~a~~~a~~kl~e~~v~~~~~~pg~~gf~~~~Re~L~~cA~T~l~SKli~~~  175 (537)
T TIGR02345        96 VVLAGELLKEAKPFIEEGVHPQLIIRCYREALKLAIEKLKEIAVTIDEKEPGNTGFKGEQREVLEKCAATALSSKLISHE  175 (537)
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHH
T ss_conf             88889999863137651788015688899999999998766100001357766665703579999999888641100100


Q ss_pred             -HHHHHHHHHHHHHCCCCC----HHHHCC-CCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             -568889999998424320----001101-46552033330232001122476542331013444113102201356441
Q gi|254780849|r  156 -REIGEKIAYAMEQIGPHG----IITIDQ-AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISA  229 (551)
Q Consensus       156 -~~l~~li~~A~~~i~~d~----vi~i~~-~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~  229 (551)
                       .++++++++|+..+..|.    .|-||+ .||+..||.+|+|+.|+|+|.+.+|    |++||++.||+|+++|.+||.
T Consensus       176 k~fFs~M~VDAV~~L~~d~~~~~lIGvKkV~GGsl~DS~~V~GVAFkKTFsYAGf----EqqPK~~~NPkI~~LNvELEl  251 (537)
T TIGR02345       176 KEFFSKMIVDAVLQLDIDDLDLKLIGVKKVQGGSLEDSVLVNGVAFKKTFSYAGF----EQQPKKFANPKILLLNVELEL  251 (537)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEECCEEECCCCCCCCC----CCCCCCCCCCEEEEEHHHHHH
T ss_conf             2221313788999986876750276335403873215504346101225465652----368850267604520012432


Q ss_pred             CCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCC
Q ss_conf             00111467753111621222223335888865312135683232222123056766998865211011233210106322
Q gi|254780849|r  230 LQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKL  309 (551)
Q Consensus       230 ~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l  309 (551)
                      ..+..++...+.....+..|+  +.||..+.......+.+|.+|++++.| +||.+.+||.|..+||.|||-.++    +
T Consensus       252 KAEkdNAEiRv~~~e~yq~iV--DAEW~iI~~KL~~i~~sGA~vVLS~lp-IGD~ATQyFAD~~iFCAGRV~~ED----~  324 (537)
T TIGR02345       252 KAEKDNAEIRVEDVEDYQAIV--DAEWAIIFRKLEKIVESGANVVLSKLP-IGDLATQYFADHDIFCAGRVSDED----L  324 (537)
T ss_pred             HCCCCCCEEEECCHHHHHHHH--HHHHHHHHHHHHHHHHCCCEEEECCCC-CCCCHHHHHHCCCCCCCCCCCHHH----H
T ss_conf             117888658708815677898--899999999999998659959971677-454202342317850037888777----8


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHH-HHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHH
Q ss_conf             112222244102789804673013774217777654-3346776541356311110122210233443212567653146
Q gi|254780849|r  310 EKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGR-INEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAA  388 (551)
Q Consensus       310 ~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~-i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~  388 (551)
                      .++...+.|+....+-           .-.....|+ |.    .+|+.+.+..|+++|+.+..  ...||+++||+-|++
T Consensus       325 ~Rv~~~~GgsI~s~~~-----------~l~~~~LG~rC~----~FEE~Q~G~~RyN~F~g~p~--~~~cT~iLRGGAeqf  387 (537)
T TIGR02345       325 KRVVKATGGSILSTVS-----------DLEADVLGTRCA----LFEERQIGSERYNLFTGCPH--AKTCTIILRGGAEQF  387 (537)
T ss_pred             HHHHHHHCCEEEHHHH-----------HHCHHHCCCHHH----HHHHHHCCCCCCCCCCCCCC--CCEEEEEEECCHHHH
T ss_conf             9999860871110002-----------103110453111----02333046312522058798--636778860877899


Q ss_pred             HHHHHHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             898988778899998754027-8105553799999999745089--9689999999999999999999997799989999
Q gi|254780849|r  389 LGEKKDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIV  465 (551)
Q Consensus       389 ~~E~~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i  465 (551)
                      ++|.+||+|||+|+||.|++. +||+||||.||++|+.|+.++.  ++++|+.++|||+|||.||++||+|||+|+..+|
T Consensus       388 ~~E~eRSlHDAimiVRrA~~~~~~V~GGGaiEm~lS~~Lr~~s~~~~GK~qli~~A~a~ALE~IP~~L~~NAGfDs~~~L  467 (537)
T TIGR02345       388 LEEAERSLHDAIMIVRRALKAKKIVAGGGAIEMELSKILREHSKKIDGKQQLIIEAFAKALEVIPRSLCENAGFDSIEIL  467 (537)
T ss_pred             HHHHCCCHHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99750334246788488522885425874588999999999734743078999999999987757988510481379999


Q ss_pred             HHHHHCC------C--CCEEEECCCCC-EEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9998168------9--86658866872-72138839837047899999999999998660999971587
Q gi|254780849|r  466 SKIQESK------T--ANYGYNAQKSV-FGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP  525 (551)
Q Consensus       466 ~~l~~~~------~--~~~G~d~~~g~-i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~  525 (551)
                      .+||+.|      .  .|+|+|+++.. +.|+.+.+||||+.||+|||++|+|+|++||.||+.|+++.
T Consensus       468 ~~LR~~H~~~~~~~~v~w~GVdI~~~~~i~d~~~~fvWEP~~Vk~Nal~Aa~eAA~~IlsiDeTi~~~~  536 (537)
T TIGR02345       468 NKLRSRHAKEIKGGSVKWYGVDINTEDKIGDNFEAFVWEPLLVKKNALKAAFEAACTILSIDETIKNPK  536 (537)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             999998877514893688744762765088887731546078998787888998876415020012689


No 14 
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit; InterPro: IPR012718    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT epsilon chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=772.10  Aligned_cols=466  Identities=22%  Similarity=0.316  Sum_probs=408.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             798999999999999999977367898635988858998388320888777603478-5225788999999986625518
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKN-HFHEVGARMIRDVATNTEDSSG   86 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~h-p~~~~~akll~~~a~~qd~~~G   86 (551)
                      -|-+|.++|+.++++||+++||||||+|||||++++.|+++|||||||||+.|++.| |    .|||++++|+|||+|+|
T Consensus        24 ~G~~a~ksnI~aak~vA~~l~tSLGP~G~DK~l~s~Dgdi~vTNDGATIl~~Md~~~n~----iakL~V~LS~SQD~EIG   99 (541)
T TIGR02343        24 KGLEAIKSNIAAAKSVASILRTSLGPKGLDKMLISPDGDITVTNDGATILEQMDVDNNP----IAKLMVELSKSQDDEIG   99 (541)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEECCCCCEEEECCHHHHHHHCCCCCCH----HHHHHHHHHHHHCCCCC
T ss_conf             00367786689999999999750688766200017898778852614576430777106----89999997442022247


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC------CCHHHHHHHHHHHHHH-----
Q ss_conf             86667999999999999999976988999999898644777767653222127------6024222122555334-----
Q gi|254780849|r   87 DGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG------SREEIIQVATISANGD-----  155 (551)
Q Consensus        87 DGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~------~~~~L~~vA~tS~~~~-----  155 (551)
                      ||||+||||||+||++|.+||.+|+||.+|.+||+.|++.|++.|++.+..+.      +++.|.+.|+||++||     
T Consensus       100 DGTTgVVVlAgALLeqA~~ll~~GiHPikIa~Gfe~a~~~Av~~L~~i~~~i~~~~~~l~~e~L~~aAkT~LgSKiV~k~  179 (541)
T TIGR02343       100 DGTTGVVVLAGALLEQAEKLLDKGIHPIKIAEGFEKAARVAVEHLEEISEEISVDENELNKEPLIQAAKTSLGSKIVSKC  179 (541)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCC
T ss_conf             76315666577899999999727987234221378999999999888877766546642145799997653010201101


Q ss_pred             -HHHHHHHHHHHHHCCC-C------CHHHH-CCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCC------CHH
Q ss_conf             -5688899999984243-2------00011-0146552033330232001122476542331013444113------102
Q gi|254780849|r  156 -REIGEKIAYAMEQIGP-H------GIITI-DQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVEN------PYI  220 (551)
Q Consensus       156 -~~l~~li~~A~~~i~~-d------~vi~i-~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n------~~I  220 (551)
                       +.++++.++|+..|.. +      ..|.+ .+.||...|++||+|+++||.|+||       +|||.+++      ++|
T Consensus       180 ~~~~Aeiav~AVL~VaD~eRrDvdfdLIk~~~kvGg~L~dt~LI~Gi~idKdfSHP-------QM~K~v~d~~g~dgaki  252 (541)
T TIGR02343       180 KRRFAEIAVDAVLAVADLERRDVDFDLIKVEGKVGGSLEDTKLIKGIIIDKDFSHP-------QMPKEVKDKEGSDGAKI  252 (541)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCCCCCCCCCCCCCCEEEECCCCCC-------CCCCEECCCCCCCCCEE
T ss_conf             55799999998874305556556512012043438853321133005862257878-------88641346667773138


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHH------------
Q ss_conf             20135644100111467753111621222223335888865312135683232222123056766998------------
Q gi|254780849|r  221 LIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEV------------  288 (551)
Q Consensus       221 li~d~~Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~------------  288 (551)
                      +|+.||+|+|||++...-.+.....+-..  +.+|+++..+++....+.|.+++.++| ||.|.+.+.            
T Consensus       253 AiLtCPFEPPKpKTKH~l~i~~~e~Y~~L--~~yE~~kF~EMi~~~K~~Ga~~v~CQW-GFDDEANhLLl~~~LPAVRWV  329 (541)
T TIGR02343       253 AILTCPFEPPKPKTKHKLDISSVEEYKKL--QKYEQQKFKEMIDDIKKSGANIVICQW-GFDDEANHLLLQNDLPAVRWV  329 (541)
T ss_pred             EEEECCCCCCCCCCCCEEECCCHHHHHHH--HHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHCCCCEEEEC
T ss_conf             78537464226885431420787899999--999889988889998642486999637-885678889874789728741


Q ss_pred             ----HHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             ----8652110112332101063221122222441027898046730137742177776543346776541356311110
Q gi|254780849|r  289 ----LRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDK  364 (551)
Q Consensus       289 ----L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~  364 (551)
                          ||-||++||+++|+     ++++++.+.||.|..|....-.|+                            .+|..
T Consensus       330 gG~elEliAi~TgGrIVp-----RF~eL~~~kLG~A~~v~E~~fGT~----------------------------~drml  376 (541)
T TIGR02343       330 GGQELELIAIATGGRIVP-----RFEELSEDKLGKAGLVREISFGTT----------------------------KDRML  376 (541)
T ss_pred             CCCCEEHHEECCCCCCCC-----CCCCCCCCCCCCCEEEEECCCCCC----------------------------CCEEE
T ss_conf             755200210122881511-----513378122865205764026876----------------------------54078


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHH
Q ss_conf             122210233443212567653146898988778899998754027-81055537999999997450899--689999999
Q gi|254780849|r  365 LKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGDN--EDQCAGIEI  441 (551)
Q Consensus       365 ~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~  441 (551)
                      +.|. |+.++.| ||+|||+++.+++|++||+||||||+|+.+++ +|||||||+|+.+|.+++..+..  +.+|+++.+
T Consensus       377 viE~-~~~skaV-Ti~iRGgn~mii~EA~RsihDAlCv~RNli~~~~iVYGGGaaEi~cSLAv~~~Adk~~g~eqyA~ra  454 (541)
T TIGR02343       377 VIEQ-CKNSKAV-TILIRGGNKMIIEEAKRSIHDALCVVRNLIKNSRIVYGGGAAEISCSLAVSQEADKYSGVEQYAIRA  454 (541)
T ss_pred             EEEC-CCCCCEE-EEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             9851-8995068-9998668602457778877667889886524884476487799999998988636898513799999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHC----CCCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999997799989999999816----8986658866872721388398370478999999999999986609
Q gi|254780849|r  442 VRKALSYPCRQIIKNAGDESELIVSKIQES----KTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLIT  517 (551)
Q Consensus       442 fa~AL~~ip~~La~NaG~d~~~~i~~l~~~----~~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLri  517 (551)
                      ||+||+.||.+||+|||+||++.++.+++.    .++.+|+||....-.||++.+|+||+..|++.++.||+++.|||+|
T Consensus       455 Fa~ALe~iP~aLA~NSGl~PI~~~s~~k~~Q~~~~~~~~GvDC~~~G~~DMk~~~V~e~l~gK~qQ~~LATQ~v~MiLKI  534 (541)
T TIGR02343       455 FADALEEIPMALAENSGLDPIETLSELKSLQLKEKNPALGVDCLGEGTNDMKEQKVFETLIGKKQQIQLATQLVKMILKI  534 (541)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998775578764068776899999998767642754463306565321444001101433789998987776432211


Q ss_pred             HHHHH
Q ss_conf             99971
Q gi|254780849|r  518 EAVVV  522 (551)
Q Consensus       518 D~iI~  522 (551)
                      |+||.
T Consensus       535 Ddv~~  539 (541)
T TIGR02343       535 DDVIS  539 (541)
T ss_pred             CCEEC
T ss_conf             00115


No 15 
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=745.29  Aligned_cols=470  Identities=21%  Similarity=0.265  Sum_probs=381.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             34379899999999999999997736789863598885899838832088877760347852257889999999866255
Q gi|254780849|r    5 DIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDS   84 (551)
Q Consensus         5 ~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~   84 (551)
                      .-..|.|||..|+.||++++++|||||||+||||||+++.|+++|||||+||+|+|+++||    +|+|++++|++||++
T Consensus        17 ~~~~G~~a~~~ni~a~~~la~~vktTLGP~G~~kmi~~~~G~~~ITnDG~TIlk~i~l~hP----~Akll~~~a~~q~~~   92 (526)
T cd03339          17 KRLKGLEAHKSHILAAKSVANILRTSLGPRGMDKILVSPDGEVTVTNDGATILEKMDVDHQ----IAKLLVELSKSQDDE   92 (526)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHH
T ss_conf             1047399999999999999999757748887838998899995797678999887448698----999999999964646


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC----CHHHHHHHHHHHHHH-----
Q ss_conf             18866679999999999999999769889999998986447777676532221276----024222122555334-----
Q gi|254780849|r   85 SGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS----REEIIQVATISANGD-----  155 (551)
Q Consensus        85 ~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~----~~~L~~vA~tS~~~~-----  155 (551)
                      +||||||+||||+|||++|.+|+++|+||+.|++||++|.+.++++|+++++++..    ++.+.++|+||+++|     
T Consensus        93 ~GDGTTt~vvLa~eLl~~~~~ll~~g~hp~~I~~G~~~a~~~~~~~L~~~a~~v~~~~~~~~~l~~va~tsl~sK~~~~~  172 (526)
T cd03339          93 IGDGTTGVVVLAGALLEQAEKLLDRGIHPIRIADGYEQACKIAVEHLEEIADKIEFSPDNKEPLIQTAMTSLGSKIVSRC  172 (526)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             46877899999999999999999769987999999999999999999983676789765699999999987400465889


Q ss_pred             -HHHHHHHHHHHHHCCC--------CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             -5688899999984243--------2000110146552033330232001122476542331013444113102201356
Q gi|254780849|r  156 -REIGEKIAYAMEQIGP--------HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       156 -~~l~~li~~A~~~i~~--------d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
                       +.+++++++|+..+..        +.+...+..+++..++++++|++|+++|.||       +||+.++|++|++++++
T Consensus       173 ~~~l~~l~~dav~~v~~~~~~~~~~~~I~i~~~~Gg~~~ds~lv~Giv~~~~~~~~-------~m~~~~~n~ki~ll~~~  245 (526)
T cd03339         173 HRQFAEIAVDAVLSVADLERKDVNFELIKVEGKVGGRLEDTKLVKGIVIDKDFSHP-------QMPKEVKDAKIAILTCP  245 (526)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCEEEECCEEECCCCCCC-------CCCCCCCCCEEHHHCCC
T ss_conf             99999999999976532357766530279997058740000677463543678898-------65443234601021476


Q ss_pred             CCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCC---------------HHHHHHHHHHHH
Q ss_conf             44100111467753111621222223335888865312135683232222123---------------056766998865
Q gi|254780849|r  227 ISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAP---------------AFGDRRKEVLRD  291 (551)
Q Consensus       227 Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~---------------~~~~~~~~~L~d  291 (551)
                      |+.+++..+....+.+......+  ...+++.+..++......|.+++++...               .+....+.+|+|
T Consensus       246 le~~k~~~~~~i~i~~~~~~~~~--~~~e~~~~~~~v~~i~~~g~~lvi~~~~I~d~a~~~l~~~~I~av~~v~~~dle~  323 (526)
T cd03339         246 FEPPKPKTKHKLDITSVEDYKKL--QEYEQKYFREMVEQVKDAGANLVICQWGFDDEANHLLLQNGLPAVRWVGGVEIEL  323 (526)
T ss_pred             CCHHHHHCCCEEEECCHHHHHHH--HHHHHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHCCCCEECCCCHHHHHH
T ss_conf             30202211441685379999999--9999999999999987529982433335463889999876986431467877999


Q ss_pred             HHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC
Q ss_conf             21101123321010632211222224410278980467301377421777765433467765413563111101222102
Q gi|254780849|r  292 IAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAK  371 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~  371 (551)
                      +|.+||+++++     ++++++.++||+|.++......+     .                       .++..+.+++ +
T Consensus       324 ia~~tGa~~i~-----~~~~l~~~~lG~a~~v~~~~~g~-----~-----------------------~d~~~~i~~~-~  369 (526)
T cd03339         324 IAIATGGRIVP-----RFEDLSPEKLGKAGLVREISFGT-----T-----------------------KDKMLVIEGC-P  369 (526)
T ss_pred             HHHHCCCEEEC-----CCCCCCHHHCCCCCEEEEEEECC-----C-----------------------CCEEEEEECC-C
T ss_conf             99980998856-----62429987878674699998536-----6-----------------------6249999658-8


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHH
Q ss_conf             334432125676531468989887788999987540278-105553799999999745089--96899999999999999
Q gi|254780849|r  372 LAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSY  448 (551)
Q Consensus       372 l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~  448 (551)
                       ..+.+||++||+|+.+++|.+|+++|||+++|++++++ +|||||++|+++++.|+.++.  ++++|+++++||+||++
T Consensus       370 -~~~~~TI~vrG~t~~~~~E~~r~l~DAl~~~k~ai~~~~iVpGGGa~el~ls~~L~~~~~~~~~~eq~~i~~~a~ALe~  448 (526)
T cd03339         370 -NSKAVTIFIRGGNKMIIEEAKRSLHDALCVVRNLIRDNRIVYGGGAAEISCSLAVEKAADKCSGIEQYAMRAFADALES  448 (526)
T ss_pred             -CCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             -8760699995670999999996047799999999827986556769999999999997532880899999999999999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHCC----CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999977999899999998168----98665886687272138839837047899999999999998660999971
Q gi|254780849|r  449 PCRQIIKNAGDESELIVSKIQESK----TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV  522 (551)
Q Consensus       449 ip~~La~NaG~d~~~~i~~l~~~~----~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~  522 (551)
                      ||++||+|||+||.+++++|+..|    +.++|||+.+|++.||++.|||||+.||+++|+.|+|+|++|||||++|+
T Consensus       449 ip~~La~NaG~d~~~~l~~l~~~~~~~~~~~~Gid~~~g~~~Dm~~~gIidP~~vk~~al~~A~e~A~~iLriD~iIv  526 (526)
T cd03339         449 IPLALAENSGLNPIETLSEVKARQVKEKNPHLGIDCLGRGTNDMKEQKVFETLISKKQQILLATQVVKMILKIDDVIV  526 (526)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCEEEC
T ss_conf             999999976997787799999999835899776977899360467566843699999999989999999872231739


No 16 
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit; InterPro: IPR012717    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT delta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=756.50  Aligned_cols=465  Identities=20%  Similarity=0.290  Sum_probs=398.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             89999999999999999773678986359888589983883208887776034785225788999999986625518866
Q gi|254780849|r   10 TAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGT   89 (551)
Q Consensus        10 ~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGT   89 (551)
                      .+.|.+|+.|+++|||+||||||||||||||.+++|+++|||||+|||+.|.+-||    +||||+++|++||-|+||||
T Consensus         8 ~~vR~snI~AAkaVADaiRtSLGP~GMDKmI~~~~G~v~ItNDGaTIL~qm~v~HP----~AkmLVe~S~AQDieAGDGT   83 (526)
T TIGR02342         8 EDVRTSNIVAAKAVADAIRTSLGPRGMDKMIQDGKGEVIITNDGATILKQMEVLHP----AAKMLVELSKAQDIEAGDGT   83 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHCH----HHHHHHHHHHHCCCCCCCCC
T ss_conf             67778989999887456530677866420212899747986382778865223063----78999997554043458874


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--------CCHHHHHHHHHHHHHH------
Q ss_conf             67999999999999999976988999999898644777767653222127--------6024222122555334------
Q gi|254780849|r   90 TTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--------SREEIIQVATISANGD------  155 (551)
Q Consensus        90 TtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--------~~~~L~~vA~tS~~~~------  155 (551)
                      ||||||||+||.-+..|+.+|+||+.|.++|+.|++++++.|++++.|++        +++.|.+.|.||+|||      
T Consensus        84 TsVvi~AGALL~A~~~LL~~giHP~~isesf~~A~~~a~~iL~~~~~~v~l~~~f~~~dre~L~~~a~TsL~SKvvSq~S  163 (526)
T TIGR02342        84 TSVVILAGALLDACEKLLEKGIHPTIISESFQSAADEAIKILDEMSIPVDLSETFTEQDRELLIKSATTSLSSKVVSQYS  163 (526)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             00243552799999999726897216888999999999999997332123311222445899999977665345666415


Q ss_pred             HHHHHHHHHHHHHC---------CCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             56888999999842---------432000110146552033330232001122476542331013444113102201356
Q gi|254780849|r  156 REIGEKIAYAMEQI---------GPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       156 ~~l~~li~~A~~~i---------~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
                      ..|+.+.++|+.++         +.+.+..+++.||.++|+++|+|++|.+.+..      +.+.|.+++++||.++.|-
T Consensus       164 ~~LaP~AvdAVlkv~d~~~~~~vdL~dIkvvkk~GGtidd~ELi~G~v~~q~~~~------~~Gg~~ri~~AKIgLIQF~  237 (526)
T TIGR02342       164 SLLAPLAVDAVLKVIDPENDKNVDLKDIKVVKKLGGTIDDTELIEGLVLTQKASK------SAGGPTRIEKAKIGLIQFQ  237 (526)
T ss_pred             HHHCHHHHHHHHEECCCCCCCCCCCHHCEEEEECCCEEECCCEECCEECCCCHHH------HCCCCCHHHHCCEEEEEEE
T ss_conf             3412143540101016754454420000576422881201110134130550100------0477421432362322110


Q ss_pred             CCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHH--------------------HHHH
Q ss_conf             44100111467753111621222223335888865312135683232222123056--------------------7669
Q gi|254780849|r  227 ISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFG--------------------DRRK  286 (551)
Q Consensus       227 Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~--------------------~~~~  286 (551)
                      |+.||+.++.-.-+.++.+---+.  +.|+.++.+++..+.+.|+||++++-.++.                    |..|
T Consensus       238 lS~PKtd~en~vi~~DY~qMDrvl--kEeR~Yil~~~~~I~k~gcNVlLiQKSiLRDA~ndlaLHfL~K~~I~vvKDIeR  315 (526)
T TIGR02342       238 LSPPKTDMENQVIVNDYAQMDRVL--KEERKYILNIVKKIKKTGCNVLLIQKSILRDAVNDLALHFLAKMKIMVVKDIER  315 (526)
T ss_pred             CCCCCCCCCCHHEEHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHHCCEEEEEECCC
T ss_conf             584489877411002178876998--998999999999998528977862145687688789999984288179860561


Q ss_pred             HHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEE-EC-CCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             988652110112332101063221122222441027898-04-6730137742177776543346776541356311110
Q gi|254780849|r  287 EVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVM-SK-DDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDK  364 (551)
Q Consensus       287 ~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i-~~-~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~  364 (551)
                      ++.+-++...|+++|.     +++.++.+.||+|.-++. .. ++..++.-.|                           
T Consensus       316 e~veF~~k~lGc~PiA-----~id~f~~d~LG~A~lvEev~~~~~~k~~kitG---------------------------  363 (526)
T TIGR02342       316 EEVEFISKTLGCKPIA-----SIDHFTADKLGKAELVEEVKTSDDSKIIKITG---------------------------  363 (526)
T ss_pred             CCHHHHHHHCCCCCEE-----CCCCCCCCCCCCCCEEEEECCCCCCEEEEEEC---------------------------
T ss_conf             3145564321884020-----21144820068741145322389813899852---------------------------


Q ss_pred             HHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHH
Q ss_conf             12221023--34432125676531468989887788999987540278-105553799999999745089--96899999
Q gi|254780849|r  365 LKERLAKL--AGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGI  439 (551)
Q Consensus       365 ~~er~~~l--~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i  439 (551)
                           .+.  .+...+|++||+|+.+++|.|||+||||||+|+..+++ ++||||+.|+++|.+|++++.  .+.+.+.+
T Consensus       364 -----~~~~~~~~tV~v~~RGSN~Lvi~EAeRSlHDALCViRsLVk~r~L~~GGGaPE~E~a~~L~~~a~~~~G~~~~~~  438 (526)
T TIGR02342       364 -----VQNNNAGKTVTVLVRGSNKLVIDEAERSLHDALCVIRSLVKKRALIAGGGAPEIEIALKLSKLARTLKGVESYCV  438 (526)
T ss_pred             -----CCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             -----246888862789980686022423322156789999988750651388695289999999986654132588899


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC---EEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999977999899999998168986---65886687272138839837047899999999999998660
Q gi|254780849|r  440 EIVRKALSYPCRQIIKNAGDESELIVSKIQESKTAN---YGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLI  516 (551)
Q Consensus       440 ~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~---~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLr  516 (551)
                      ++||+|||+||+|||||||++|+.++++||+.|..+   +|+|+..|.+.||.++.|+.|+.|..+|++.|+|++.||||
T Consensus       439 r~FAdAleviP~TLAENAGL~pi~~VTeLR~~H~~G~~~~Gi~Vrkg~~~~~~eE~vlQP~LV~~SA~tlAsE~Vr~iLk  518 (526)
T TIGR02342       439 RAFADALEVIPYTLAENAGLNPIKVVTELRNRHANGEKTAGISVRKGGITDMLEEEVLQPLLVTTSAVTLASETVRSILK  518 (526)
T ss_pred             HHHHHHHHHCHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             98864631010134454067725799987875207874476457625644553131006403446677777789898875


Q ss_pred             HHHHHHC
Q ss_conf             9999715
Q gi|254780849|r  517 TEAVVVD  523 (551)
Q Consensus       517 iD~iI~~  523 (551)
                      ||||+..
T Consensus       519 iDDiv~~  525 (526)
T TIGR02342       519 IDDIVFT  525 (526)
T ss_pred             HHHHHHC
T ss_conf             6434206


No 17 
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=740.66  Aligned_cols=486  Identities=22%  Similarity=0.298  Sum_probs=389.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      |.+|+.+|+.||++++++|||||||+||||||+++.|+++|||||+||+|+++++||    +|+||+++|++||+++|||
T Consensus        14 g~~a~~~ni~a~~~lad~vktTLGPkG~~k~i~~~~G~~~ITnDG~TI~k~i~l~~P----~Akll~e~a~~q~~~~GDG   89 (522)
T cd03340          14 GKGQLISNINACQAIADAVRTTLGPRGMDKLIVDGRGKVTISNDGATILKLLDIVHP----AAKTLVDIAKSQDAEVGDG   89 (522)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHCCCC
T ss_conf             799999999999999999747759887849998899982796578999887357698----9999999998400130687


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------HHHHHHHHHHHHHH------H
Q ss_conf             66799999999999999997698899999989864477776765322212760------24222122555334------5
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSR------EEIIQVATISANGD------R  156 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~------~~L~~vA~tS~~~~------~  156 (551)
                      |||++|||+|||++|.+|+++|+||+.|++||+.|.+.++++|+++++++++.      +.|.++|+||+++|      +
T Consensus        90 TTt~vvLa~ell~~~~~li~~G~~p~~I~~G~~~A~~~~~~~L~~~s~~v~~~~~~~~~~~l~~va~tsl~sK~~~~~~~  169 (522)
T cd03340          90 TTSVVVLAGEFLKEAKPFIEDGVHPQIIIRGYRKALQLAIEKIKEIAVNIDKEDKEEQRELLEKCAATALNSKLIASEKE  169 (522)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             47899999999999999998799847999999999999999999843137786366699999999898850045321378


Q ss_pred             HHHHHHHHHHHHCCCCC---HHHH-CCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCC
Q ss_conf             68889999998424320---0011-0146552033330232001122476542331013444113102201356441001
Q gi|254780849|r  157 EIGEKIAYAMEQIGPHG---IITI-DQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQP  232 (551)
Q Consensus       157 ~l~~li~~A~~~i~~d~---vi~i-~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~  232 (551)
                      .+++++++|+..++.+.   .+.+ +..+++..++.+++|+.|+++|.+|+|    ++||++++||+|+++|++|+..++
T Consensus       170 ~l~~li~~Av~~v~~~~~~~~I~i~ki~gg~~~ds~lv~G~~~~~~~~~~~~----~~~~~~~~~~~Ill~~~~le~~~~  245 (522)
T cd03340         170 FFAKMVVDAVLSLDDDLDLDMIGIKKVPGGSLEDSQLVNGVAFKKTFSYAGF----EQQPKKFKNPKILLLNVELELKAE  245 (522)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEECCEEECCEEEEECCCCCCC----CCCCCCCCCCEEEEECHHHHHHHC
T ss_conf             9889999999984556876548999953884002268603788614555440----028620368613530105666421


Q ss_pred             CHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCC
Q ss_conf             11467753111621222223335888865312135683232222123056766998865211011233210106322112
Q gi|254780849|r  233 LLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKA  312 (551)
Q Consensus       233 ~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~  312 (551)
                      ..+....+.+......++  +.++..+...+..+++.+.++++++.+ |++.+.++|.|.+++++.++..++    ++.+
T Consensus       246 ~~~~~i~i~~~~~~~~~~--~~e~~~i~~~~~~i~~~g~~vvi~~~~-i~d~~~~~l~~~~I~~~~~v~~~d----l~~i  318 (522)
T cd03340         246 KDNAEVRVEDPEEYQAIV--DAEWKIIYDKLEKIVKSGANVVLSKLP-IGDLATQYFADRDIFCAGRVPEED----LKRV  318 (522)
T ss_pred             CCCCEEEECCHHHHHHHH--HHHHHHHHHHHHHHHHHCCCEEECCCC-CCHHHHHHHHHCCCEEECCCCHHH----HHHH
T ss_conf             557605854879999999--999999999999987526757831687-645899998764864423157888----8899


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             22224410278980467301377421777765433467765413563111101222102334432125676531468989
Q gi|254780849|r  313 TIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEK  392 (551)
Q Consensus       313 ~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~  392 (551)
                      .....+.... ..+..          .....+.+..    +++.+...++..+++++..  ...+||++||+|+.+++|.
T Consensus       319 ~~~tg~~i~~-~~~~~----------~~~~lG~~~~----~e~~~i~~~~~~~~~~~~~--~~~~tiiirg~t~~~l~e~  381 (522)
T cd03340         319 AQATGGSIQT-TVSNI----------TDDVLGTCGL----FEERQVGGERYNIFTGCPK--AKTCTIILRGGAEQFIEEA  381 (522)
T ss_pred             HHHCCCEEEE-ECCCC----------CHHHCCCCCC----EEEEEECCEEEEHHCCCCC--CCCEEEEEECCCHHHHHHH
T ss_conf             9864886886-21667----------5665154232----4798865474201305555--5645999966718899999


Q ss_pred             HHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             887788999987540278-105553799999999745089--96899999999999999999999977999899999998
Q gi|254780849|r  393 KDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQ  469 (551)
Q Consensus       393 ~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~  469 (551)
                      +|++|||||++|++++++ +|||||++|++++++|++++.  ++++|+++++|++||+.||++||+|||+|+.+++.+|+
T Consensus       382 er~l~DAl~a~k~a~~~~~iVpGGGa~e~~ls~~L~~~~~~~~~~eq~~~~~~a~AL~~ip~~La~NAG~d~~~vv~~L~  461 (522)
T cd03340         382 ERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIAGKQQLVINAFAKALEIIPRQLCDNAGFDATDILNKLR  461 (522)
T ss_pred             HHHHHHHHHHHHHHHHCCCEECCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             99888899999999858987427619999999999997456885789999999999999999999986977999999999


Q ss_pred             HCCC----CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             1689----86658866872721388398370478999999999999986609999715877
Q gi|254780849|r  470 ESKT----ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK  526 (551)
Q Consensus       470 ~~~~----~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~  526 (551)
                      +.|.    .|+|||+.+|++.||++.|||||+.||+++|+.|+|+|++|||||++|+++|+
T Consensus       462 ~~h~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~Vk~~al~~A~~vA~~iL~iD~iI~~~~s  522 (522)
T cd03340         462 QKHAQGGGKWYGVDINNEGIADNFEAFVWEPSLVKINALTAATEAACLILSVDETIKNPKS  522 (522)
T ss_pred             HHHHCCCCCCEEEECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9985579985779778993726785768365899999999799999999989999937899


No 18 
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. There are 2 main chaperonin groups. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). The symmetry of type II is eight- or nine-fold and they are found in archea (thermosome), thermophilic bacteria (TF55) and  in the eukaryotic cytosol (CTT). Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis.
Probab=100.00  E-value=0  Score=738.57  Aligned_cols=443  Identities=36%  Similarity=0.543  Sum_probs=392.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             63437989999999999999999773678986359888589983883208887776034785225788999999986625
Q gi|254780849|r    4 KDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTED   83 (551)
Q Consensus         4 ~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~   83 (551)
                      |.+.||++||.+|+.||++++++++|||||+||||||+++.|+++|||||+||+++|+++||    +|+||+++|++||+
T Consensus         1 ~~~~~~~~a~~~~i~a~~~l~~~~~ttlGP~G~~kmI~~~~g~~~iTnDG~tIlk~i~~~hp----~a~ll~~~a~~q~~   76 (464)
T cd00309           1 KEREFGEEARLSNINAAKALADAVKTTLGPKGMDKMLVDSLGDPTITNDGATILKEIEVEHP----AAKLLVEVAKSQDD   76 (464)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHH
T ss_conf             97533599999999999999998746739888748998799984896769999986426397----99999999998777


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHH------HH
Q ss_conf             5188666799999999999999997698899999989864477776765322212--760242221225553------34
Q gi|254780849|r   84 SSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV--GSREEIIQVATISAN------GD  155 (551)
Q Consensus        84 ~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i--~~~~~L~~vA~tS~~------~~  155 (551)
                      ++||||||+||||++||+++.+|+++|+||+.|++||+.|++.++++|+++++++  .+.++|.++|+||++      ++
T Consensus        77 ~~GDGTTt~vvLa~~Ll~~~~~li~~g~~p~~Ii~g~~~a~~~~~~~L~~~s~~~~~~~~~~l~~va~tsl~sK~~~~~~  156 (464)
T cd00309          77 EVGDGTTTVVVLAGELLKEAEKLLAAGIHPTEIIRGYEKAVEKALEILKEIAVPIDVEDREELLKVATTSLNSKLVSGGD  156 (464)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCH
T ss_conf             72787244999999999987553007998899999999999999999998551277899999999999984246553233


Q ss_pred             HHHHHHHHHHHHHCCCC------CHHHHC-CCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCC
Q ss_conf             56888999999842432------000110-14655203333023200112247654233101344411310220135644
Q gi|254780849|r  156 REIGEKIAYAMEQIGPH------GIITID-QAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKIS  228 (551)
Q Consensus       156 ~~l~~li~~A~~~i~~d------~vi~i~-~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le  228 (551)
                      +.+++++++|+..++.+      +.+.+. ..+++..++++++|++|+++|.+|+       ||++++||+|+++|++|+
T Consensus       157 ~~l~~li~~A~~~v~~~~~~~~~~~I~I~k~~ggs~~~s~li~G~~~~~~~~~~~-------~~~~~~n~~Ili~~~~Le  229 (464)
T cd00309         157 DFLGELVVDAVLKVGKENGDVDLGVIRVEKKKGGSLEDSELVVGMVFDKGYLSPY-------MPKRLENAKILLLDCKLE  229 (464)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCEEEECCEEEECCCCCCC-------CCCCCCCCEEEEECCCCC
T ss_conf             8999999999998545667777770899975788701115544789813667898-------720504617999868843


Q ss_pred             CCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCC
Q ss_conf             10011146775311162122222333588886531213568323222212305676699886521101123321010632
Q gi|254780849|r  229 ALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLK  308 (551)
Q Consensus       229 ~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~  308 (551)
                      .                 +++..+.++..++..+..+      +++++++     .++++|+|+|.+||+++++     +
T Consensus       230 ~-----------------lIi~~~~I~~~al~~l~~~------~I~av~~-----~~~~~l~~ia~~tGa~~i~-----~  276 (464)
T cd00309         230 Y-----------------VVIAEKGIDDEALHYLAKL------GIMAVRR-----VRKEDLERIAKATGATIVS-----R  276 (464)
T ss_pred             E-----------------EEEECCCCCHHHHHHHHHC------CCEEEEE-----CCHHHHHHHHHHHCCEEEC-----C
T ss_conf             7-----------------9998888778999999985------9669980-----4587899999984999965-----5


Q ss_pred             CCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHH
Q ss_conf             21122222441027898046730137742177776543346776541356311110122210233443212567653146
Q gi|254780849|r  309 LEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAA  388 (551)
Q Consensus       309 l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~  388 (551)
                      +++++.++||+|.++.+.+...                              .++.+++.+  ..++++||++||+|+.+
T Consensus       277 ~~~~~~~~lG~~~~v~~~~~~~------------------------------~~~~~i~~~--~~~~~~tI~vrG~t~~~  324 (464)
T cd00309         277 LEDLTPEDLGTAGLVEETKIGD------------------------------EKYTFIEGC--KGGKVATILLRGATEVE  324 (464)
T ss_pred             CCCCCHHHHCCCCEEEEEEECC------------------------------CEEEEEECC--CCCCEEEEEECCCCHHH
T ss_conf             0229988824151589998478------------------------------208999747--89966999967898778


Q ss_pred             HHHHHHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             898988778899998754027-8105553799999999745089--9689999999999999999999997799989999
Q gi|254780849|r  389 LGEKKDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIV  465 (551)
Q Consensus       389 ~~E~~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i  465 (551)
                      ++|++|+++||++++|+++++ ++|||||++|++++++|+.++.  ++++++++++|++||+.||++||+|||+||.+++
T Consensus       325 ~~E~~r~i~DAl~~~k~~~~~~~ivpGGGa~e~~ls~~L~~~~~~~~~~~~~~i~~~a~AL~~ip~~La~NaG~d~~~~~  404 (464)
T cd00309         325 LDEAERSLHDALCAVRAAVEDGGIVPGGGAAEIELSKALEELAKTLPGKEQLGIEAFADALEVIPRTLAENAGLDPIEVV  404 (464)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99999999999999999973788502752999999999986531478389999999999999999999998799889999


Q ss_pred             HHHHHCCC---CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99981689---8665886687272138839837047899999999999998660999971
Q gi|254780849|r  466 SKIQESKT---ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV  522 (551)
Q Consensus       466 ~~l~~~~~---~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~  522 (551)
                      .+|++.|.   .++|+|+.+|++.||++.|||||+.||+++|+.|+|+|++|||||++|+
T Consensus       405 ~~l~~~~~~~~~~~g~d~~~~~~~d~~~~gI~dp~~vk~~~l~~A~e~a~~iL~iD~iI~  464 (464)
T cd00309         405 TKLRAKHAEGGGNAGGDVETGEIVDMKEAGIIDPLKVKRQALKSATEAASLILTIDDIIV  464 (464)
T ss_pred             HHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHEEC
T ss_conf             999988635798777976789070577574861799999999989999999985201619


No 19 
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=733.73  Aligned_cols=454  Identities=21%  Similarity=0.308  Sum_probs=387.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      =|.+|+..|+.||++|+++|||||||+||||||+++.|+++|||||+||+|+++++||    +|+||+++|++||+++||
T Consensus         9 ~~~~a~~~Ni~a~~~lad~vktTLGPkG~~kmi~~~~g~~~ITnDG~TI~k~i~~~hP----~a~ll~~~a~~q~~~~GD   84 (484)
T cd03342           9 RRGQALAVNISAAKGLQDVLKTNLGPKGTLKMLVSGAGDIKLTKDGNVLLSEMQIQHP----TASMIARAATAQDDITGD   84 (484)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             6988999999999999998737759886849999899984796359999986637597----999999999963446468


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC---CHHHHHHHHHHHHHH------HHH
Q ss_conf             66679999999999999999769889999998986447777676532221276---024222122555334------568
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS---REEIIQVATISANGD------REI  158 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~---~~~L~~vA~tS~~~~------~~l  158 (551)
                      ||||+||||++||+++.+|+++|+||+.|++||+.|.+.++++|+++++++++   ++.|.++|+||+++|      +.+
T Consensus        85 GTTt~vvLa~~ll~~~~~li~~G~~p~~I~~G~~~a~~~~~~~L~~~~~~v~~~~d~~~l~~va~ts~~sk~~~~~~~~l  164 (484)
T cd03342          85 GTTSNVLLIGELLKQAERYIQEGVHPRIITEGFELAKNKALKFLESFKVPVEIDTDRELLLSVARTSLRTKLHADLADQL  164 (484)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             87789999999999999999869976899999999999999999984667778646999999987046505568999999


Q ss_pred             HHHHHHHHHHCCCCC-------HHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             889999998424320-------0011014655203333023200112247654233101344411310220135644100
Q gi|254780849|r  159 GEKIAYAMEQIGPHG-------IITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       159 ~~li~~A~~~i~~d~-------vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                      ++++++|+..+..++       +..++..+|+..++++++|+++++++.+|       .||+.++||+|+++|++|+..+
T Consensus       165 ~~i~~~av~~i~~~~~~~d~~~v~i~~~~~g~~~~s~li~G~v~~~~~~~~-------~~~~~~~n~~Ili~~~~le~~k  237 (484)
T cd03342         165 TEIVVDAVLAIYKPDEPIDLHMVEIMQMQHKSDSDTKLIRGLVLDHGARHP-------DMPKRVENAYILTCNVSLEYEK  237 (484)
T ss_pred             HHHHHHHHHEECCCCCCCCCHHEEEEEECCCCCCCHHHEEEEEECCCCCCC-------CCCCCCCCCEEEEECCCCCCHH
T ss_conf             999999872000489745530147887238765312103113632566788-------8742126757998446643101


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCC
Q ss_conf             11146775311162122222333588886531213568323222212305676699886521101123321010632211
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEK  311 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~  311 (551)
                      +..+     ......+++.+++++..++..+..+.      +.+++     ...+.+|+|++.+||+++++     ++++
T Consensus       238 ~e~~-----~~~~~~vvi~~~~i~~~al~~l~~~~------I~~~~-----~~~~~~le~ia~~tGa~~i~-----~~~~  296 (484)
T cd03342         238 TEVN-----SGFFYSVVINQKGIDPPSLDMLAKEG------ILALR-----RAKRRNMERLTLACGGVAMN-----SVDD  296 (484)
T ss_pred             HHHH-----HCCCCEEEEECCCCCHHHHHHHHHCC------CEEEE-----HHHHHHHHHHHHHCCCEEEC-----CCCC
T ss_conf             7666-----30464699987867589999999859------80320-----22287899999971997735-----4122


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             22222441027898046730137742177776543346776541356311110122210233443212567653146898
Q gi|254780849|r  312 ATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGE  391 (551)
Q Consensus       312 ~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E  391 (551)
                      ++.++||+|.++.....     +                         .+++.+.+++.  .++.+||++||+|+.+++|
T Consensus       297 ~~~~~lG~~~~v~~~~i-----g-------------------------~~~~~~i~~~~--~~~~~tI~irG~t~~~l~E  344 (484)
T cd03342         297 LSPECLGYAGLVYERTL-----G-------------------------EEKYTFIEGVK--NPKSCTILIKGPNDHTITQ  344 (484)
T ss_pred             CCHHHCCCCCCCEEEEE-----C-------------------------CCEEEEEECCC--CCCEEEEEECCCHHHHHHH
T ss_conf             99887565786389987-----7-------------------------83289998689--8854799981724889999


Q ss_pred             HHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9887788999987540278-105553799999999745089--9689999999999999999999997799989999999
Q gi|254780849|r  392 KKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKI  468 (551)
Q Consensus       392 ~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l  468 (551)
                      .+|+++|||||+|+++++| +|||||++|++++++|+.++.  ++++++++++|++||+.||++||+|||+||.+++.+|
T Consensus       345 ~~r~i~DAl~a~k~ai~eg~ivpGGGa~e~~ls~~L~~~~~~~~~~e~~~i~~~a~AL~~ip~~La~NAG~d~~~vl~~l  424 (484)
T cd03342         345 IKDAIRDGLRAVKNAIEDKCVVPGAGAFEVALYAHLKEFKKSVKGKAKLGVQAFADALLVIPKTLAENSGLDVQETLVKL  424 (484)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             98777668999999982898863745999999999997644587389999999999999999999998799778999999


Q ss_pred             HHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             8168---98665886687272138839837047899999999999998660999971587
Q gi|254780849|r  469 QESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP  525 (551)
Q Consensus       469 ~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~  525 (551)
                      ++.|   .+++|||+.+|++.||++.|||||+.||+++|+.|+++|++|||||++|++++
T Consensus       425 ~~~~~~~~~~~G~d~~~g~~~dm~~~gIiDP~~vk~~al~~A~~~A~~iL~iD~iI~a~~  484 (484)
T cd03342         425 QDEYAEGGQVGGVDLDTGEPMDPESEGIWDNYSVKRQILHSATVIASQLLLVDEIIRAGR  484 (484)
T ss_pred             HHHHHCCCCCEEEECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             999965799778974689571687576836699999999989999999998899605687


No 20 
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=733.35  Aligned_cols=473  Identities=23%  Similarity=0.303  Sum_probs=384.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      -|+|||.+|+.||.+|+++|||||||+||||||+++.|+++|||||+||+++++++||    +|+|++++|++||+++||
T Consensus         5 ~G~~ar~~~i~a~~~la~~vktTlGP~G~~k~i~~~~G~~~ITnDG~TI~k~i~l~~P----~Akll~e~a~~q~~~~GD   80 (527)
T cd03335           5 SGQDVRTQNVTAAMAIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP----AAKILVELAQLQDKEVGD   80 (527)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             4799999999999999999737759887738999899995896759999986757697----999999999961446468


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHCCC--CHHHHHHHHHHHHHH------HHH
Q ss_conf             6667999999999999999976988999999898644777767653-2221276--024222122555334------568
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKA-NHKKVGS--REEIIQVATISANGD------REI  158 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~-~s~~i~~--~~~L~~vA~tS~~~~------~~l  158 (551)
                      ||||+||||++||+++.+|+++|+||..|++||+.|++.++++|.+ .+.+++.  ++.|.++|+||+++|      +.+
T Consensus        81 GTTtavvLa~~ll~~~~~li~~G~~P~~Ii~G~~~a~~~~~~~l~~~l~~~~~~~~~~~l~~va~tsl~sK~~~~~~e~l  160 (527)
T cd03335          81 GTTSVVIIAAELLKRANELVKQKIHPTTIISGYRLACKEAVKYIKEHLSISVDNLGKESLINVAKTSMSSKIIGADSDFF  160 (527)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77789999999999999999879998999999999999999999997410355327899999999886116555568888


Q ss_pred             HHHHHHHHHHCCC-----------CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCC
Q ss_conf             8899999984243-----------20001101465520333302320011224765423310134441131022013564
Q gi|254780849|r  159 GEKIAYAMEQIGP-----------HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKI  227 (551)
Q Consensus       159 ~~li~~A~~~i~~-----------d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~L  227 (551)
                      ++++++|+..++.           +.+..++..+++..++.+++|+.+++++.++       .||..++||+|+++|++|
T Consensus       161 ~~l~~~a~~~v~~~~~~~~~~~~~~~i~i~~~~g~~~~~s~li~G~~~~~~~~~~-------~m~~~~~n~ki~lld~~l  233 (527)
T cd03335         161 ANMVVDAILAVKTTNEKGKTKYPIKAVNILKAHGKSAKESYLVNGYALNCTRASQ-------GMPTRVKNAKIACLDFNL  233 (527)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEECCCCEEEEEECCCCEEECEEECCEEECCCCCCC-------CCCEECCCCEEEEECCCC
T ss_conf             7888989987523577775201036449999648721004456147851333576-------553031155455313430


Q ss_pred             CCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECC-------------CCCCHHHHHH--HHHHHHH
Q ss_conf             410011146775311162122222333588886531213568323222-------------2123056766--9988652
Q gi|254780849|r  228 SALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLA-------------VKAPAFGDRR--KEVLRDI  292 (551)
Q Consensus       228 e~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~-------------vk~~~~~~~~--~~~L~di  292 (551)
                      +..++..+....+.+......+  ...+++.+...+...+..|.++++             .+.++++.++  +++|+++
T Consensus       234 ~~~k~~~~~~i~i~~~~~~~~~--~~~e~~~~~~~v~~i~~~g~~vv~~~~gI~d~~~~~l~~~~i~~~~~v~~~dl~~i  311 (527)
T cd03335         234 QKTKMKLGVQVVVTDPEKLEKI--RQRESDITKERIKKILAAGANVVLTTGGIDDMCLKYFVEAGAMAVRRVKKEDLRRI  311 (527)
T ss_pred             HHHHCCCCCEEEECCHHHHHHH--HHHHHHHHHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHCCCCEECCCCHHHHHHH
T ss_conf             2221035744895388999999--99899999999999985477624320571238999998759831223679899999


Q ss_pred             HHHCCCCCCCHHHCCCCC-CCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC
Q ss_conf             110112332101063221-1222224410278980467301377421777765433467765413563111101222102
Q gi|254780849|r  293 AAVVGATVISEEIGLKLE-KATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAK  371 (551)
Q Consensus       293 a~~tGa~vi~~~~~~~l~-~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~  371 (551)
                      +.+||+++++.....+.+ .++..++|+|.++...+..                               +.+.++.+.++
T Consensus       312 a~~tga~ii~~~~~~~~~e~~~~~~lG~~~~v~~~~i~-------------------------------~~~~~~~~~~~  360 (527)
T cd03335         312 AKATGATLVSTLANLEGEETFDPSYLGEAEEVVQERIG-------------------------------DDELILIKGTK  360 (527)
T ss_pred             HHHHCCEEECCCCCCCCCCCCCHHHCCCCCEEEEEEEC-------------------------------CCEEEEEECCC
T ss_conf             99859988414446651002476550656528999966-------------------------------83699997467


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHH
Q ss_conf             334432125676531468989887788999987540278-105553799999999745089--96899999999999999
Q gi|254780849|r  372 LAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSY  448 (551)
Q Consensus       372 l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~  448 (551)
                      .+ +.++|++||+|+.+++|.+|+++|||+|+|+++++| +|||||++|++++.+|+.++.  ++++|+++++|++||++
T Consensus       361 ~~-~~~tIii~G~te~~~~E~~~~i~DAl~a~k~a~~eg~ivpGGGa~e~~ls~~l~~~~~~~~~~~q~~i~~~a~Al~~  439 (527)
T cd03335         361 KR-SSASIILRGANDFMLDEMERSLHDALCVVKRTLESNSVVPGGGAVETALSIYLENFATTLGSREQLAIAEFAEALLV  439 (527)
T ss_pred             CC-CEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             88-64799996886225999999888899999999867986126609999999999998611682788999999999899


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHCCC-----------CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999779998999999981689-----------86658866872721388398370478999999999999986609
Q gi|254780849|r  449 PCRQIIKNAGDESELIVSKIQESKT-----------ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLIT  517 (551)
Q Consensus       449 ip~~La~NaG~d~~~~i~~l~~~~~-----------~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLri  517 (551)
                      ||++||+|||+|+.+++++|++.|+           +|+|||+.+|++.||++.|||||+.||+++|+.|+|+|++||||
T Consensus       440 ip~~La~NAG~d~~~vv~~L~~~h~~~~~~~~~~~~~~~G~d~~~g~~~Dm~~~gIiDp~~vk~~al~~A~e~a~~iL~i  519 (527)
T cd03335         440 IPKTLAVNAAKDATELVAKLRAYHAAAQVKPDKKHLKWYGLDLINGKVRDNLEAGVLEPTVSKIKSLKFATEAAITILRI  519 (527)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999997799799999999976401222211357775658657994847886878316999999999999999999989


Q ss_pred             HHHHHCCC
Q ss_conf             99971587
Q gi|254780849|r  518 EAVVVDAP  525 (551)
Q Consensus       518 D~iI~~~~  525 (551)
                      |++|+.+|
T Consensus       520 D~iI~~~p  527 (527)
T cd03335         520 DDLIKLNP  527 (527)
T ss_pred             HHHHHCCC
T ss_conf             99985186


No 21 
>cd03343 cpn60 cpn60 chaperonin family. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. Archaeal cpn60 (thermosome), together with TF55 from thermophilic bacteria and the eukaryotic cytosol chaperonin (CTT), belong to the type II group of chaperonins. Cpn60 consists of two stacked octameric rings, which are composed of one or two different subunits.  Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis.
Probab=100.00  E-value=0  Score=730.65  Aligned_cols=465  Identities=24%  Similarity=0.363  Sum_probs=391.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      |+|||.+|+.||++++++|||||||+||||||+++.|.++|||||+||+|+|+++||    +|+|++++|++|++++|||
T Consensus        13 G~~ar~~~i~g~~~lad~vk~TLGP~G~nk~i~~~~G~~~ITnDGvTIak~i~le~p----~A~ll~e~A~~~~~~aGDG   88 (517)
T cd03343          13 GRDAQRMNIAAAKAVAEAVRTTLGPKGMDKMLVDSLGDVTITNDGATILKEMDIEHP----AAKMLVEVAKTQDEEVGDG   88 (517)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCCC
T ss_conf             199999999999999998747759887859998899991697779999876648697----9999999999756574686


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHH------HHHHH
Q ss_conf             6679999999999999999769889999998986447777676532221276--024222122555334------56888
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS--REEIIQVATISANGD------REIGE  160 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~--~~~L~~vA~tS~~~~------~~l~~  160 (551)
                      |||++|||++||+++.+|+++|+||..|++||+.|.+.++++|++++++++.  ++.|.++|+||+++|      +.+++
T Consensus        89 TTTa~vLa~~ll~~~~~li~~G~~p~~I~~G~~~a~~~~~~~L~~~a~~v~~~~~~~l~~va~ts~~~k~~~~~~~~l~~  168 (517)
T cd03343          89 TTTAVVLAGELLEKAEDLLDQNIHPTVIIEGYRLAAEKALELLDEIAIKVDPDDKDTLRKIAKTSLTGKGAEAAKDKLAD  168 (517)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             78899999999999999997699756899999999999999999717888975399999999986133024668999999


Q ss_pred             HHHHHHHHCCCC----------CHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             999999842432----------0001101465520333302320011224765423310134441131022013564410
Q gi|254780849|r  161 KIAYAMEQIGPH----------GIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL  230 (551)
Q Consensus       161 li~~A~~~i~~d----------~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~  230 (551)
                      ++++|+..++.+          .+...+..+++..++++++|++++++++++       .||+.++||+|+++|++|+..
T Consensus       169 l~~~av~~v~~~~~~~~~~d~~~i~i~~~~G~~~~~s~l~~G~v~~~~~~~~-------~m~~~~~n~~Ill~~~~le~~  241 (517)
T cd03343         169 LVVDAVLQVAEKRDGKYVVDLDNIKIEKKTGGSVDDTELIRGIVIDKEVVHP-------GMPKRVENAKIALLDAPLEVK  241 (517)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCEEEEEEECCCEECCEEEEEEEECCHHHCC-------CCHHHHCCCEEEEECCHHHHH
T ss_conf             9999999987358985166335169999808716756544107983202100-------241231275244443266664


Q ss_pred             CCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHH----------------HHHHHHHHHH
Q ss_conf             011146775311162122222333588886531213568323222212305676----------------6998865211
Q gi|254780849|r  231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDR----------------RKEVLRDIAA  294 (551)
Q Consensus       231 ~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~----------------~~~~L~dia~  294 (551)
                      ++..+....+.+......+  ...+++.+..++......|.+++++. +++++.                .+.+|++++.
T Consensus       242 ~~~~~~~i~i~~~~~~~~~--~~~e~~~l~~~v~~i~~~g~~vvi~~-~gi~d~a~~~l~~~~i~~~~~v~~~~l~~ia~  318 (517)
T cd03343         242 KTEIDAKIRITSPDQLQAF--LEQEEAMLKEMVDKIADTGANVVFCQ-KGIDDLAQHYLAKAGILAVRRVKKSDMEKLAR  318 (517)
T ss_pred             HHHHCCEEEECCHHHHHHH--HHHHHHHHHHHHHHHHHHCCCEEEEC-CCCCHHHHHHHHHCCCCEEEEECHHHHHHHHH
T ss_conf             4322122450799999999--99999999999999985177679853-77436899999876983575422878999998


Q ss_pred             HCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCC
Q ss_conf             01123321010632211222224410278980467301377421777765433467765413563111101222102334
Q gi|254780849|r  295 VVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAG  374 (551)
Q Consensus       295 ~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g  374 (551)
                      +||+++++     ++++++..+||+|.++...+..                               +....+.+.++.++
T Consensus       319 ~tga~~i~-----~~~~~~~~~lG~a~~v~~~~~~-------------------------------~~~~~~~~~~~~~~  362 (517)
T cd03343         319 ATGAKIVT-----NIDDLTPEDLGEAELVEERKVG-------------------------------DDKMVFVEGCKNPK  362 (517)
T ss_pred             HCCCEEEE-----ECCCCCHHHCCCCCEEEEEEEC-------------------------------CEEEEEEECCCCCC
T ss_conf             51978975-----3476888666505169999987-------------------------------74689986278874


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHH
Q ss_conf             432125676531468989887788999987540278-105553799999999745089--96899999999999999999
Q gi|254780849|r  375 GVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCR  451 (551)
Q Consensus       375 ~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~  451 (551)
                       .++|++||+|+.+++|.+|+++||||++|+++++| +|||||++|++++.+|+.++.  ++++++++++|++||+.||+
T Consensus       363 -~~tIii~G~te~~~~E~k~~i~DAl~a~kaaieeg~iVpGGG~a~~~~s~~l~~~~~~~~~~e~~gi~~~~~AL~~p~~  441 (517)
T cd03343         363 -AVTILLRGGTEHVVDELERALEDALRVVADALEDGKVVAGGGAVEIELAKRLREYARSVGGREQLAVEAFADALEEIPR  441 (517)
T ss_pred             -EEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             -2799982674889999998776689999998548988558669999999999987356872799999999999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999977999899999998168---9866588668727213883983704789999999999999866099997158
Q gi|254780849|r  452 QIIKNAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDA  524 (551)
Q Consensus       452 ~La~NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~  524 (551)
                      +||+|||+|+.+++.++++.|   .+|||||+.+|+++||++.|||||+.||+++|+.|+++|++|||||+||++|
T Consensus       442 ~ia~NAG~d~~~v~~~l~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDp~~V~~~al~~A~~vA~~iL~id~iI~~k  517 (517)
T cd03343         442 TLAENAGLDPIDTLVELRAAHEKGNKNAGLDVYTGEVVDMLEKGVIEPLRVKKQAIKSATEAATMILRIDDVIAAK  517 (517)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9999779778999999999973589977897789947028878793568999999998999999999999998088


No 22 
>PTZ00212 T-complex protein 1 beta subunit; Provisional
Probab=100.00  E-value=0  Score=727.37  Aligned_cols=479  Identities=22%  Similarity=0.307  Sum_probs=376.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE-----CCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             37989999999999999999773678986359888-----5899838832088877760347852257889999999866
Q gi|254780849|r    7 KLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIG-----NSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         7 ~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~-----~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      ..|++||.+|+.||+++|++|||||||+||||||+     ++.|+++|||||+||+|+++++||    +|+|++++|++|
T Consensus        18 ~~G~~ar~~~i~g~~~ladaV~tTLGPkG~nk~i~~~~~~~~~G~~~ITnDGvTIak~i~le~p----~Akll~e~a~~q   93 (533)
T PTZ00212         18 EKGETARLQSFVGAIAVADLVKTTLGPKGMDKILQPMNEGPRSQHVTVTNDGATILKSVWVDNP----AAKILIDISKTQ   93 (533)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHH
T ss_conf             2659999999999999998873887988785999836777888983796429999887518598----999999999977


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276-----0242221225553345
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS-----REEIIQVATISANGDR  156 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~-----~~~L~~vA~tS~~~~~  156 (551)
                      |+++||||||+||||++||+++.+|+++|+||..|++||++|++.++++|++++.+...     +++|.++|+||+++| 
T Consensus        94 ~~~aGDGTTTavvLa~~ll~~~~~ll~~G~~p~~I~~G~~~A~~~~~~~L~~~s~~~~~~~~~~~~~l~~va~ts~~sk-  172 (533)
T PTZ00212         94 DDEVGDGTTSVVVLAGELLRNAEKLLDQKIHPQTIIEGYRMALDVARKALEESAFDHDADSKKFHEDLLNIARTTLSSK-  172 (533)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHH-
T ss_conf             8886787689999999999999999987998799999999999999999998525567856777999999999887658-


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHC--CCCCCCCCCCCCCCCCCH---HHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             68889999998424320001101465520333302--320011224765423310---1344411310220135644100
Q gi|254780849|r  157 EIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQ--GMQIDRGYISPYFVTSTE---RMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       157 ~l~~li~~A~~~i~~d~vi~i~~~~~~~~d~~li~--G~~id~g~~~~~fi~~~~---~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                       +.....+++..++.+++..++.. ...+.+++++  |..++++|+.++|+.+.+   .+|+.++||+|++++++|+..+
T Consensus       173 -i~~~~~~~~~~l~~~av~~~~~~-~~~d~i~i~k~~Gg~~~~s~l~~G~vl~~~~~~~~~~~~~n~~ili~~~~le~~k  250 (533)
T PTZ00212        173 -LLTVEKDHFAKLAVDAVLRLKGS-GNLDLIQIIKKPGGTLRDSYLEDGFILEKRIGIGQPKRLENAKILVANTPMDTDK  250 (533)
T ss_pred             -HHHHHHHHHHHHHHHHHHHCCCC-CCCEEEEEEEEECCEEECCEEEEEEEECCCCCCCCCEECCCHHHHHHCCCCCCCH
T ss_conf             -88989999999999999751577-8722489999839788613555545760445667841305688886325444204


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCH---------------HHHHHHHHHHHHHHHC
Q ss_conf             1114677531116212222233358888653121356832322221230---------------5676699886521101
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPA---------------FGDRRKEVLRDIAAVV  296 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~---------------~~~~~~~~L~dia~~t  296 (551)
                      ......+...+....+..+ ...+++.+..++..++..++++++.+...               +.....+.|++++..|
T Consensus       251 ~~~~~~~i~i~~~~~~~~~-~~~e~~~~~~~~~~I~~~~~~v~i~~~~i~~~~~~~l~~~~i~~i~~~~~~~le~ia~~t  329 (533)
T PTZ00212        251 IKIYGAKVNVDSMEKVAEI-EAAEKEKMKNKVDKILKHGINVFINRQLIYNYPEQLFAEAGIMAIEHADFDGMERLAAAL  329 (533)
T ss_pred             HHHHCCHHCCCCHHHHHHH-HHHHHHHHHHHHHHHHHCCCCEEEEHHHCCCHHHHHHHHCCEEEEECCCHHHHHHHHHHH
T ss_conf             5410123136889999999-999999999899999845896898501133266667763683354137888899999874


Q ss_pred             CCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             12332101063221122222441027898046730137742177776543346776541356311110122210233443
Q gi|254780849|r  297 GATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGV  376 (551)
Q Consensus       297 Ga~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~  376 (551)
                      |+++++     +++..+..++|+|.++....     ++                         .++  +..+.....+++
T Consensus       330 g~~ii~-----~~~~~~~~~lG~~~~v~e~~-----ig-------------------------~~~--~~~~~~~~~~~~  372 (533)
T PTZ00212        330 GAEIVS-----TFDTPENVKLGHCDLIEEIM-----IG-------------------------EDK--LIRFSGCKKGEA  372 (533)
T ss_pred             CCEEEE-----ECCCCCHHHHCCCCCEEEEE-----EC-------------------------CEE--EEEEECCCCCCC
T ss_conf             887986-----36878887717467149999-----87-------------------------788--887624678871


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2125676531468989887788999987540278-105553799999999745089--9689999999999999999999
Q gi|254780849|r  377 AVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQI  453 (551)
Q Consensus       377 ~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~L  453 (551)
                      +||++||+|+.+++|.+|+++||||++|++++++ +|||||++|++++..|+.++.  ++++++++++|++||+.||++|
T Consensus       373 ~tI~v~G~t~~~l~E~~r~l~DAl~a~k~ai~eg~iVpGGGa~e~~ls~~l~~~~~~~~g~e~~~i~~~a~AL~~~p~~L  452 (533)
T PTZ00212        373 CTIVLRGASSHILDEAERSLHDALCVLSETVKDTRVVLGAGCSEMLMANAVEEEAKKVQGKKSLAIEAFAKALRQIPTII  452 (533)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             69997177468999999999999999999985699762533999999999998733475089999999999999999999


Q ss_pred             HHHCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9977999899999998168---9866588668727213883983704789999999999999866099997158778888
Q gi|254780849|r  454 IKNAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA  530 (551)
Q Consensus       454 a~NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~  530 (551)
                      |+|||+|+.+++.+|++.|   ++++|||+.+|++.||++.|||||+.||+++|+.|+++|++|||||++|+.+|+++.+
T Consensus       453 a~NAG~d~~~vv~~l~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~V~~~aL~~A~~vA~~iL~iD~iI~~~P~~~~p  532 (533)
T PTZ00212        453 ADNGGYDSAELVSKLRAEHYKGNKTAGIDMEDGDVGDVKELGITESYKVKLSVLCSATEAAEMILRVDDIIKCAPRQRTP  532 (533)
T ss_pred             HHHCCCCHHHHHHHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99779878999999999985579988797779967158758783569999999999999999999999999606888898


No 23 
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=729.81  Aligned_cols=464  Identities=21%  Similarity=0.287  Sum_probs=383.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      -|+|||.+|+.||++++++|||||||+||||||+++.|+++|||||+||+|+++++||    +|+|++++|++||+++||
T Consensus         5 ~~~dar~~ni~a~~~la~~vksTLGPkG~nk~i~~~~G~~~ITnDGvTI~k~i~l~~P----~a~ll~e~a~~q~~~~GD   80 (515)
T cd03338           5 KPADVRLSNIQAAKAVADAIRTSLGPRGMDKMIQTGKGEVIITNDGATILKQMSVLHP----AAKMLVELSKAQDIEAGD   80 (515)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             7999999999999999998627759887808998899995895369999987537497----999999999851225268


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             6667999999999999999976988999999898644777767653222127--6024222122555334------5688
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
                      ||||+||||++||+++.+|+++|+||..|++||++|.+.++++|++++++++  +++.|.++|+||+++|      +.++
T Consensus        81 GTTt~vvLa~~ll~~~~~li~~g~~p~~I~~G~~~a~~~~~~~L~~~s~~v~~~~~~~l~~va~ts~~sk~~~~~~~~l~  160 (515)
T cd03338          81 GTTSVVVLAGALLSACESLLKKGIHPTVISESFQIAAKKAVEILDSMSIPVDLNDRESLIKSATTSLNSKVVSQYSSLLA  160 (515)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76699999999999999999879975789999999999999999972577788989999999887400056665899999


Q ss_pred             HHHHHHHHHCCCCC---------HHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             89999998424320---------001101465520333302320011224765423310134441131022013564410
Q gi|254780849|r  160 EKIAYAMEQIGPHG---------IITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL  230 (551)
Q Consensus       160 ~li~~A~~~i~~d~---------vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~  230 (551)
                      +++++|+..++..+         +..++..++...++++++|+++++.+.+.      ..||..++||+|++++++|+.+
T Consensus       161 ~l~~~a~~~v~~~~~~~~~d~~~i~ii~~~gg~~~d~~~i~G~~~~~~~~~~------~~~~~~~~~~~I~l~~~~l~~~  234 (515)
T cd03338         161 PIAVDAVLKVIDPATATNVDLKDIRIVKKLGGTIEDTELVDGLVFTQKASKK------AGGPTRIEKAKIGLIQFCLSPP  234 (515)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEEEECCCCCCC------CCCCCCCHHHHHHHHCCCCCCH
T ss_conf             9999888302557776533221048999528731212354026972531037------8886001408877530155510


Q ss_pred             CCCHHHHH------------------------HHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHH
Q ss_conf             01114677------------------------531116212222233358888653121356832322221230567669
Q gi|254780849|r  231 QPLLPILE------------------------SATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRK  286 (551)
Q Consensus       231 ~~~~~~le------------------------~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~  286 (551)
                      ++..+...                        .+.+.+..++++++++.++.+..+..+... ..++.++     .+.++
T Consensus       235 k~~~~~~i~~~~~~~~~~~~~~e~~~i~~~~~~i~~~g~~vv~~~~~i~~~~i~d~~~~~l~-~~~i~~v-----~~v~~  308 (515)
T cd03338         235 KTDMDNNIVVNDYAQMDRILREERKYILNMCKKIKKSGCNVLLIQKSILRDAVSDLALHFLA-KLKIMVV-----KDIER  308 (515)
T ss_pred             HHHCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHHC-CCCEEEE-----CCCCH
T ss_conf             23214621138999999999989999999999999709986997102344346678886512-1570354-----33468


Q ss_pred             HHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHH
Q ss_conf             98865211011233210106322112222244102789804673013774217777654334677654135631111012
Q gi|254780849|r  287 EVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLK  366 (551)
Q Consensus       287 ~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~  366 (551)
                      ++|++++..||+++++     +++.++.+++|++..+....                              ..+.+..+.
T Consensus       309 ~dl~~ia~~tg~~~i~-----~~~~~~~~~lg~~~~v~~~~------------------------------~~~~~~~~~  353 (515)
T cd03338         309 EEIEFICKTIGCKPVA-----SIDHFTEDKLGSADLVEEVS------------------------------LGDGKIVKI  353 (515)
T ss_pred             HHHHHHHHHHCCEEEC-----CHHHCCHHHCCCCCCCEEEE------------------------------ECCCEEEEE
T ss_conf             8899999982987715-----63008987682466745898------------------------------568469999


Q ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHH
Q ss_conf             2210233443212567653146898988778899998754027-8105553799999999745089--968999999999
Q gi|254780849|r  367 ERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVR  443 (551)
Q Consensus       367 er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa  443 (551)
                      ++ ++.+++.++|++||+|+.+++|.+|++||||+|+|+++++ ++|||||++|++++.+|+.++.  ++++++++++|+
T Consensus       354 ~~-~~~~~~~~tI~v~G~t~~~~~E~~~~i~DAl~a~k~ai~~~~ivpGGG~~e~~ls~~l~~~~~~~~~~~~~~~~~~a  432 (515)
T cd03338         354 TG-VKNPGKTVTILVRGSNKLVLDEAERSLHDALCVIRCLVKKRALIPGGGAPEIEIALQLSEWARTLTGVEQYCVRAFA  432 (515)
T ss_pred             EE-CCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             96-57667856999826607789999998776699999998588804475099998999999863347617899999999


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999977999899999998168---986658866872721388398370478999999999999986609999
Q gi|254780849|r  444 KALSYPCRQIIKNAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAV  520 (551)
Q Consensus       444 ~AL~~ip~~La~NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~i  520 (551)
                      +||+.||++||+|||+||.+++++|++.|   ++|+|||+.+|++.||++.|||||+.||+++|+.|+++|++|||||+|
T Consensus       433 ~aL~~ip~~La~NAG~d~~~vl~kl~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~v~~~al~~A~~~a~~iLriD~i  512 (515)
T cd03338         433 DALEVIPYTLAENAGLNPISIVTELRNRHAQGEKNAGINVRKGAITNILEENVVQPLLVSTSAITLATETVRMILKIDDI  512 (515)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999976997999999999998557998889767993726886879365899999999899999999867896


Q ss_pred             HHC
Q ss_conf             715
Q gi|254780849|r  521 VVD  523 (551)
Q Consensus       521 I~~  523 (551)
                      |++
T Consensus       513 I~a  515 (515)
T cd03338         513 VLA  515 (515)
T ss_pred             EEC
T ss_conf             249


No 24 
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=725.52  Aligned_cols=473  Identities=24%  Similarity=0.354  Sum_probs=381.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE--CCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             7989999999999999999773678986359888--58998388320888777603478522578899999998662551
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIG--NSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSS   85 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~--~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~   85 (551)
                      =|+|||.+|+.|+.+++++|||||||+||||||+  ++.|+++|||||+||+|+|+++||    +|+|++++|++|++++
T Consensus        10 ~G~eAr~~~i~g~~~la~aV~~TLGPkG~nk~i~~~~~~G~~~ITnDGvTI~k~i~l~~p----~A~ll~e~A~~q~~~a   85 (517)
T cd03336          10 KGETARLSSFVGAIAIGDLVKTTLGPKGMDKILQSVGRSGGVTVTNDGATILKSIGVDNP----AAKVLVDISKVQDDEV   85 (517)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHH
T ss_conf             549999999999999998870887998785999842789983796449999886637598----9999999999767776


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-----HHHHHHHHHHHHHHHHHHH
Q ss_conf             88666799999999999999997698899999989864477776765322212760-----2422212255533456888
Q gi|254780849|r   86 GDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSR-----EEIIQVATISANGDREIGE  160 (551)
Q Consensus        86 GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~-----~~L~~vA~tS~~~~~~l~~  160 (551)
                      ||||||+||||++||+++.+|+++|+||+.|++||++|.+.++++|+++++++.+.     ++|.++|+|++++|  +..
T Consensus        86 GDGTTTavvLa~~ll~~~~~li~~g~~p~~I~~G~~~A~~~~~~~L~~~a~~~~~~~~~~~~~l~~va~ts~~sK--i~~  163 (517)
T cd03336          86 GDGTTSVTVLAAELLREAEKLVAQKIHPQTIIEGYRMATAAAREALLSSAVDHSSDEEAFREDLLNIARTTLSSK--ILT  163 (517)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH--HHH
T ss_conf             888679999999999999999987998478999999999999999998464678807788999999999887768--889


Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCCCHHHHHC--CCCCCCCCCCCCCCCCCH---HHHHHHCCCHHHHCCCCCCCCCCCH-
Q ss_conf             9999998424320001101465520333302--320011224765423310---1344411310220135644100111-
Q gi|254780849|r  161 KIAYAMEQIGPHGIITIDQAKTATTEVRVVQ--GMQIDRGYISPYFVTSTE---RMTAEVENPYILIYDKKISALQPLL-  234 (551)
Q Consensus       161 li~~A~~~i~~d~vi~i~~~~~~~~d~~li~--G~~id~g~~~~~fi~~~~---~~~~~~~n~~Ili~d~~Le~~~~~~-  234 (551)
                      ...+++.+++.+++..++. .+..+..++++  |..++++|++|||+.+++   .||++++||+|+++|++|+..+... 
T Consensus       164 ~~~~~~~~l~~~av~~v~~-~~~~~~i~i~~~~gg~~~~~~l~~g~i~d~~~~~~~~~~~~n~~ill~~~~le~~~~~~~  242 (517)
T cd03336         164 QDKEHFAELAVDAVLRLKG-SGNLDAIQIIKKLGGSLKDSYLDEGFLLDKKIGVNQPKRIENAKILIANTPMDTDKIKIF  242 (517)
T ss_pred             HHHHHHHHHHHHHHHHCCC-CCCEEEEEEEEEECCEEEEEEEECCEEEECCCCCCCCEEECCHHHHCCCCCCCHHHHHHH
T ss_conf             9999999999999975168-886036999997187886316772578703225678535226343101676541466530


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHH----------------HHHHHHHHHHHHCCC
Q ss_conf             4677531116212222233358888653121356832322221230567----------------669988652110112
Q gi|254780849|r  235 PILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGD----------------RRKEVLRDIAAVVGA  298 (551)
Q Consensus       235 ~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~----------------~~~~~L~dia~~tGa  298 (551)
                      ......... ..+..+ ...+++.+..++.++...++++++.+.. +.+                ...+.|++++.+||+
T Consensus       243 ~~~i~i~~~-~~~~~~-~~~e~~~~~~~v~~i~~~~~~~~~~~~~-i~~~~~~~l~~~~I~~~~~~~~~~le~ia~~tg~  319 (517)
T cd03336         243 GAKVRVDST-AKVAEI-EEAEKEKMKNKVEKILKHGINCFINRQL-IYNYPEQLFADAGIMAIEHADFDGVERLALVTGG  319 (517)
T ss_pred             CCHHCCCCH-HHHHHH-HHHHHHHHHHHHHHHHHCCCCEEEHHHC-CCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             112104889-999999-9999999985999998658860313320-1317889987537410045888888999998488


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             33210106322112222244102789804673013774217777654334677654135631111012221023344321
Q gi|254780849|r  299 TVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV  378 (551)
Q Consensus       299 ~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~t  378 (551)
                      ++++     .+++.+..++|+|.++....     ++                         .++  +..+.....++++|
T Consensus       320 ~ii~-----~~~~~~~~~lG~~~~v~e~~-----i~-------------------------~~~--~~~~~g~~~~~~~t  362 (517)
T cd03336         320 EIAS-----TFDHPELVKLGTCKLIEEIM-----IG-------------------------EDK--LIRFSGVAAGEACT  362 (517)
T ss_pred             EEEE-----ECCCCCHHHCCCCCCEEEEE-----EC-------------------------CEE--EEEEECCCCCCEEE
T ss_conf             7886-----45878887726467159999-----87-------------------------827--99997036787169


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25676531468989887788999987540278-105553799999999745089--968999999999999999999999
Q gi|254780849|r  379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIK  455 (551)
Q Consensus       379 I~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~  455 (551)
                      |++||+|+++++|.+|+++|||+++|++++++ +|||||++|+++++.|+.++.  .+++++++++|++||+.||++||+
T Consensus       363 I~irG~t~~~~~E~~r~~~DAL~a~k~ai~e~~iVpGGG~~e~~ls~~l~~~~~~~~g~~~~~i~~~a~AL~~ip~~La~  442 (517)
T cd03336         363 IVLRGASQQILDEAERSLHDALCVLAQTVKDTRVVLGGGCSEMLMAKAVEELAKKTPGKKSLAIEAFAKALRQLPTIIAD  442 (517)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99806858999999987777999999998679877466799999999999874348547999999999999999999999


Q ss_pred             HCCCCHHHHHHHHHHCC---CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             77999899999998168---9866588668727213883983704789999999999999866099997158778
Q gi|254780849|r  456 NAGDESELIVSKIQESK---TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD  527 (551)
Q Consensus       456 NaG~d~~~~i~~l~~~~---~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~  527 (551)
                      |||+|+.+++.+|++.|   +++||||+.+|++.||++.|||||+.||+++|++|+++|++|||||++|.++|++
T Consensus       443 NAG~d~~~vv~~l~~~~~~~~~~~G~d~~~g~~~dm~~~GIiDP~~V~~~al~~A~~vA~~iL~iD~iI~~~P~k  517 (517)
T cd03336         443 NAGYDSAELVAQLRAAHYNGNTTAGLDMRKGTVGDMKELGITESFKVKRQVLLSASEAAEMILRVDDIIKCAPRK  517 (517)
T ss_pred             HCCCCHHHHHHHHHHHHHCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             869979999999999984689988897679947158768693668999999997999999999999999855799


No 25 
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit; InterPro: IPR012721    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT theta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=736.67  Aligned_cols=479  Identities=19%  Similarity=0.283  Sum_probs=412.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             43798999999999999999977367898635988858998388320888777603478522578899999998662551
Q gi|254780849|r    6 IKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSS   85 (551)
Q Consensus         6 ~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~   85 (551)
                      .+.-+||..+|+.||+.|+.+.||||||+||+|||+++.++.+||||.||||++|+++||    |||||+.+|+.|++|+
T Consensus        13 ~sG~eeav~KNI~AcKEL~~itrTSlGPnGmNKmvINHL~K~fVTnDAATIl~ElEv~HP----AaK~lV~As~~Qe~E~   88 (554)
T TIGR02346        13 MSGLEEAVIKNIEACKELSNITRTSLGPNGMNKMVINHLDKLFVTNDAATILRELEVQHP----AAKLLVMASKMQENEI   88 (554)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCCCCC----HHHHHHHHHHHHHHHC
T ss_conf             257736899999999999999776258998851277021101224258999852243375----7899999999988744


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH-H-HCC---CCHHHHHHHHHHHHHH-----
Q ss_conf             88666799999999999999997698899999989864477776765322-2-127---6024222122555334-----
Q gi|254780849|r   86 GDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANH-K-KVG---SREEIIQVATISANGD-----  155 (551)
Q Consensus        86 GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s-~-~i~---~~~~L~~vA~tS~~~~-----  155 (551)
                      ||||.-|++||||||++|.+||++|+||+.||+||.+|++.+.+.|+++. + .+.   ++++|.+.-++|+.||     
T Consensus        89 GDgtN~v~~lAGELL~~Ae~Li~mGL~pseIi~GY~~A~~~a~e~L~elv~~~~~~~~~~~~e~~k~l~~~~~SK~~g~n  168 (554)
T TIGR02346        89 GDGTNLVLVLAGELLEKAEELIRMGLHPSEIIKGYEQALKKAMEVLEELVVWKEVKDLRDKEEVIKALKASISSKQYGNN  168 (554)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             83568999999999999999987268898998789999999998522314034346720078999999998742124763


Q ss_pred             -HHHHHHHHHHHHHC-------------CCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHH---HHCCC
Q ss_conf             -56888999999842-------------43200011014655203333023200112247654233101344---41131
Q gi|254780849|r  156 -REIGEKIAYAMEQI-------------GPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTA---EVENP  218 (551)
Q Consensus       156 -~~l~~li~~A~~~i-------------~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~---~~~n~  218 (551)
                       ..|++|+++|+..+             .+|.|+..|-.||+..+|++++|++|.|.         .++..+   +.+||
T Consensus       169 ~dfL~~LvA~Ac~~v~P~~~~~GeiPyFnVDniRV~Ki~Ggs~~~S~v~~GmV~~re---------aeG~vksls~~~~A  239 (554)
T TIGR02346       169 EDFLAQLVAKACITVLPKNPENGEIPYFNVDNIRVSKILGGSISNSEVLKGMVFKRE---------AEGSVKSLSRVKNA  239 (554)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCEEEECCEECCC---------CCCCEEECCCCCCC
T ss_conf             788999999887412788889886551145601322320786347758851176317---------88433530213688


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHH----------
Q ss_conf             0220135644100111467753111621222223335888865312135683232222123056766998----------
Q gi|254780849|r  219 YILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEV----------  288 (551)
Q Consensus       219 ~Ili~d~~Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~----------  288 (551)
                      ||+++.|+|+...+.+..=..+++. ++|+-+... |+..+...+.++.+.|++|++. -+.++|..+||          
T Consensus       240 KVAVf~CplD~~~TETKGTVLihnA-~ELlny~Kg-EE~~~e~~iK~iad~Gv~VIv~-gG~v~d~AlHy~~~Y~im~~k  316 (554)
T TIGR02346       240 KVAVFSCPLDTATTETKGTVLIHNA-EELLNYSKG-EENQIEALIKAIADSGVKVIVT-GGSVGDMALHYVEKYNIMVLK  316 (554)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHCCH-HHHCCCCCC-HHHHHHHHHHHHHHCCCEEEEE-CCCHHHHHHHHHHHCCEEEEE
T ss_conf             6788717777456652430001247-866055702-6899999878998689859994-684889999878155826999


Q ss_pred             ------HHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             ------86521101123321010632211222224410278980467301377421777765433467765413563111
Q gi|254780849|r  289 ------LRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR  362 (551)
Q Consensus       289 ------L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~  362 (551)
                            |+|||..+||+...     +|....++++|+|.++.+.+-     ++.  +      |           ..+.+
T Consensus       317 ~~SKFELrRlCk~~gA~~l~-----rL~~P~PEe~G~vds~~v~EI-----G~~--~------V-----------Tvf~~  367 (554)
T TIGR02346       317 IPSKFELRRLCKTVGATPLA-----RLGAPQPEELGYVDSVYVSEI-----GGQ--K------V-----------TVFKQ  367 (554)
T ss_pred             ECCCHHHHHHHHHHCCCCCC-----CCCCCCHHHCCCEEEEEEEEE-----CCC--E------E-----------EEEEE
T ss_conf             77826588999880777735-----183458226442007999998-----584--8------8-----------99973


Q ss_pred             CCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCC--CCCCCCCHHHHHHHHHHHHCCCC--HHHHH
Q ss_conf             10122210233443212567653146898988778899998754-027--81055537999999997450899--68999
Q gi|254780849|r  363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAA-SDE--GIVPGGGIALVRAAQALSVKGDN--EDQCA  437 (551)
Q Consensus       363 ~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~-~~~--~vvpGGGa~e~~ls~~l~~~~~~--~~~~~  437 (551)
                      +      ..--+.++||++||||+..+|+.||++||.++++|++ +++  ++||||||+|++|+++|.+++..  +-.|+
T Consensus       368 e------~~di~~~~TIiLRGsT~N~LDDiERAiDDGVN~~K~L~KD~GGrl~pGaGAtEieL~~~L~~ya~~~~gl~qY  441 (554)
T TIGR02346       368 E------NGDISKISTIILRGSTKNLLDDIERAIDDGVNVIKALVKDNGGRLLPGAGATEIELAKRLKKYANKLPGLDQY  441 (554)
T ss_pred             E------CCCCCCCCCEEECCCCCCHHHHHHHHHHCCHHHHHEEECCCCCCEECCCCCHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             0------3775432116752300001344444430431210100058986150577724899999999974206763676


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC--------CC---CEEEECCCCCE----EEHHHHCCCCHHHHHHH
Q ss_conf             99999999999999999977999899999998168--------98---66588668727----21388398370478999
Q gi|254780849|r  438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQESK--------TA---NYGYNAQKSVF----GDMFEMGIIDPVKVVRN  502 (551)
Q Consensus       438 ~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~--------~~---~~G~d~~~g~i----~d~~~~gI~dp~~vk~~  502 (551)
                      +|+.||+|||+||||||+|||+||.|||++|-+.|        .+   .+|+|+..+..    .|+.+.+|||.+..|+|
T Consensus       442 Aik~FA~aFE~iPrtLAeNAGl~~~eVi~~Ly~~HnvtePGa~~~g~~~~GiDIe~~~~~q~vkd~~e~~IyD~l~~K~~  521 (554)
T TIGR02346       442 AIKKFAEAFEIIPRTLAENAGLNANEVISKLYAAHNVTEPGAVKKGNKSLGIDIEAESDKQGVKDASEAGIYDLLAAKKF  521 (554)
T ss_pred             HHHHHHHHEEEHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             65554221021136762215887788888653103545777544687212022578860256776765555201467899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999999986609999715877888899989
Q gi|254780849|r  503 ALQSAGSLAGMMLITEAVVVDAPKDETASPQMP  535 (551)
Q Consensus       503 al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~  535 (551)
                      ||+.|||+|+++||||+|||+||.++|+.||.|
T Consensus       522 Ai~LAt~Aa~TvL~VDQIIMAKpAGGPk~~~~~  554 (554)
T TIGR02346       522 AIKLATEAAVTVLRVDQIIMAKPAGGPKPPQGK  554 (554)
T ss_pred             HHHHHHHHHHEEECCCEEEEECCCCCCCCCCCC
T ss_conf             999888751110000347885376224466889


No 26 
>pfam00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family. This family includes members from the HSP60 chaperone family and the TCP-1 (T-complex protein) family.
Probab=100.00  E-value=0  Score=712.57  Aligned_cols=441  Identities=35%  Similarity=0.523  Sum_probs=390.8

Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             99997736789863598885899838832088877760347852257889999999866255188666799999999999
Q gi|254780849|r   23 LAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNE  102 (551)
Q Consensus        23 ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGTTtvvvLa~eLL~~  102 (551)
                      +++++||||||+||||||+++.|+++|||||+||+++++++||    +|++++++|++||+++||||||+|||+++||++
T Consensus         1 ia~~vkstlGP~G~~k~i~~~~g~~~iTnDG~tIlk~i~~~hP----~a~ll~~~a~~~~~~~GDGTTt~vvL~~~Ll~~   76 (481)
T pfam00118         1 LADAVKTTLGPKGRNKMLVNHGGKITITNDGATILKEIEIQHP----AAKLLVEAAKSQDEEVGDGTTTAVVLAGELLEE   76 (481)
T ss_pred             CCHHHCCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHCHHCCCHHHHHHHHHHHHHH
T ss_conf             9124227739887859998799996897769999986768697----999999999964144258877999999999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHH------HHHHHHHHHHHHHC----CC
Q ss_conf             99999769889999998986447777676532221276-024222122555334------56888999999842----43
Q gi|254780849|r  103 GRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGS-REEIIQVATISANGD------REIGEKIAYAMEQI----GP  171 (551)
Q Consensus       103 a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~-~~~L~~vA~tS~~~~------~~l~~li~~A~~~i----~~  171 (551)
                      +.+|+++|+||+.|++||+.|++.++++|+++++++++ .+.|.++|+||+++|      +.+++++++|+..+    ..
T Consensus        77 ~~~li~~gi~p~~I~~g~~~a~~~~~~~L~~~s~~~~~~~~~l~~va~ts~~~k~~~~~~~~l~~l~~~A~~~~~~~~~~  156 (481)
T pfam00118        77 AEKLIEAGIHPTDIIRGYELALEIALKALEELSIPVSDDDEDLLNVARTSLNSKISSRESELLGKLVVDAVLLIIEKFDV  156 (481)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999779989999999999999999999984641899999999999998447742035899999999999973024667


Q ss_pred             CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCC-------------------
Q ss_conf             2000110146552033330232001122476542331013444113102201356441001-------------------
Q gi|254780849|r  172 HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQP-------------------  232 (551)
Q Consensus       172 d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~-------------------  232 (551)
                      +.+..++..+|...++++++|++|+++|.+|       .|++.++||+|+++|++|+..++                   
T Consensus       157 ~~i~ii~i~gg~~~~s~li~Gi~i~~~~~~~-------~~~~~~~n~kIll~d~~l~~~~~~~~~~~~~~~~~~~~~~E~  229 (481)
T pfam00118       157 GNIGVIKIEGGSLEDSELIEGIVLDKGYLSP-------DMPKRLENPKILLLDCPLEYEKTEKVIISTAEELERLLEAEE  229 (481)
T ss_pred             CCCEEEEECCCCCCCEEEEEEEEEECCCCCC-------CCCCCCCCCEEEEECCCCCCCCCCCCCEEEECCHHHHHHHHH
T ss_conf             7720799637875441897008984476799-------886424674799987756766554552178458899999999


Q ss_pred             --CHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCC
Q ss_conf             --114677531116212222233358888653121356832322221230567669988652110112332101063221
Q gi|254780849|r  233 --LLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLE  310 (551)
Q Consensus       233 --~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~  310 (551)
                        ..+.++.+.+.+.++++++++++..++..+..|.+.           ++...++++|+|+|.+|||+++++     ++
T Consensus       230 ~~i~~~l~~i~~~~~~lvi~~~~I~~~al~~l~~~~I~-----------~~~~v~~~~Le~ia~~tGa~~i~~-----~~  293 (481)
T pfam00118       230 KQLLPLLEKIVDAGVNLVIIQKGIDDLALHFLAKNGIL-----------ALRRVKKEDLERLAKATGATVVSS-----LD  293 (481)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH-----------HHHCCCHHHHHHHHHHHCCEEECC-----CC
T ss_conf             99999999999809899999488677999999996556-----------663424889999999829988456-----35


Q ss_pred             CCCCCCCCCEEEEEE---ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHH
Q ss_conf             122222441027898---04673013774217777654334677654135631111012221023344321256765314
Q gi|254780849|r  311 KATIADLGSAKKVVM---SKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEA  387 (551)
Q Consensus       311 ~~~~~~LG~~~~v~i---~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~  387 (551)
                      +++..+||+|.++..   ..+.++++.                                   ..+.++++||++||+|+.
T Consensus       294 ~l~~~~lG~~~~v~~~~i~~~~~~~i~-----------------------------------~~~~~~~~tI~i~g~t~~  338 (481)
T pfam00118       294 DLEPDELGSAGKVEEREIGEDKTTFIE-----------------------------------GCLSGKVATILLRGATDH  338 (481)
T ss_pred             CCCHHHCCCCCEEEEEEECCEEEEEEE-----------------------------------CCCCCCEEEEEECCCCHH
T ss_conf             499887835760599998781599995-----------------------------------157897699995689899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             689898877889999875402-78105553799999999745089--968999999999999999999999779998999
Q gi|254780849|r  388 ALGEKKDRYQDSLDATRAASD-EGIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELI  464 (551)
Q Consensus       388 ~~~E~~r~~~DAl~v~~~~~~-~~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~  464 (551)
                      +++|.+|+++|||++++++++ +++|||||++|++++++|+.++.  ++++++++++|++||+.||++|++|||+|+.++
T Consensus       339 ~~~E~~r~i~Dal~~~~~~~~~~~vvpGGG~~e~~l~~~L~~~~~~~~~~~~~~~~~~~~Al~~ip~~L~~NaG~d~~~~  418 (481)
T pfam00118       339 ELDELERAIEDALNAVKAALKDEGVVPGGGAAELELSRALREYAKSVSGKEQLGIEAFAEALEVIPRTLAENAGLDPIEV  418 (481)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             99999999999999999997488724587389999999999986037848999999999999999999999779988999


Q ss_pred             HHHHHHCC--CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99998168--98665886687272138839837047899999999999998660999971587
Q gi|254780849|r  465 VSKIQESK--TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP  525 (551)
Q Consensus       465 i~~l~~~~--~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~  525 (551)
                      +++|++.|  .+++|+|+.+|++.||++.|||||+.||+++|+.|+|+|++|||||++|+.+|
T Consensus       419 i~~l~~~~~~~~~~Gid~~~~~i~d~~~~gI~dp~~vk~~~l~~A~e~a~~iL~id~iI~~~~  481 (481)
T pfam00118       419 LAKLKAAHKKGNNLGIDADTGEIGDMKEAGIIDPLKVKRSALKSAVEVASLILTIDQIIKAKP  481 (481)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999850799677974899071267674852799999999999999999999999996296


No 27 
>KOG0356 consensus
Probab=100.00  E-value=0  Score=716.02  Aligned_cols=524  Identities=54%  Similarity=0.846  Sum_probs=511.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86634379899999999999999997736789863598885899838832088877760347852257889999999866
Q gi|254780849|r    2 AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNT   81 (551)
Q Consensus         2 ~~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~q   81 (551)
                      .+|+|+||.++|..++.|+..++++|.+||||+|++++|....|+|.|||||.|+.++++++++++|++|+++.+++...
T Consensus        15 ~ak~i~fg~~~r~~ll~Gv~~Ladav~~TlgpKgrnViieq~~gsPkvtkdgvTva~si~l~d~~~n~gaklvq~va~~t   94 (550)
T KOG0356          15 YAKDIKFGKDVRAKLLQGVDLLADAVAVTLGPKGRNVIIEQSWGSPKVTKDGVTVAKSIELKDKYENIGAKLVQDVANNT   94 (550)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCEECCCCEEECCCCCCCHHHHHCCHHHHHHHHHC
T ss_conf             35531047779999986389999776550268862487203468983614872553000212255541528999988624


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25518866679999999999999999769889999998986447777676532221276024222122555334568889
Q gi|254780849|r   82 EDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEK  161 (551)
Q Consensus        82 d~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~l  161 (551)
                      .++.||||||+++|+.++.+++.+-+.+|.+|..|.+|...+.+.+++.|.++|+++.+.+++.+||.+|+|+|++++++
T Consensus        95 Ne~agdGtttatvlar~i~~eg~~~v~~G~npv~irrGi~~av~~vv~~L~k~sk~Vtt~eeIaqVAtiSAngD~~ig~l  174 (550)
T KOG0356          95 NEEAGDGTTTATVLARAIAKEGFEKVAKGANPVEIRRGIMLAVDAVVDELKKMSKPVTTPEEIAQVATISANGDKEIGNL  174 (550)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHH
T ss_conf             67244685128999999999799998636881310366898899999999973877788789988876522781788799


Q ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999842432000110146552033330232001122476542331013444113102201356441001114677531
Q gi|254780849|r  162 IAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT  241 (551)
Q Consensus       162 i~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~  241 (551)
                      +.+|+++++.+|++++++++...++.++++|+.||+||+||||+++++.+.++|+||++++.+.+++..+.+.|++|...
T Consensus       175 i~~a~~kvG~~GVItv~~gkt~~delev~eGmkfdrGyiSPyfi~~~k~~~~efe~~~~ll~~kki~~v~~ivp~LE~a~  254 (550)
T KOG0356         175 ISDAMKKVGRKGVITVKDGKTLEDELEVIEGMKFDRGYISPYFITSSKKQKVEFENALLLLSEKKISSVQSIVPALELAL  254 (550)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCEEHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999984767728842487455302000033025666573203462222210100256655632227888777999854


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHC-CCCCCCCCCCCCCE
Q ss_conf             11621222223335888865312135683232222123056766998865211011233210106-32211222224410
Q gi|254780849|r  242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIG-LKLEKATIADLGSA  320 (551)
Q Consensus       242 ~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~-~~l~~~~~~~LG~~  320 (551)
                      +..+||+|++++++.++|.+++.|..+.+++++++++|+||+.|++.|.|++.+||++++.++.+ .+++.++.++||.+
T Consensus       255 ~~~~PLliIAeDi~~eaL~tLIlNkLk~glqV~AvKapgfGdnrk~~l~Diai~Tg~~v~~~e~~~l~le~~~~~dLG~~  334 (550)
T KOG0356         255 AKRRPLLIIAEDIDGEALATLVLNKLKGGLQVVAVKAPGFGDNRKNLLKDIAILTGATVFGEELSTLNLEDAKLEDLGEV  334 (550)
T ss_pred             HCCCCEEEEEHHCCHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHCCCC
T ss_conf             00586599831044468889986200132268987558876167776667887730043125111125011863224741


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27898046730137742177776543346776541356311110122210233443212567653146898988778899
Q gi|254780849|r  321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSL  400 (551)
Q Consensus       321 ~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl  400 (551)
                      .++.++++++.++.+.+.+..+.+|+++++..++.+.+.|+++++.+|.++|++++++|.+||.||.+++|++.+++|||
T Consensus       335 ~ev~vtkd~t~ll~g~~~~~~v~~rIeqik~~~e~t~~~ye~ekl~er~a~ls~gvavi~vGg~se~Ev~ekk~rv~dal  414 (550)
T KOG0356         335 GEVVVTKDDTMLLKGKGNKAQVEGRIEQIKEMIEETTSDYEKEKLNERLAKLSGGVAVIKVGGHSEVEVNEKKDRVEDAL  414 (550)
T ss_pred             EEEEEECCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             16998256433217999889999899999999986330566767878898752781799954754102544332588988


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEE
Q ss_conf             998754027810555379999999974508--996899999999999999999999977999899999998168986658
Q gi|254780849|r  401 DATRAASDEGIVPGGGIALVRAAQALSVKG--DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY  478 (551)
Q Consensus       401 ~v~~~~~~~~vvpGGGa~e~~ls~~l~~~~--~~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~~~~G~  478 (551)
                      +++++++++|+|||||+++++++..|....  .+.+++.|++++.+||..|..++++|||.|+..++.+++.   ..|||
T Consensus       415 nat~aaveeGivpGGG~all~~~~~l~~lk~~~~~~~~~G~~iv~~Al~~P~~~IakNAGvdg~~vv~Kv~~---~~~gy  491 (550)
T KOG0356         415 NATRAAVEEGIVPGGGTALLRAIPVLDELKATNNFDQKVGVEIVKKALRLPAQTIAKNAGVDGSVVVEKVLN---DDYGY  491 (550)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH---HHHHH
T ss_conf             888877515855676078898765551046665067665099999998646999999658754889999886---44334


Q ss_pred             ECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             86687272138839837047899999999999998660999971587788
Q gi|254780849|r  479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE  528 (551)
Q Consensus       479 d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~  528 (551)
                      |..++++.||.+.||+||..|.+.+|..|..+|.++++.+.+|...|.++
T Consensus       492 da~~~ey~dlv~~GiidP~kVvr~al~~a~~vasll~tte~vvtei~k~~  541 (550)
T KOG0356         492 DAAKGEYVDLVEAGIIDPTKVVRTALTDAAGVASLLTTTEAVVTEIPKEE  541 (550)
T ss_pred             HHHCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHEEEEEECCCCC
T ss_conf             31012167787535777178888761103678888752305788425655


No 28 
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=701.06  Aligned_cols=440  Identities=22%  Similarity=0.338  Sum_probs=366.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      -|++||..|+.||++++++|||||||+||||||+++.|+++|||||+||+|+++++||    +|++++++|++||+++||
T Consensus        13 ~G~~a~~~ni~a~~~lad~vktTLGPkG~~k~i~~~~G~~~ITnDG~TIlk~i~l~~P----~a~ll~~~a~~qd~~~GD   88 (480)
T cd03337          13 SGRKAQLGNIQAAKTVADVIRTCLGPRAMLKMLLDPMGGIVLTNDGNAILREIDVAHP----AAKSMIELSRTQDEEVGD   88 (480)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             4499999999999999999747659897828998899984796469999986547597----999999999965766268


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             6667999999999999999976988999999898644777767653222127--6024222122555334------5688
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
                      ||||+||||++||+++.+|+++|+||..|++||++|.+.++++|+++++|++  ++..+.++++|+++++      ..++
T Consensus        89 GTTt~vvLa~~ll~~~~~li~~g~~p~~I~~G~~~a~~~~~~~L~~~s~~v~~~~~~~l~~~i~t~~~~k~~~~~~~~~~  168 (480)
T cd03337          89 GTTSVIILAGEILAVAEPFLERGIHPTVIIKAYRKALEDALKILEEISIPVDVNDRAQMLKIIKSCIGTKFVSRWSDLMC  168 (480)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             58899999999999999999869980889999999999999999974427786569999999998444124466999999


Q ss_pred             HHHHHHHHHCCCCC-----------HHHH-CCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCC
Q ss_conf             89999998424320-----------0011-01465520333302320011224765423310134441131022013564
Q gi|254780849|r  160 EKIAYAMEQIGPHG-----------IITI-DQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKI  227 (551)
Q Consensus       160 ~li~~A~~~i~~d~-----------vi~i-~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~L  227 (551)
                      +++++|+..+..+.           .+.+ +..++...++.+++|+++++++.+|       .|++.++||+|+++|++|
T Consensus       169 ~l~~~av~~v~~~~~~~~~~id~~~~i~i~ki~gg~~~ds~~~~G~i~~k~~~~~-------~m~~~i~n~~ill~~~~L  241 (480)
T cd03337         169 NLALDAVKTVAVEENGRKKEIDIKRYAKVEKIPGGEIEDSRVLDGVMLNKDVTHP-------KMRRRIENPRIVLLDCPL  241 (480)
T ss_pred             HHHHHHHEEEECCCCCCCEEEEHHCCEEEEEECCCCCCCCEEEEEEEECCCCCCC-------CCCHHCCCCEEEEECCCC
T ss_conf             9999862576316887631321000458998237500000234017971666775-------330110575389971774


Q ss_pred             CCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCC
Q ss_conf             41001114677531116212222233358888653121356832322221230567669988652110112332101063
Q gi|254780849|r  228 SALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGL  307 (551)
Q Consensus       228 e~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~  307 (551)
                      +.                 +.+..+.+...++..+..+    +  +.+++     ..++.+++|++.+||++++++    
T Consensus       242 e~-----------------lvi~~k~i~~~a~~~l~~~----~--i~~~~-----~~~~~dl~~ia~~tga~ii~~----  289 (480)
T cd03337         242 EY-----------------LVITEKGVSDLAQHYLVKA----G--ITALR-----RVRKTDNNRIARACGATIVNR----  289 (480)
T ss_pred             CE-----------------EEECCCCCHHHHHHHHHHC----C--CEEEE-----EECHHHHHHHHHHCCCEEECC----
T ss_conf             01-----------------4550467548899999976----9--73897-----412877999998539888465----


Q ss_pred             CCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHH
Q ss_conf             22112222244102789804673013774217777654334677654135631111012221023344321256765314
Q gi|254780849|r  308 KLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEA  387 (551)
Q Consensus       308 ~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~  387 (551)
                       ++.++.+++|+++++...+.    ++   +                      ....+... ++ .++.+||++||+|+.
T Consensus       290 -~~~~~~~~lG~~~~~~~~~~----~~---~----------------------~~~~~~~~-~~-~~~~~tIlirG~t~~  337 (480)
T cd03337         290 -PEELTESDVGTGAGLFEVKK----IG---D----------------------EYFTFITE-CK-DPKACTILLRGASKD  337 (480)
T ss_pred             -HHHCCHHHCCCCCCEEEEEE----EC---C----------------------EEEEEEEC-CC-CCCEEEEEECCCCHH
T ss_conf             -31098877200250699999----44---5----------------------58999963-67-762489997167788


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             68989887788999987540278-105553799999999745089--968999999999999999999999779998999
Q gi|254780849|r  388 ALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELI  464 (551)
Q Consensus       388 ~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~  464 (551)
                      +++|.+|+++|||||+|++.+++ +|||||++|++++++|++++.  ++++++++++|++||++||++||+|||+|+.++
T Consensus       338 ~l~E~~r~l~DAl~a~k~a~~e~~iVpGGG~~e~~ls~~L~~~~~~~~~~e~~~i~~~a~AL~~ip~~La~NaG~d~~~v  417 (480)
T cd03337         338 VLNEVERNLQDAMAVARNIILNPKLVPGGGATEMAVSHALSEKAKSIEGVEQWPYKAVASALEVIPRTLAQNCGANVIRT  417 (480)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             99999999999999999996389988364499998899999873247717899999999999989999999779959999


Q ss_pred             HHHHHHCC----CCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998168----98665886687272138839837047899999999999998660999971
Q gi|254780849|r  465 VSKIQESK----TANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV  522 (551)
Q Consensus       465 i~~l~~~~----~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~  522 (551)
                      +.+|+..|    +++||||+.+|++.||++.|||||+.||+++|+.|+|+|++|||||++|.
T Consensus       418 l~~L~~~~~~~~~~~~Gid~~~g~~~dm~~~gIiDP~~vk~~al~~A~~va~~iL~iD~iIs  479 (480)
T cd03337         418 LTELRAKHAQGENSTWGIDGETGDIVDMKELGIWDPLAVKAQTYKTAIEAACMLLRIDDIVS  479 (480)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCCEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999998557898576967899170677587834699999999979999999998778635


No 29 
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=100.00  E-value=0  Score=691.08  Aligned_cols=442  Identities=20%  Similarity=0.281  Sum_probs=376.1

Q ss_pred             CH-HHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98-99999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    9 GT-AARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         9 g~-~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      |. +|...|+.||++++++|||||||+||||||+++.|+++|||||+||+|+|+++||    +|+|++++|++||+++||
T Consensus         5 ~~~~a~~~ni~a~~~la~~vk~TLGP~G~~kmi~~~~g~~~ITnDG~TI~k~i~~~~P----~a~ll~e~a~~qd~~~GD   80 (472)
T cd03341           5 GLEEAVLRNIEACKELSQITRTSYGPNGMNKMVINHLEKLFVTSDAATILRELEVQHP----AAKLLVMASQMQEEEIGD   80 (472)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEECCHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHCC
T ss_conf             5899999999999999999737759887838988799984898858999886748498----999999999834426358


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCHHHHHHHHHHHHHH-----HHH
Q ss_conf             6667999999999999999976988999999898644777767653222----1276024222122555334-----568
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHK----KVGSREEIIQVATISANGD-----REI  158 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~----~i~~~~~L~~vA~tS~~~~-----~~l  158 (551)
                      ||||+||||++||+++.+|+++|+||..|++||+.|.+.++++|++++.    +..+.+++.+++.|+++++     +.+
T Consensus        81 GTTt~vvLa~~ll~~~~~li~~g~~p~~I~~g~~~a~~~~~~~L~~~a~~~~~~~~~~~~i~~~~~ts~~sk~~~~~~~l  160 (472)
T cd03341          81 GTNLVVVLAGELLEKAEELLRMGLHPSEIIEGYEKALKKALEILEELVVYKIEDLRNKEEVSKALKTAIASKQYGNEDFL  160 (472)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHH
T ss_conf             67799999999999999999769988999999999999999999986124588966799999999988621014637899


Q ss_pred             HHHHHHHHHHCCCC--------CHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             88999999842432--------0001101465520333302320011224765423310134441131022013564410
Q gi|254780849|r  159 GEKIAYAMEQIGPH--------GIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL  230 (551)
Q Consensus       159 ~~li~~A~~~i~~d--------~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~  230 (551)
                      ++++++|+..+..+        .+..++..+++..++++++|++|++..         +++++.++||+|++++++++. 
T Consensus       161 ~~l~~~A~~~v~~~~~~~~~~~~i~i~~i~gg~~~~s~~i~G~v~~~~~---------~~~~~~~~~~ki~i~~~~~e~-  230 (472)
T cd03341         161 SPLVAEACISVLPENIGNFNVDNIRVVKILGGSLEDSKVVRGMVFKREP---------EGSVKRVKKAKVAVFSCPFDI-  230 (472)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEECCC---------CCCCEEECCCCEEEEECCCCC-
T ss_conf             9999999885204778840114789999418710011567247984354---------346413003736887234335-


Q ss_pred             CCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCC
Q ss_conf             01114677531116212222233358888653121356832322221230567669988652110112332101063221
Q gi|254780849|r  231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLE  310 (551)
Q Consensus       231 ~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~  310 (551)
                                   +..+++.++.++..++..+..+      ++++++++.     +.+|++++.+||+++++     +++
T Consensus       231 -------------~~~lii~~~~i~~~a~~~l~k~------~I~av~~~~-----~~~l~ria~~tg~~~i~-----~~~  281 (472)
T cd03341         231 -------------GVNVIVAGGSVGDLALHYCNKY------GIMVIKINS-----KFELRRLCRTVGATPLP-----RLG  281 (472)
T ss_pred             -------------CCCEEEECCCCCHHHHHHHHHC------CCEEEECCC-----HHHHHHHHHHCCCEEEC-----CCC
T ss_conf             -------------8977998788669999999874------937997077-----65799999973998855-----678


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHH
Q ss_conf             12222244102789804673013774217777654334677654135631111012221023344321256765314689
Q gi|254780849|r  311 KATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALG  390 (551)
Q Consensus       311 ~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~  390 (551)
                      .++.++||+|.++.+.+...                               ......+.++.+++++||++||+|+.+++
T Consensus       282 ~~~~~~lG~a~~v~~~~i~~-------------------------------~~~~~~~~~~~~~~v~tI~v~g~t~~~~~  330 (472)
T cd03341         282 APTPEEIGYCDSVYVEEIGD-------------------------------TKVVVFRQNKEDSKIATIVLRGATQNILD  330 (472)
T ss_pred             CCCHHHCCCCCCCEEEEECC-------------------------------EEEEEEEECCCCCCEEEEEECCCCHHHHH
T ss_conf             79887785367756888387-------------------------------77999994478775479997178899999


Q ss_pred             HHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             89887788999987540278-105553799999999745089--968999999999999999999999779998999999
Q gi|254780849|r  391 EKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSK  467 (551)
Q Consensus       391 E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~  467 (551)
                      |.+|+++||||++|++++++ +|||||++|++++.+|+.++.  .+.+++++++|++||+.||++|++|||+||.+++.+
T Consensus       331 E~~r~i~DAl~~~k~a~~e~~iVpGGG~~e~~l~~~l~~~~~~~~~~~~~~i~~~a~AL~~ip~~La~NaG~d~~~vv~~  410 (472)
T cd03341         331 DVERAIDDGVNVFKSLTKDGRFVPGAGATEIELAKKLKEYGEKTPGLEQYAIKKFAEAFEVVPRTLAENAGLDATEVLSE  410 (472)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             99986201899999998558731487588999999999975228867899999999999999999999789979999999


Q ss_pred             HHHCC---CCCEEEECCCC--CEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             98168---98665886687--27213883983704789999999999999866099997158
Q gi|254780849|r  468 IQESK---TANYGYNAQKS--VFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDA  524 (551)
Q Consensus       468 l~~~~---~~~~G~d~~~g--~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~  524 (551)
                      |++.|   ++++|+|+..+  ++.||++.|||||+.||+++|+.|+|+|++|||||++|+++
T Consensus       411 l~~~~~~~~~~~G~~~~~~~~~~~Dm~~~gIidP~~Vk~~al~~A~eva~~iL~iD~vI~~k  472 (472)
T cd03341         411 LYAAHQKGNKSAGVDIESGDEGTKDAKEAGIFDHLATKKWAIKLATEAAVTVLRVDQIIMAK  472 (472)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999717998007824797751657877694579999999998999999998777996179


No 30 
>KOG0361 consensus
Probab=100.00  E-value=0  Score=700.56  Aligned_cols=502  Identities=23%  Similarity=0.292  Sum_probs=423.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      |.--.-+|+.+|.++++.++|||||+||||+|+++.|+++||||||||||.+++-||    +||.|+++|++||.|+|||
T Consensus        18 Gk~QlvSNInaC~~v~e~~rtTLGP~GmDkLivd~~g~~tIsNDGATIlKlldivhP----aaktlVdia~sQDaEVGDG   93 (543)
T KOG0361          18 GKGQLVSNINACTAVAEALRTTLGPRGMDKLIVDSKGKTTISNDGATILKLLDIVHP----AAKTLVDIARSQDAEVGDG   93 (543)
T ss_pred             CCHHHHHCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEECCCHHHHHHHHHCCH----HHHHHHHHHHHCCCCCCCC
T ss_conf             751011023889999999972348666654665488747984670889998753171----4889998886213534688


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--C----CHHHHHHHHHHHHHH------H
Q ss_conf             667999999999999999976988999999898644777767653222127--6----024222122555334------5
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--S----REEIIQVATISANGD------R  156 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~----~~~L~~vA~tS~~~~------~  156 (551)
                      |||||+||+|+|+++..||+.|+||+.|+++|+.|...+++.+++++..++  +    ++.|.++|.|+++||      .
T Consensus        94 TTSVv~la~E~lk~~Kpfiedgv~~~~iir~~rka~~l~v~ki~elav~i~~~~~~~~r~lL~KcA~T~lsSKlI~~ek~  173 (543)
T KOG0361          94 TTSVVLLAAEFLKEAKPFIEDGVHPQLIIRAYRKARQLAVEKIKELAVEIDGSSKTELRELLEKCAATALSSKLIRQEKE  173 (543)
T ss_pred             CEEEEEEHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             13675418999975305766287788899999999999999999761473235515589999999887754666420489


Q ss_pred             HHHHHHHHHHHHCCC---CCHHHHCCC-CCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCC
Q ss_conf             688899999984243---200011014-6552033330232001122476542331013444113102201356441001
Q gi|254780849|r  157 EIGEKIAYAMEQIGP---HGIITIDQA-KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQP  232 (551)
Q Consensus       157 ~l~~li~~A~~~i~~---d~vi~i~~~-~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~  232 (551)
                      .+++++++|+..++.   ...|-+++. +|++.||.+++|+.|+|.|.+.+|    +++|+++.||+|+++|.+||....
T Consensus       174 fF~~MvVDAV~~ld~~l~~~mIGIKKV~GG~~~dS~lv~GVAFkKtFsYAGf----EqqPKk~~NpkIl~LnvELElKaE  249 (543)
T KOG0361         174 FFAKMVVDAVLTLDNDLDLNMIGIKKVPGGAMEDSLLVNGVAFKKTFSYAGF----EQQPKKFLNPKILLLNVELELKAE  249 (543)
T ss_pred             HHHHHHHHHHHHHCCCCCHHHCCEEECCCCCCCHHHHCCCEEEEEHCCCCCH----HHCCCCCCCCEEEEEEEEEEECCC
T ss_conf             9999999999864124642111244147886114142013002000020253----108510389648998635652003


Q ss_pred             CHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCC
Q ss_conf             11467753111621222223335888865312135683232222123056766998865211011233210106322112
Q gi|254780849|r  233 LLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKA  312 (551)
Q Consensus       233 ~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~  312 (551)
                      ..++.........+..++  +.||..+..........|.+|++.+.| +||.+.+||.|..++|.+||-.++    +...
T Consensus       250 kdNAEiRv~~v~eyQ~iV--DAEW~Ii~~KL~ki~~sGAnVVLSkLp-IGD~ATQyFAdrdiFCAGRV~~eD----l~Rv  322 (543)
T KOG0361         250 KDNAEIRVDNVEEYQAIV--DAEWNIIYDKLDKIHESGANVVLSKLP-IGDLATQYFADRDIFCAGRVPEED----LNRV  322 (543)
T ss_pred             CCCCEEECCCHHHHHHHH--HHHHHHHHHHHHHHHHCCCEEEEECCC-CHHHHHHHHHCCCCEECCCCCHHH----HHHH
T ss_conf             457446617889989987--379999999999998557717982366-227788775125831157688889----9899


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             22224410278980467301377421777765433467765413563111101222102334432125676531468989
Q gi|254780849|r  313 TIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEK  392 (551)
Q Consensus       313 ~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~  392 (551)
                      -.++.|+.....           ....+.+.+.|    ..+|+.+...+++++++.|.+  ...||++.||+.++.++|+
T Consensus       323 ~~acGGsi~tt~-----------~~i~~~~LG~C----~~FeE~QvG~eRyN~Fegcp~--aktcTliLRGgaeqfieE~  385 (543)
T KOG0361         323 MQACGGSIQTTV-----------SDIKEEVLGTC----ALFEERQVGGERYNLFEGCPK--AKTCTLILRGGAEQFIEET  385 (543)
T ss_pred             HHHCCCCHHHHH-----------HHCCHHHCCHH----HHHHHHHHCCHHHHHHCCCCC--CCEEEEEEECCHHHHHHHH
T ss_conf             996585110016-----------33165430123----557887513322122147886--6436999846689999997


Q ss_pred             HHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             88778899998754027-8105553799999999745089--96899999999999999999999977999899999998
Q gi|254780849|r  393 KDRYQDSLDATRAASDE-GIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQ  469 (551)
Q Consensus       393 ~r~~~DAl~v~~~~~~~-~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~  469 (551)
                      +|++|||++++|.++++ .||+|||+.||++|+.|++++.  .+++|+-+.+|++|||+|||+||+|||+|.++++.+||
T Consensus       386 eRSlHDAImIVrralkn~~vVaGGGaiEMElSk~lRd~S~ti~gK~q~~i~A~akalEvIPrqLc~NaGfDa~~ilnkLR  465 (543)
T KOG0361         386 ERSLHDAIMIVRRALKNDSVVAGGGAIEMELSKYLRDYSRTIAGKQQLFINAYAKALEVIPRQLCDNAGFDATNILNKLR  465 (543)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEECCCEEEEHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             65234477787877504837417862310699999986146672888999999999987589985512972889999999


Q ss_pred             HCCC---CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             1689---86658866872721388398370478999999999999986609999715877888899989999--997569
Q gi|254780849|r  470 ESKT---ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG--GMGGGM  544 (551)
Q Consensus       470 ~~~~---~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p~~~~~~--~~~~~~  544 (551)
                      ..|.   +|||+|+.++.+.|+++.+||||+.||.|++.+|+|+|++||.||+.|++.+++..    +|.+.  |+++||
T Consensus       466 ~rHA~G~~w~Gvdi~~e~i~dn~~~~VwEP~~VK~Nai~aateAa~lIlsvDeTikn~~S~~~----~p~~a~rgrg~g~  541 (543)
T KOG0361         466 QRHAQGEKWYGVDINTEGIADNFEKFVWEPSIVKINAITAATEAACLILSVDETIKNPKSQSA----PPSAAGRGRGRGR  541 (543)
T ss_pred             HHHHCCCCEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHEEEHHHHHCCCCCCCC----CCCCCCCCCCCCC
T ss_conf             986068850213305420556788654476787788788887755615751654238765689----9875556778999


Q ss_pred             CC
Q ss_conf             88
Q gi|254780849|r  545 GG  546 (551)
Q Consensus       545 ~~  546 (551)
                      |+
T Consensus       542 p~  543 (543)
T KOG0361         542 PR  543 (543)
T ss_pred             CC
T ss_conf             99


No 31 
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit; InterPro: IPR012719   The TCP-1 protein ,  (Tailless Complex Polypeptide 1) was first identified in mice where it is especially abundant in testis but present in all cell types. It has since been found and characterised in many other animal species, as well as in yeast, plants and protists. TCP-1 is a highly conserved protein of about 60 kDa (556 to 560 residues) which participates in a hetero-oligomeric 900 kDa double-torus shaped particle  with 6 to 8 other different subunits. These subunits, the chaperonin containing TCP-1 (CCT) subunit beta, gamma, delta, epsilon, zeta and eta are evolutionary related to TCP-1 itself , . The CCT is known to act as a molecular chaperone for tubulin, actin and probably some other proteins.   The TCP-1 family of proteins are weakly, but significantly , related to the cpn60/groEL chaperonin family (see IPR001844 from INTERPRO).    Proteins in this entry consist exclusively of the CCT gamma chain from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=704.02  Aligned_cols=464  Identities=19%  Similarity=0.305  Sum_probs=379.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79899999999999999997736789863598885899838832088877760347852257889999999866255188
Q gi|254780849|r    8 LGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGD   87 (551)
Q Consensus         8 ~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GD   87 (551)
                      -|..|+..|+.|+++|||+|||||||+.|-|||.|+.|.+++||||..||||+++.||    |||-++|+|++||+||||
T Consensus        13 ~G~k~q~~NI~AakAvaDiirttLGP~~MLKMLLDP~GGiV~TNDGnaILREi~v~HP----AAKSmiElsR~qDEEVGD   88 (527)
T TIGR02344        13 SGRKAQLSNIQAAKAVADIIRTTLGPRSMLKMLLDPMGGIVLTNDGNAILREIDVAHP----AAKSMIELSRTQDEEVGD   88 (527)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCEEEEECCCEEEEEEECCCC----HHHHHHHHHCCCCCCCCC
T ss_conf             5303435556888899999861476568999963004948986078657755312785----245688762145741257


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             6667999999999999999976988999999898644777767653222127--6024222122555334------5688
Q gi|254780849|r   88 GTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        88 GTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
                      |||||+|||||||..|..||++.+||+.|+++|..|++.+++.|+++|++++  +...+.++...|...|      +.+.
T Consensus        89 GTTSViiLAGE~L~~A~~f~~~~iHP~ii~~ay~~AL~d~l~~~~~~~~~vDV~d~~~~~~~~~scigTK~~~rw~~l~~  168 (527)
T TIGR02344        89 GTTSVIILAGEMLSAAEPFLEQNIHPTIIIRAYKKALEDALSVLEEISIPVDVNDSAAMLKLIKSCIGTKFVSRWSDLIC  168 (527)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             50212344689999999987238996650557999999999987660310145867899999974565557888899999


Q ss_pred             HHHHHHHHHCCCCC------------HHHHCCCCC-CCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCC
Q ss_conf             89999998424320------------001101465-52033330232001122476542331013444113102201356
Q gi|254780849|r  160 EKIAYAMEQIGPHG------------IITIDQAKT-ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKK  226 (551)
Q Consensus       160 ~li~~A~~~i~~d~------------vi~i~~~~~-~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~  226 (551)
                      ++..+|+..+..+.            +..+|+.+| ...||.+.+|+.|+|...||       +|.+.++||+|+++||+
T Consensus       169 ~lAL~Av~tv~~~~~~~~~~e~DIKrYakVEKiPGG~i~dS~VL~GVm~NKDvthP-------KMrR~I~NPRi~LLDcp  241 (527)
T TIGR02344       169 DLALDAVRTVKRDEGNGRKLEIDIKRYAKVEKIPGGEIEDSCVLKGVMINKDVTHP-------KMRRRIENPRIVLLDCP  241 (527)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEEEEEEEEECCCCCCCCCEEECCEEECCCCCCC-------CCCCEECCCEEEEECCC
T ss_conf             99999998875205675156556531478963489811243232131323453586-------44103138737984688


Q ss_pred             CCCCCCC--HHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHH---------------
Q ss_conf             4410011--14677531116212222233358888653121356832322221230567669988---------------
Q gi|254780849|r  227 ISALQPL--LPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVL---------------  289 (551)
Q Consensus       227 Le~~~~~--~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L---------------  289 (551)
                      ||+.|-.  +++.....+.-..++.+.+..-+.....++..+     |.+++..+|+.|.++|||               
T Consensus       242 LEYKKGESqTn~Ei~~E~d~~~~L~~Eee~v~~~C~~Ii~~K-----PD~ViTEKGvSDLAqHYL~K~ni~aiRR~RKtD  316 (527)
T TIGR02344       242 LEYKKGESQTNVEITKEEDWNRLLQIEEEYVQRMCEDIIAVK-----PDLVITEKGVSDLAQHYLLKANISAIRRVRKTD  316 (527)
T ss_pred             CCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCEEEECCCCHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             400136775440320653589999988999999999998418-----988996276026899999867922886023130


Q ss_pred             -HHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEE-EECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             -65211011233210106322112222244102789-8046730137742177776543346776541356311110122
Q gi|254780849|r  290 -RDIAAVVGATVISEEIGLKLEKATIADLGSAKKVV-MSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       290 -~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~-i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
                       .+++.+|||++++     +.+++..+|.|.-+-.. +.+     ++            ++++..+.+            
T Consensus       317 nnRiaR~~GA~IVn-----R~Eel~E~DvGt~cGLFe~~k-----iG------------DeYf~F~~~------------  362 (527)
T TIGR02344       317 NNRIARACGATIVN-----RPEELRESDVGTGCGLFEVKK-----IG------------DEYFTFLTE------------  362 (527)
T ss_pred             HHHHHHHHCCEEEC-----CCCCCEECCCCCCCCEEEEEE-----CC------------CHHHHHHHC------------
T ss_conf             14667750871525-----611051044467654033210-----21------------146688524------------


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHH
Q ss_conf             210233443212567653146898988778899998754-02781055537999999997450899--689999999999
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAA-SDEGIVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRK  444 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~-~~~~vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~  444 (551)
                        ||.++. |||+.||+|..++.|+||.++||+.|.|+. ++++++|||||+||+.|.+|.+.+.+  +-+|..++|.|.
T Consensus       363 --Ck~PkA-CTilLRG~SKDvLnE~ERNL~Dam~varN~~~~P~L~pGGGA~Em~Vs~~L~~~~~~~eg~~~~py~AVA~  439 (527)
T TIGR02344       363 --CKDPKA-CTILLRGASKDVLNEVERNLQDAMAVARNVLLEPKLLPGGGATEMAVSVKLAKKAKKLEGVEQWPYRAVAD  439 (527)
T ss_pred             --CCCCCC-CEEEECCCCCHHHHHHHHHHHHHHHHHHHEEECCEECCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             --889762-24774278601333433117779988441020773348874588999999999876413300136899999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCCCC-----CEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999997799989999999816898-----665886687272138839837047899999999999998660999
Q gi|254780849|r  445 ALSYPCRQIIKNAGDESELIVSKIQESKTA-----NYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEA  519 (551)
Q Consensus       445 AL~~ip~~La~NaG~d~~~~i~~l~~~~~~-----~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~  519 (551)
                      |||.|||||+||+|.|+.-.+++||+.|..     ++|+|+.+|++.||.+.+||||+.||.|.+++|.|+|++||||||
T Consensus       440 AlE~IPrtL~QNcG~~~ir~~t~LraKH~~~~~~~~~GIdG~~G~ivdm~~~~iWep~~VK~Q~~KTAiE~A~llLRiDD  519 (527)
T TIGR02344       440 ALEIIPRTLAQNCGVNVIRTLTELRAKHAQEYNNKTWGIDGETGKIVDMKEKGIWEPLAVKLQTYKTAIESACLLLRIDD  519 (527)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCEEEEEECCCCCHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             97453467764258728888898777762278841453327732168620036654023201102568999999874200


Q ss_pred             HHHCC
Q ss_conf             97158
Q gi|254780849|r  520 VVVDA  524 (551)
Q Consensus       520 iI~~~  524 (551)
                      ||.-.
T Consensus       520 iVSG~  524 (527)
T TIGR02344       520 IVSGV  524 (527)
T ss_pred             EECCC
T ss_conf             00475


No 32 
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit; InterPro: IPR012722    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT zeta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=668.37  Aligned_cols=470  Identities=22%  Similarity=0.319  Sum_probs=392.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      -..|...|+.|++.+.+++||.|||+|.-||||++.|++.+|+||.+.|+||.++||+    |-||-.+|.+||+..|||
T Consensus        14 ~~~aL~~N~~Aa~gL~~vLktNLGPKGTlKMLVsGaGdIKLTKDG~VLL~EM~IQhPT----A~lIar~A~aQDdi~GDG   89 (548)
T TIGR02347        14 RDAALMMNINAARGLQDVLKTNLGPKGTLKMLVSGAGDIKLTKDGNVLLKEMQIQHPT----ASLIARAATAQDDITGDG   89 (548)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCEEECCCCHHHHHCCCCCCCH----HHHHHHHHHHHCCCCCCC
T ss_conf             7758877588888899999864898876200013668714324754677337502720----899999976531656683


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHH------H
Q ss_conf             66799999999999999997-6988999999898644777767653222127-----6024222122555334------5
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVT-AGLNPMDIKRGIDLAVQEVVEYLKANHKKVG-----SREEIIQVATISANGD------R  156 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~-~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~-----~~~~L~~vA~tS~~~~------~  156 (551)
                      |||+|+|++|||++|+++|. .|+||..|.+||+.|.+.+++||++..+|++     |++-|.+||+||+..|      .
T Consensus        90 TTStv~ligeLlkq~e~~i~yEG~HPRi~t~GfE~A~~~~L~FL~~~K~pvk~~~~~Dre~L~~Vart~l~TKl~~~L~D  169 (548)
T TIGR02347        90 TTSTVILIGELLKQAERYILYEGIHPRILTEGFEIARKELLEFLDKFKIPVKTEDEVDRELLLNVARTSLRTKLPAELAD  169 (548)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             26899989889998888775259973012321889999999862104652013631007899999766520377878998


Q ss_pred             HHHHHHHHHHHHCCCC-------CHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             6888999999842432-------000110146552033330232001122476542331013444113102201356441
Q gi|254780849|r  157 EIGEKIAYAMEQIGPH-------GIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISA  229 (551)
Q Consensus       157 ~l~~li~~A~~~i~~d-------~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~  229 (551)
                      .|++.+++|+..|-.+       .|...+.......|+++|+|+++|+|..||       .||..++||+||+||-.||+
T Consensus       170 ~Lt~~vvdavl~I~~~~~~iDLfMvEim~M~h~~~~dT~LirGLVLDHG~RHP-------dMp~~~~n~yiLtcNVSLEY  242 (548)
T TIGR02347       170 QLTEIVVDAVLAIKKDGEKIDLFMVEIMEMKHKSATDTTLIRGLVLDHGARHP-------DMPRRVKNAYILTCNVSLEY  242 (548)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCEECEEECCCCCCCC-------CCCCCCCCCEEEEEECCCHH
T ss_conf             88689887777520678998703554587520210164100101303778877-------73214231078896051001


Q ss_pred             CCCCHHH--HHHHHHCCCHHHHHHHHHHHHHHH---------------------HHCCCCCCCCEE----ECCCCCCHHH
Q ss_conf             0011146--775311162122222333588886---------------------531213568323----2222123056
Q gi|254780849|r  230 LQPLLPI--LESATQSGRPLCIIAEDVEGDALA---------------------TLVVNRVRCGLP----VLAVKAPAFG  282 (551)
Q Consensus       230 ~~~~~~~--le~~~~~~~~l~ii~~~~e~~~l~---------------------~lv~n~~k~gi~----v~~vk~~~~~  282 (551)
                      ++++++.  ..+..+....|+--..+|..+..+                     .+++-..| |++    ..+.+.++++
T Consensus       243 EKtEVNS~f~Ys~A~~Re~lv~aERkF~d~rV~KIIeLK~~v~~~~~~~~d~iygFvViNQK-GIDp~SLD~La~~~I~A  321 (548)
T TIGR02347       243 EKTEVNSGFFYSNAEQREKLVEAERKFVDDRVKKIIELKKKVCGKSPKEEDKIYGFVVINQK-GIDPPSLDLLAKEGILA  321 (548)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECEEEEECC-CCCHHHHHHHHHCCCEE
T ss_conf             00112123110688789999998656388888777987688607899754101145888406-89822388996589246


Q ss_pred             HHH--HHHHHHHHHHCCCCCCCHHHCCCCCCCCC-CCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             766--99886521101123321010632211222-224410278980467301377421777765433467765413563
Q gi|254780849|r  283 DRR--KEVLRDIAAVVGATVISEEIGLKLEKATI-ADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD  359 (551)
Q Consensus       283 ~~~--~~~L~dia~~tGa~vi~~~~~~~l~~~~~-~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~  359 (551)
                      .||  +..+||+..+|||..+|     +++++++ ++||+|+-|+...                              ..
T Consensus       322 LRRAKRRNMERL~LacGG~a~N-----Sv~dL~Pfe~LG~AGlVYE~~------------------------------~G  366 (548)
T TIGR02347       322 LRRAKRRNMERLTLACGGEALN-----SVEDLTPFECLGWAGLVYETV------------------------------IG  366 (548)
T ss_pred             EEHHHHHHHHHHHHHHCCCCCC-----CCCCCCCHHHCCCCCEEEEEE------------------------------EC
T ss_conf             4023453145655640780137-----424687311237652134135------------------------------56


Q ss_pred             CCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHH---HCCC--CH
Q ss_conf             111101222102334432125676531468989887788999987540278-10555379999999974---5089--96
Q gi|254780849|r  360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALS---VKGD--NE  433 (551)
Q Consensus       360 ~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~---~~~~--~~  433 (551)
                      ++|++|.|.+ + +..+|||+++||++|.+...+++++|.|+|++++++++ ||||+||+|+.++.+|+   +...  .+
T Consensus       367 EEKyTFiEe~-~-~PkScTiLIkGpn~~ti~QiKDAvRDGLRAv~N~i~D~cv~~GAGAFE~a~~~~L~~an~~~~~vkG  444 (548)
T TIGR02347       367 EEKYTFIEEV-K-NPKSCTILIKGPNDHTIKQIKDAVRDGLRAVKNAIEDKCVVPGAGAFEIAAYKHLKSANEEKKSVKG  444 (548)
T ss_pred             CCCCEEEEEC-C-CCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             8500022103-8-7861688732886446776467665225764545413551356179999999986433210014651


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC--------CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHH
Q ss_conf             8999999999999999999999779998999999981689--------86658866872721388398370478999999
Q gi|254780849|r  434 DQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKT--------ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQ  505 (551)
Q Consensus       434 ~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~~--------~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~  505 (551)
                      ++++|+|+||+||.+|||||++|||||+.|+|.+|..+++        .-.|+|+.+|+..+....||||++.||+|.|+
T Consensus       445 k~klG~eafA~ALL~IPKtL~~NsG~D~~~~L~~l~~~~~~~~dsde~~~~GvdL~~Ge~~~~~~~GIwDny~VKk~~i~  524 (548)
T TIGR02347       445 KAKLGVEAFANALLVIPKTLAENSGYDAQDTLVKLEDEHDEGGDSDESEVVGVDLETGEPIDPELKGIWDNYRVKKQLIQ  524 (548)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             24567999998764102686522786789999999998740456334520232035677566442552165146866541


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999866099997158778
Q gi|254780849|r  506 SAGSLAGMMLITEAVVVDAPKD  527 (551)
Q Consensus       506 ~A~e~a~~iLriD~iI~~~~~~  527 (551)
                      +||-+|++||-||+|+++..+.
T Consensus       525 ~At~iA~qLLLvDEv~RAG~~~  546 (548)
T TIGR02347       525 SATVIASQLLLVDEVLRAGRSM  546 (548)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCC
T ss_conf             0658988899999998646223


No 33 
>KOG0358 consensus
Probab=100.00  E-value=0  Score=639.46  Aligned_cols=467  Identities=21%  Similarity=0.276  Sum_probs=383.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      -++.|.+|+.|+++++++++|||||+||||||..++|+++|||||+||||.|.+-||    +|+||+++|++||.|+|||
T Consensus        24 p~~vR~sni~Aa~avadairTSLGPkGmDKMIq~~~gev~iTNDGaTILk~m~vlhP----~akmLvelS~aQD~eaGDG   99 (534)
T KOG0358          24 PEQVRFSNIQAARAVADAIRTSLGPKGMDKMIQTGKGEVIITNDGATILKQMNVLHP----AAKMLVELSAAQDSEAGDG   99 (534)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHCCCCCEEEECCHHHHHHHHHHHCH----HHHHHHHHHHHCCCCCCCC
T ss_conf             787777888989999999873338633456753488748995671899998763271----8899998655201002698


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHH------HHHHH
Q ss_conf             667999999999999999976988999999898644777767653222127--6024222122555334------56888
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG--SREEIIQVATISANGD------REIGE  160 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~--~~~~L~~vA~tS~~~~------~~l~~  160 (551)
                      |||||||||.||+.+.+|+++|+||+.|.+.|+.|.++++++|.+++.|++  +++.|.+-|+||+|+|      +.++.
T Consensus       100 TTsVVilaGaLL~~~~~LL~kgiHPtvIsdsfq~a~~~~v~il~~m~~~velsdre~Li~~atTsLnSKvvSq~s~llap  179 (534)
T KOG0358         100 TTSVVILAGALLEAAEKLLQKGIHPTVISDSFQSAAKKAVDILDEMSVPVELSDRESLIKSATTSLNSKVVSQYSSLLAP  179 (534)
T ss_pred             CEEEEEEHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             34798825569999999996599940466789999887899998617874157689999887767668888741011014


Q ss_pred             HHHHHHHHC---------CCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             999999842---------43200011014655203333023200112247654233101344411310220135644100
Q gi|254780849|r  161 KIAYAMEQI---------GPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       161 li~~A~~~i---------~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                      +.++|+.++         +...+..+++.+|..+|+++++|+.|++....       ...|.++++++|.++.+.|+.++
T Consensus       180 mAVdAV~kv~dp~~~~nvdlkdIkivkklGgtvdDte~i~glvl~~~~~~-------~~gptriekAkIglIQF~iS~PK  252 (534)
T KOG0358         180 MAVDAVLKVIDPENATNVDLKDIKIVKKLGGTVDDTELIKGLVLTQKASK-------SAGPTRIEKAKIGLIQFQISPPK  252 (534)
T ss_pred             HHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHCCEEEEEECCC-------CCCCCHHHHCEEEEEEEEECCCC
T ss_conf             78999985047665665654652248863886212333044377643035-------88864121202568999816999


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHH--------------------HHHHHHHHH
Q ss_conf             111467753111621222223335888865312135683232222123056--------------------766998865
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFG--------------------DRRKEVLRD  291 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~--------------------~~~~~~L~d  291 (551)
                      +-++.-.-+.++.+---++  ..|++++-++...+.+.|+++++++..+..                    |..+++.+-
T Consensus       253 tdmen~iiv~DyaqMdril--keER~YiL~mcKkIKk~gcnvLliQKSILRdavsDLAlHfL~klkimvikdieRedief  330 (534)
T KOG0358         253 TDMENQIIVNDYAQMDRIL--KEERQYILNMCKKIKKAGCNVLLIQKSILRDAVSDLALHFLAKLKIMVIKDIEREDIEF  330 (534)
T ss_pred             CCCCCCEEECCHHHHHHHH--HHHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHHHHHHHHHCCEEEECCCCHHHHHH
T ss_conf             9855526754799999999--99999999999999862882999758888988999999999757078870443766789


Q ss_pred             HHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC
Q ss_conf             21101123321010632211222224410278980467301377421777765433467765413563111101222102
Q gi|254780849|r  292 IAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAK  371 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~  371 (551)
                      ++...|.+++.     +++.++.+.||++.-+                              |+..+..+...++-...+
T Consensus       331 ick~l~c~Pia-----~id~f~~d~Lg~adlv------------------------------eE~~~~G~gkivk~tg~~  375 (534)
T KOG0358         331 ICKTLGCKPIA-----DIDHFTADKLGSADLV------------------------------EETDSSGEGKIVKITGIQ  375 (534)
T ss_pred             HHHHCCCEECC-----HHHHCCHHHCCCCHHH------------------------------HHCCCCCCCCEEEEEEEE
T ss_conf             88514970131-----0432496443750244------------------------------412468985179998762


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHH
Q ss_conf             334432125676531468989887788999987540278-1055537999999997450899--6899999999999999
Q gi|254780849|r  372 LAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRKALSY  448 (551)
Q Consensus       372 l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~AL~~  448 (551)
                      ..|..++|++||+++.+++|.+|++||||||+|+..+.+ .+||||+.||+++..|+.++.+  +.+.+.+++||+|||.
T Consensus       376 n~g~tvsil~RGsn~lvleEaeRSlhDALCVirCLvk~r~li~GGGapEieia~~L~~~a~t~eG~~~yc~rafA~AlEv  455 (534)
T KOG0358         376 NAGRTVSILLRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIEIALRLSALARTLEGVEAYCWRAFADALEV  455 (534)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             38983699994574342677764332025777766522101058998106999999998755216156899999988724


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHCCC---CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999779998999999981689---86658866872721388398370478999999999999986609999715
Q gi|254780849|r  449 PCRQIIKNAGDESELIVSKIQESKT---ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD  523 (551)
Q Consensus       449 ip~~La~NaG~d~~~~i~~l~~~~~---~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~  523 (551)
                      ||+|||+|||++|+.++++||+.|.   +++|+|+..|.+.||++..|+.|+.|-.++++.|+|++.+||+||||+.+
T Consensus       456 IP~tLAeNAGLnpI~~VtELRn~haqge~~aGInVRkg~~tni~ee~VvQPllVs~SaitlA~Etvr~ILKIDDIv~a  533 (534)
T KOG0358         456 IPYTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGGITNILEENVVQPLLVSISAITLATETVRSILKIDDIVNA  533 (534)
T ss_pred             CCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             637677517988146899998887547766663453153113577735440253077999999999888304231026


No 34 
>KOG0363 consensus
Probab=100.00  E-value=0  Score=620.07  Aligned_cols=471  Identities=23%  Similarity=0.347  Sum_probs=380.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECC--CCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             98999999999999999977367898635988858--9983883208887776034785225788999999986625518
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNS--FGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSG   86 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~--~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~G   86 (551)
                      |++||...+.|+.++.|+|||||||+|||||+...  .|.+.||||||||||++.+.+|    +||.|+++|+.||+|+|
T Consensus        16 ge~ArlssfvGaiaigDlvKsTLGPKGMdKiL~s~~~~~~v~VTNDGAtILksi~vDnp----aAkvLv~~S~vQD~EvG   91 (527)
T KOG0363          16 GENARLSSFVGAIAIGDLVKSTLGPKGMDKILQSTGRAGTVMVTNDGATILKSIGVDNP----AAKVLVDISKVQDDEVG   91 (527)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCEEEECCHHHHHHHCCCCCC----HHHHEECCCCCCCCCCC
T ss_conf             45577888777899888888435830288998616888726994564899985278980----55602232125543347


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHH------
Q ss_conf             86667999999999999999976988999999898644777767653222127-----6024222122555334------
Q gi|254780849|r   87 DGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG-----SREEIIQVATISANGD------  155 (551)
Q Consensus        87 DGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~-----~~~~L~~vA~tS~~~~------  155 (551)
                      ||||||+|||+|||++|.+|+.+.+||++|+.|||+|...+++.|.+.++...     -+++|+++|+|++++|      
T Consensus        92 DGTTSV~vlaaeLlreAeklv~~kiHPq~Ii~GyR~A~~~a~eaL~~~s~dns~~~~kfr~DLl~iarTTL~SKiLsq~k  171 (527)
T KOG0363          92 DGTTSVTVLAAELLREAEKLVNQKIHPQTIISGYRMATAAALEALTKSSIDNSSDKEKFREDLLKIARTTLSSKILSQDK  171 (527)
T ss_pred             CCCEEHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87012498899999999998752468288999999999999999987640056856777999999998878889988618


Q ss_pred             HHHHHHHHHHHHHCC----CCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             568889999998424----3200011014655203333023200112247654233101344411310220135644100
Q gi|254780849|r  156 REIGEKIAYAMEQIG----PHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       156 ~~l~~li~~A~~~i~----~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                      ++++++.++|+..+.    .+.+-.++..+|...|+.+=+|..+++..-        -..|++++||+||+.|.+++..+
T Consensus       172 ehFaelavdAV~rLkGs~nL~~IqIIK~~Gg~l~dSfLDeGFlL~K~ig--------v~qpkriena~iLIANT~mDtDK  243 (527)
T KOG0363         172 EHFAELAVDAVLRLKGSTNLEAIQIIKKLGGKLEDSFLDEGFLLDKKIG--------VNQPKRIENAKILIANTPMDTDK  243 (527)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEEHHCCCCCCCCCCCCCCEECCCCC--------CCCCCCCCCCCEEEECCCCCCCC
T ss_conf             8999999999997458787112121022287521000455400214558--------99831024564687458776432


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHH----------------HHHHHH
Q ss_conf             1114677531116212222233358888653121356832322221230567669988----------------652110
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVL----------------RDIAAV  295 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L----------------~dia~~  295 (551)
                      -++..-.--.++..++.-+ +..++++++..+..+.+.|+++. +..+.++++..+.|                ++++..
T Consensus       244 vKvfGarvrVds~~klael-E~AEkeKmK~KV~kI~~hgiN~F-iNRQLiYnyPeqLf~dagi~aIEHADFdGiERLalv  321 (527)
T KOG0363         244 VKVFGARVRVDSTAKLAEL-EKAEKEKMKEKVEKILKHGINVF-INRQLIYNYPEQLFADAGIMAIEHADFDGIERLALV  321 (527)
T ss_pred             EEEECCEEEECCHHHHHHH-HHHHHHHHHHHHHHHHHCCCCEE-EEHHHHHCCHHHHHHHCCCCEEECCCCHHHHHHHHC
T ss_conf             2452106860415679988-87799999999999985597689-614676248899975437323312561357888631


Q ss_pred             CCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCC
Q ss_conf             11233210106322112222244102789804673013774217777654334677654135631111012221023344
Q gi|254780849|r  296 VGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGG  375 (551)
Q Consensus       296 tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~  375 (551)
                      ||+.+++     .+++.+...||+|..+                          ++.+    ...++...+.. + -.|-
T Consensus       322 tGGeI~S-----TFd~p~~~klG~C~~I--------------------------eeim----iGed~li~FSG-v-~~Ge  364 (527)
T KOG0363         322 TGGEIVS-----TFDNPELVKLGECDLI--------------------------EEIM----IGEDKLIKFSG-V-KLGE  364 (527)
T ss_pred             CCCEEEE-----CCCCCCHHCCCCCHHH--------------------------HHHH----CCCCCEEEECC-C-CCCC
T ss_conf             3662210-----0578002015641226--------------------------8875----07531366325-3-3466


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHHHH
Q ss_conf             3212567653146898988778899998754-02781055537999999997450899--68999999999999999999
Q gi|254780849|r  376 VAVLEVGDVTEAALGEKKDRYQDSLDATRAA-SDEGIVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRKALSYPCRQ  452 (551)
Q Consensus       376 ~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~-~~~~vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~AL~~ip~~  452 (551)
                      .|||++||+|++++||.||++||||||+... .+++++.||||+||.+++.+.+++..  +++..++++|++||..+|.+
T Consensus       365 ActIVlrGat~q~LDEaeRslHDALcVLaqtv~esrvv~GgG~sEm~Ma~av~~~A~~~pGkea~AieAfarAL~qlPti  444 (527)
T KOG0363         365 ACTIVLRGATQQILDEAERSLHDALCVLAQTVKESRVVLGGGCSEMLMAKAVDKEAQETPGKEALAIEAFARALRQLPTI  444 (527)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCHH
T ss_conf             05899806638777788877888999999872445166558818999999999998648861568999999999844443


Q ss_pred             HHHHCCCCHHHHHHHHHHCCCC---CEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             9997799989999999816898---6658866872721388398370478999999999999986609999715877888
Q gi|254780849|r  453 IIKNAGDESELIVSKIQESKTA---NYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET  529 (551)
Q Consensus       453 La~NaG~d~~~~i~~l~~~~~~---~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~  529 (551)
                      ||.|||||+.+++++||+.|..   ++|+|+.+|+++||.+.||+|++.||+..+.+|+|+|.+|||+|+||+++|+.+.
T Consensus       445 iaDNaG~dsaelva~Lra~h~~g~~t~Gld~~~G~i~dm~~~Gi~es~~vK~~vv~sasEaae~ilrvD~Iik~aPR~r~  524 (527)
T KOG0363         445 IADNAGYDSAELVAQLRAEHYNGRTTMGLDVRNGEIGDMRELGIVESLKVKQAVVSSASEAAEMILRVDNIIKAAPRERE  524 (527)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             22367887899999999886168865130125673335787410888889999986057787888766456535875345


Q ss_pred             C
Q ss_conf             8
Q gi|254780849|r  530 A  530 (551)
Q Consensus       530 ~  530 (551)
                      .
T Consensus       525 ~  525 (527)
T KOG0363         525 R  525 (527)
T ss_pred             C
T ss_conf             6


No 35 
>KOG0360 consensus
Probab=100.00  E-value=0  Score=577.12  Aligned_cols=473  Identities=23%  Similarity=0.311  Sum_probs=388.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      |+.+|.+|..|+.++++++||||||-|+|||++|+.|++++||||||||+.++++||    ++|.|++.++.||+|+|||
T Consensus        17 g~~vr~qnv~a~~~i~nivkss~GPvGldKmlvdd~Gdvt~TndgAtiL~~l~V~HP----a~KiLvelaq~qd~evgDg   92 (545)
T KOG0360          17 GERVRTQNVMAAMAIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILSLLEVEHP----AAKVLVELAQLQDEEVGDG   92 (545)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHCCCH----HHHHHHHHHHHCCCCCCCC
T ss_conf             500444437889999988873258643354414664606884458999875420270----8999999887342112677


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHCC--CCHHHHHHHHHHHHHH------HHHH
Q ss_conf             667999999999999999976988999999898644777767653-222127--6024222122555334------5688
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKA-NHKKVG--SREEIIQVATISANGD------REIG  159 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~-~s~~i~--~~~~L~~vA~tS~~~~------~~l~  159 (551)
                      ||+||++|+|||++|.+|+.+++||+.|+.||+.|+.+++++..+ .+.+++  .++-|.++++||+++|      +.++
T Consensus        93 ttsvviia~eLl~~a~~Lv~~~ihpt~ii~gyr~ac~e~~k~i~~~~~~~vd~lg~~~Lin~~ktsmsSK~i~~ds~~f~  172 (545)
T KOG0360          93 TTSVVIIAAELLKNADELVKTKIHPTRIISGYRLACIEAVKYITEGLSKPVDSLGTQILINLAKTSMSSKIIGMDSDFFT  172 (545)
T ss_pred             CEEEEEEEHHHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHHCCCEEEHHHCCHHHHHHHHHHHHCCEECCCCHHHHH
T ss_conf             04899977876525998603788642126668999999998731551002212056899999987631401124347778


Q ss_pred             HHHHHHHHHCCC-----------CCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCC
Q ss_conf             899999984243-----------200011014655203333023200112247654233101344411310220135644
Q gi|254780849|r  160 EKIAYAMEQIGP-----------HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKIS  228 (551)
Q Consensus       160 ~li~~A~~~i~~-----------d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le  228 (551)
                      +++++|+..+..           +.+-.++-.+.+..|+.++.|+.++....+       +.||..+.|+||+++|+.|.
T Consensus       173 ~~Vvda~l~v~~~~~~ge~~ypi~~vnILkahG~s~~eS~l~~GyaLnc~~as-------q~m~~~i~~~Kiacld~~Lq  245 (545)
T KOG0360         173 EMVVDALLAVKILDINGEPHYPINSVNILKAHGKSQIESMLLPGYALNCSVAS-------QMMPLRIKNAKIACLDFTLQ  245 (545)
T ss_pred             HHHHHHHHHHHHCCCCCCEECCCCCEEEEECCCCCCHHHEEECCEEEECCHHH-------HCCCCCCCCCEEEEEECCCC
T ss_conf             89999997776305578520002521577647754012224446345134765-------23633343421466751220


Q ss_pred             CCCCCHHH---------HHHHHHCCCHHHHHHHHHHHHHHHHHCCC--CCCCCEEECCCC----CCHHHHHH--HHHHHH
Q ss_conf             10011146---------77531116212222233358888653121--356832322221----23056766--998865
Q gi|254780849|r  229 ALQPLLPI---------LESATQSGRPLCIIAEDVEGDALATLVVN--RVRCGLPVLAVK----APAFGDRR--KEVLRD  291 (551)
Q Consensus       229 ~~~~~~~~---------le~~~~~~~~l~ii~~~~e~~~l~~lv~n--~~k~gi~v~~vk----~~~~~~~~--~~~L~d  291 (551)
                      ..+..+..         ++++.+  ++..|..+++..  +..-..|  +..+|++..+.|    ++.++.+|  +++|+.
T Consensus       246 k~km~lGv~vvv~dp~kle~ir~--~e~~itkeRi~k--Il~~ganvVLtt~gIddmc~K~~veagamAVrR~~k~dlk~  321 (545)
T KOG0360         246 KTKMKLGVQVVVDDPEKLEQIRQ--REQDITKERIKK--ILATGANVVLTTGGIDDMCLKYFVEAGAMAVRRCKKEDLKR  321 (545)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHH--HHHHHHHHHHHH--HHHCCCCEEEECCCCCHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             13445661599828588899898--876767999999--98669858998587568999999872216668887988899


Q ss_pred             HHHHCCCCCCCHHHCCC-CCCCCCCCCCCEEEEEEEC---CCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             21101123321010632-2112222244102789804---6730137742177776543346776541356311110122
Q gi|254780849|r  292 IAAVVGATVISEEIGLK-LEKATIADLGSAKKVVMSK---DDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       292 ia~~tGa~vi~~~~~~~-l~~~~~~~LG~~~~v~i~~---~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
                      ++.+||+++++.-...+ -+.++.+.+|+|..+...+   ++..++.+                                
T Consensus       322 iaKatGat~~sSla~l~geetf~~~~lG~a~evvqeri~dde~ilikg--------------------------------  369 (545)
T KOG0360         322 IAKATGATLLSSLANLEGEETFEPASLGSADEVVQERIGDDELILIKG--------------------------------  369 (545)
T ss_pred             HHHHHCCEEEEHHHCCCCCCCCCHHHCCCHHHHHHHHCCCCEEEEECC--------------------------------
T ss_conf             998618704212213466323371421545678887506642699606--------------------------------


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHH
Q ss_conf             2102334432125676531468989887788999987540278-1055537999999997450899--689999999999
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRK  444 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~  444 (551)
                        .  ....+.|+.||++++.+||.+|++|||||++|..++++ +||||||.|..++.+|+.++.+  .+++.++.-|++
T Consensus       370 --~--ka~~aSiILrgaNd~~~DEmers~hdaL~VlkrtLes~~vvpGGG~vE~aLs~yle~~a~s~~srE~laiaefa~  445 (545)
T KOG0360         370 --T--KATSASIILRGANDFMLDEMERSLHDALCVLKRTLESKSVVPGGGAVETALSIYLENFATSVGSREQLAIAEFAA  445 (545)
T ss_pred             --C--CCCEEEEEEECCCCCCHHHHCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             --7--530456898268745075523443568999998703573455862899999999984234676088899999999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCCC-----------CCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999779998999999981689-----------8665886687272138839837047899999999999998
Q gi|254780849|r  445 ALSYPCRQIIKNAGDESELIVSKIQESKT-----------ANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGM  513 (551)
Q Consensus       445 AL~~ip~~La~NaG~d~~~~i~~l~~~~~-----------~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~  513 (551)
                      ||.+||++|+-||+.|+.+.++++|+.|+           +|+|+|+.+|++.|.++.|+++|..+|...|++|+|+|++
T Consensus       446 all~ipktla~naa~Dstelvt~lra~Hs~~q~~p~~~~~k~~GldL~ng~~~dn~~~g~~ep~~~kvksLk~ateaait  525 (545)
T KOG0360         446 ALLSIPKTLAVNAAKDSTELVTKLRAYHSVSQDNPWRLLLKQYGLDLINGKIRDNKSAGSFEPPIVKVKSLKFATEAAIT  525 (545)
T ss_pred             HHHCCHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCCCCCCHHHCCCCCCCEEECCEEEEEECCCEEEHHHHHHHHHHHHH
T ss_conf             99621387755412563100135667742440687544213307400055763240441652642320455788876666


Q ss_pred             HHHHHHHHHCCCCCCCCCC
Q ss_conf             6609999715877888899
Q gi|254780849|r  514 MLITEAVVVDAPKDETASP  532 (551)
Q Consensus       514 iLriD~iI~~~~~~~~~~p  532 (551)
                      |||||++|...|..+.+.|
T Consensus       526 iLriD~li~l~~~~~~~~~  544 (545)
T KOG0360         526 ILRIDDLIKLLPELQVAVE  544 (545)
T ss_pred             HCCHHHHHHCCCCCCCCCC
T ss_conf             4022034312866455678


No 36 
>KOG0362 consensus
Probab=100.00  E-value=0  Score=538.82  Aligned_cols=472  Identities=21%  Similarity=0.269  Sum_probs=378.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      -++|.-.|+.||+.+++++||+|||.||+||++++.|++++|||.+||+++++++||    |||+|+++++.|+++.|||
T Consensus        24 ~e~~v~~ni~a~~ela~~~rs~yGpng~nK~vvnh~~k~~~TndaatIlrelev~HP----aakllv~a~~~q~~~iGDg   99 (537)
T KOG0362          24 EEEAVIRNIAAVRELANVIRSAYGPNGRNKMVVNHLGKTFVTNDAATILRELEVEHP----AAKLLVEATQMQEEEIGDG   99 (537)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEEEECCCHHHHHHHHHCCCC----HHHHHHHHHHHHHHHHCCC
T ss_conf             328899899999999998886118877650111044507870876999887642583----8999999999888760887


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHH-----HHHHHHHHH
Q ss_conf             6679999999999999999769889999998986447777676532221-2760242221225553-----345688899
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKK-VGSREEIIQVATISAN-----GDREIGEKI  162 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~-i~~~~~L~~vA~tS~~-----~~~~l~~li  162 (551)
                      |+.||+|++|||++|++||+.|++|..|++||+.|.+++++.|+++... +.+.++...+..++.+     ++..+++++
T Consensus       100 tnfvvvla~~LLe~Ae~li~~Gl~~~ei~~gy~~A~~~~~e~l~~lv~~~~~d~~d~~~~~rs~i~skq~~~ed~l~~lV  179 (537)
T KOG0362         100 TNFVVVLAGALLEQAEELIRMGLTPAEISEGYETATKEALEILPELVVQSIGDLEDKEWALRSVIMSKQYGNEDFLTKLV  179 (537)
T ss_pred             CEEEEHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             24750068999999999997599879999999999999987748988876014347688989988776326188999999


Q ss_pred             HHHHHHCCCC------CHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHH
Q ss_conf             9999842432------0001101465520333302320011224765423310134441131022013564410011146
Q gi|254780849|r  163 AYAMEQIGPH------GIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPI  236 (551)
Q Consensus       163 ~~A~~~i~~d------~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~  236 (551)
                      ++|+..+.+.      ++..++-.+++..+|.++.|++|++..         ++.+++-++++|+++.||++..++..+.
T Consensus       180 a~ac~si~p~~~FnvdnIrVcKi~Gg~l~~S~Vv~GmVfkr~~---------eG~v~~ak~arvAvf~cP~d~~~TEtkg  250 (537)
T KOG0362         180 AKACVSILPLMSFNVDNIRVCKILGGGLEDSCVVCGMVFKRDP---------EGEVKSAKDARVAVFACPFDIAQTETKG  250 (537)
T ss_pred             HHHHHHHCCCCCCCCCCEEEEEEECCCCCCCEEEEEEEECCCC---------CCCCCCCCCCEEEEEECCCCCCCCCCCC
T ss_conf             9999865455665546447999842775555015877733666---------7760202133257874688755456764


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHH----------------HHHHHHHHHHHHCCCCC
Q ss_conf             77531116212222233358888653121356832322221230567----------------66998865211011233
Q gi|254780849|r  237 LESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGD----------------RRKEVLRDIAAVVGATV  300 (551)
Q Consensus       237 le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~----------------~~~~~L~dia~~tGa~v  300 (551)
                      -..+.+. .++.-++.. ++..+..++..+...|.++++.. +.+++                ..+.+|++++...||+.
T Consensus       251 TvLi~~A-~el~~FSKg-Ee~lle~~vk~Ia~~gvkViV~~-g~v~em~Lhflnky~ImVlqi~Sk~eLrrlcrtvGA~~  327 (537)
T KOG0362         251 TVLLKNA-KELLNFSKG-EEALLEEQVKAIADAGVKVIVSG-GKVDEMTLHFLNKYKIMVLQINSKFDLRRLCRTVGATA  327 (537)
T ss_pred             EEEECCC-HHHHHHCCC-CHHHHHHHHHHHHHCCCEEEEEC-CCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             0410585-766642536-48899999999985598099855-73216664454355589999243766999999708855


Q ss_pred             CCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCC
Q ss_conf             21010632211222224410278980467301377421777765433467765413563111101222102334432125
Q gi|254780849|r  301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLE  380 (551)
Q Consensus       301 i~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~  380 (551)
                      .+     ++.......||.|.+|...+..-+.+                        ..|.+      -+. .+.++|++
T Consensus       328 l~-----rl~~P~~~~lG~~d~V~~~EiG~~~v------------------------~vF~~------e~~-~~~~~TvV  371 (537)
T KOG0362         328 LP-----RLFPPAPEELGYCDSVSTQEIGDTLV------------------------VVFRW------EST-GTRVATVV  371 (537)
T ss_pred             CH-----HCCCCCCCCCCCCCEEEEEECCCCEE------------------------EEEEE------CCC-CCCEEEEE
T ss_conf             03-----20589874455122366654078237------------------------99751------367-87226999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6765314689898877889999875402-781055537999999997450899--6899999999999999999999977
Q gi|254780849|r  381 VGDVTEAALGEKKDRYQDSLDATRAASD-EGIVPGGGIALVRAAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNA  457 (551)
Q Consensus       381 vgg~t~~~~~E~~r~~~DAl~v~~~~~~-~~vvpGGGa~e~~ls~~l~~~~~~--~~~~~~i~~fa~AL~~ip~~La~Na  457 (551)
                      +||+|+..+|+.||+++|++++.+...+ ++++||+|++|+++++.|..++..  +-.|++|+.||+||+.+|++|++||
T Consensus       372 LRgst~s~LDd~ERAVddgV~tyK~l~~d~rLlpGagateieLak~i~~~g~~~~Gl~q~Aik~fa~Ale~~PktlaEna  451 (537)
T KOG0362         372 LRGATQSILDDAERAVDDGVNTYKALCSDSRLLPGAGATEIELAKQISSRGATLPGLKQLAIKKFAEALEVLPKTLAENA  451 (537)
T ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCHHHHHHC
T ss_conf             80650555778999988768775100357750567761699999998875035788302579999887235647678765


Q ss_pred             CCCHHHHHHHHHHCCC--CCEEEECCCC-CEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             9998999999981689--8665886687-2721388398370478999999999999986609999715877888899
Q gi|254780849|r  458 GDESELIVSKIQESKT--ANYGYNAQKS-VFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP  532 (551)
Q Consensus       458 G~d~~~~i~~l~~~~~--~~~G~d~~~g-~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~~~~p  532 (551)
                      |+++.+++++|.+.|.  ++.|+|+..+ ...|+.+.||||-+.+|.++|+.|+|+|+++|++|+||+++|...|..|
T Consensus       452 gl~~~ev~a~ly~~h~~g~~~g~di~~e~~~~d~~~~~i~D~~~~K~~a~k~at~aa~tvl~vDqiimak~aggp~~~  529 (537)
T KOG0362         452 GLAVTEVIAKLYAVHQGGKNLGMDIEAEGGTIDVREEGIWDTLAVKAQAIKLATEAALTVLTVDQIIMAKKAGGPKPP  529 (537)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHCHHHHHHHHHHHHHHHHHHHHEEEEHHHEEEECCCCCCCCC
T ss_conf             985899999998765078752134303655247455131788888999999998655404442024671456899999


No 37 
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit; InterPro: IPR012716    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT beta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=100.00  E-value=0  Score=517.58  Aligned_cols=469  Identities=23%  Similarity=0.331  Sum_probs=372.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCC--CCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             989999999999999999773678986359888589--983883208887776034785225788999999986625518
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSF--GAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSG   86 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~--g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~G   86 (551)
                      ++.||...+.|+.++.|++|+||||+||||++....  ..+.+||||+||||++.+.+|    +||.|+++|+.||+|+|
T Consensus        12 ~e~arl~~fvGaia~GdlvkstlGPkGmdk~l~s~~~~~~~~vtndGatilk~i~~dn~----aakvlv~~s~~qd~evG   87 (519)
T TIGR02341        12 AENARLSSFVGAIAVGDLVKSTLGPKGMDKILLSASSEASIVVTNDGATILKSIGLDNP----AAKVLVDISKVQDDEVG   87 (519)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCEEEECCCHHHHHHCCCCCH----HHHHHHHHHHHHCCCCC
T ss_conf             33335777776787766776304841135675227877615785051023332034504----67888776542011247


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHH------
Q ss_conf             86667999999999999999976988999999898644777767653222127-----6024222122555334------
Q gi|254780849|r   87 DGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVG-----SREEIIQVATISANGD------  155 (551)
Q Consensus        87 DGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~-----~~~~L~~vA~tS~~~~------  155 (551)
                      ||||||+||++|||++|+.|+.+.+||+.|+.|||.|...+.+.|..-++.-.     -+++|.++|.|+++++      
T Consensus        88 dGttsv~vl~aell~~ae~l~~~~ihPq~ii~Gyr~a~~~a~~~l~~~~~~~~~~~~~~r~dl~~ia~ttl~sk~l~~~k  167 (519)
T TIGR02341        88 DGTTSVTVLAAELLREAEKLVNQKIHPQTIIEGYREATKAALEALKKSAVDNSSDEVKFREDLLNIARTTLSSKILSQDK  167 (519)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             74046788889999999999860257157888899999999998876542034322589999999976666667764115


Q ss_pred             HHHHHHHHHHHHHCC----CCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             568889999998424----3200011014655203333023200112247654233101344411310220135644100
Q gi|254780849|r  156 REIGEKIAYAMEQIG----PHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       156 ~~l~~li~~A~~~i~----~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                      .+++.+.++|+..+.    .+.+-.++.-+|...++.+=+|..+++.+-        ...|+.+++++|++.|..++..+
T Consensus       168 ~hf~~la~~avlrlkGs~nl~~i~iik~lGG~l~~s~ldeGf~l~k~~G--------~~~P~~~e~a~iliant~~dtdk  239 (519)
T TIGR02341       168 DHFAQLAVDAVLRLKGSTNLEAIQIIKKLGGKLDDSYLDEGFLLEKKIG--------VNQPKRIENAKILIANTALDTDK  239 (519)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHCCCCHHHHHCCC--------CCCCCHHHCCEEEEECCCCCCCC
T ss_conf             6899999988876316541466676777267300122123112210015--------44541110020355404556340


Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHH----------------HHHHHHH
Q ss_conf             111467753111621222223335888865312135683232222123056766998----------------8652110
Q gi|254780849|r  232 PLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEV----------------LRDIAAV  295 (551)
Q Consensus       232 ~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~----------------L~dia~~  295 (551)
                      -.+.....-.+....+.-+ +..++++++..+....+.++++. +..+.++++..+.                .++++..
T Consensus       240 vk~fG~~~~vd~~~k~a~l-e~ae~~kmk~kv~~i~~~~~n~f-inrqliy~yPeqlf~~~~~~~iehadf~G~erl~lv  317 (519)
T TIGR02341       240 VKVFGSRVRVDSTAKLAEL-EKAEKEKMKEKVEKILKHNINVF-INRQLIYNYPEQLFADAGVMAIEHADFEGVERLALV  317 (519)
T ss_pred             EEEEEEEEEECCHHHHHHH-HHHHHHHHHHHHHHHHHCCCCEE-EEHHHHHHCHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             6777424665213678888-89999999999999986376314-303466513477874200132111032213444421


Q ss_pred             CCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCC
Q ss_conf             11233210106322112222244102789804673013774217777654334677654135631111012221023344
Q gi|254780849|r  296 VGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGG  375 (551)
Q Consensus       296 tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~  375 (551)
                      +|+.+++     .++......||.|..+..     .+++                   |+....|.        ..-.|-
T Consensus       318 ~GGe~~s-----tfd~P~~~~lG~C~~iee-----~~~G-------------------e~~~~~fs--------G~~~Ge  360 (519)
T TIGR02341       318 TGGEIVS-----TFDEPELVKLGSCDLIEE-----IMIG-------------------EDKLLKFS--------GVKLGE  360 (519)
T ss_pred             CCCCEEE-----ECCCCCCCCCCCCCHHHH-----HEEC-------------------CHHHHHHH--------CCCCCC
T ss_conf             0661355-----137854201367420022-----0005-------------------21344431--------323366


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             321256765314689898877889999875-40278105553799999999745089--968999999999999999999
Q gi|254780849|r  376 VAVLEVGDVTEAALGEKKDRYQDSLDATRA-ASDEGIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQ  452 (551)
Q Consensus       376 ~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~-~~~~~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~  452 (551)
                      .|+|++||+|++++||.||++||||+++.. ..+.+.+.||||+|+-+++.+...+.  .+++.+++++|++||...|.+
T Consensus       361 aC~~vlrGat~q~lde~er~lhdal~vl~~~~~~~~~~~G~G~~e~~m~~a~~~~a~~~~Gk~~~a~~~f~~al~~lPti  440 (519)
T TIGR02341       361 ACTIVLRGATQQILDEAERSLHDALCVLSQTVKESRTVLGGGCAEMLMAKAVEEEAQKVPGKKALAVEAFAKALRQLPTI  440 (519)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHCEEECCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             02576613135677666777999999998765420012147478899999999986303540355588999999741045


Q ss_pred             HHHHCCCCHHHHHHHHHHCCCC---CEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9997799989999999816898---665886687272138839837047899999999999998660999971587788
Q gi|254780849|r  453 IIKNAGDESELIVSKIQESKTA---NYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE  528 (551)
Q Consensus       453 La~NaG~d~~~~i~~l~~~~~~---~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~~~  528 (551)
                      |+.|||+|+.+++++|++.|..   +.|+|+..|++.||...||+|++.+|+..+.+|.|++..|||+|+||++.|+.+
T Consensus       441 ~~dnaG~ds~~lv~~l~~~~~~G~~~~Gld~~~G~~~d~~~~G~~e~~~~k~~~~~s~~e~~~~~lrvd~i~~a~Pr~~  519 (519)
T TIGR02341       441 LADNAGFDSAELVAKLRAAHYNGNSTMGLDLEEGEIADMRKLGIVESYKLKRAVVSSAAEAAEVLLRVDNIIKAAPRKR  519 (519)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             2202688668999999888634752145001466245667652477898889998521146788888778873267789


No 38 
>KOG0359 consensus
Probab=100.00  E-value=0  Score=505.25  Aligned_cols=468  Identities=20%  Similarity=0.290  Sum_probs=385.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             89999999999999999773678986359888589983883208887776034785225788999999986625518866
Q gi|254780849|r   10 TAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGT   89 (551)
Q Consensus        10 ~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGT   89 (551)
                      ..|...|+.+++.+.++++|.|||+|.-||++++.|++.+|+||.+.+++|+++||+    |-++-.+|.+||+..||||
T Consensus        16 ~~al~~nis~a~glq~Vl~snlGPkgt~kmlvsgagdIkltkdgnvLl~EmQiqhPT----a~~IakaatAqdd~tGDGt   91 (520)
T KOG0359          16 QAALALNISAAIGLQSVLVLNLGPKGTEKMLVSGAGDIKLAKDGNVLLKEMQIQHPT----ASLIAKVATAQDDITGDGT   91 (520)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCEEEEECHHHHHHHHHHCCCH----HHHHHHHHHHHHCCCCCCC
T ss_conf             131100257766778877514698623554258756369973325787888634714----8889988875112357875


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH------HHHHHHHH
Q ss_conf             679999999999999999769889999998986447777676532221276024222122555334------56888999
Q gi|254780849|r   90 TTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGD------REIGEKIA  163 (551)
Q Consensus        90 TtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~------~~l~~li~  163 (551)
                      ||+|+|.||||++|..+|..|+||.+|++||+.|.++++++|+..++++ +++.|..+|.||++.|      ..++..++
T Consensus        92 ts~V~ligEllkqa~~~i~eGlhprii~~gfe~a~~~~l~~L~k~~~~~-~~~~L~~va~tsl~TKv~a~la~~lt~~vv  170 (520)
T KOG0359          92 TSVVLLIGELLKQADRYISEGLHPRIITEGFEAAKNKALEFLEKVSREV-DRETLKDVARTSLRTKVHAELADVLTPIVV  170 (520)
T ss_pred             CEEEEEEHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             2189970888877998865479952210178898898886652135355-589999988876247356777768689987


Q ss_pred             HHHHHCC-------CCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHH
Q ss_conf             9998424-------320001101465520333302320011224765423310134441131022013564410011146
Q gi|254780849|r  164 YAMEQIG-------PHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPI  236 (551)
Q Consensus       164 ~A~~~i~-------~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~  236 (551)
                      +|+..+-       ...+..+++-..+..|+.+++|.++|+|-.||       .||++++|++||++|..||++++.++.
T Consensus       171 ~aVL~i~~~~~~iDl~MvEim~Mqh~s~~dT~lv~GLvLDHG~RHp-------dMp~~~e~a~iL~~NvSLEYEK~EINs  243 (520)
T KOG0359         171 DSVLCIRRQEEPIDLFMVEIMEMQHKSLHDTSLVQGLVLDHGARHP-------DMPRRVEDAYILICNVSLEYEKPEINS  243 (520)
T ss_pred             HHHHEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCC-------CCCCCHHCCEEEEEECCCCCCCCCCCC
T ss_conf             6651110567774336887766056754666776400003789886-------651000020788741131014555665


Q ss_pred             --HHHHHHCCCHHHHHHHHHHHHHHHHHCC---C------CCCCCEE----ECCCCCCHHHHHH--HHHHHHHHHHCCCC
Q ss_conf             --7753111621222223335888865312---1------3568323----2222123056766--99886521101123
Q gi|254780849|r  237 --LESATQSGRPLCIIAEDVEGDALATLVV---N------RVRCGLP----VLAVKAPAFGDRR--KEVLRDIAAVVGAT  299 (551)
Q Consensus       237 --le~~~~~~~~l~ii~~~~e~~~l~~lv~---n------~~k~gi~----v~~vk~~~~~~~~--~~~L~dia~~tGa~  299 (551)
                        ..........|......|..+....++.   .      +.++|++    .+..+.++++.+|  +..+|++..+||+.
T Consensus       244 GffYsta~ere~L~~~ER~Fi~~r~~kiielk~~vc~fvvinqKGIDP~SLd~lA~~gIlALRRAKRRNmERL~lacGG~  323 (520)
T KOG0359         244 GFFYSTAEEREVLVLAERKFIDQRVRKIIELKRKVCEFVVINQKGIDPTSLDSLAKSGILALRRAKRRNMERLVLACGGE  323 (520)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             20004446789999999999998999999876410216885146779876102211353888777653078898761540


Q ss_pred             CCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCC
Q ss_conf             32101063221122222441027898046730137742177776543346776541356311110122210233443212
Q gi|254780849|r  300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVL  379 (551)
Q Consensus       300 vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI  379 (551)
                      .++     .++++++++||+|+.++...                              ...+++.|.|.+ . ..+.+||
T Consensus       324 a~n-----svdDLtpd~LG~aGlVye~t------------------------------lGEEKfTFIE~~-~-~P~SvTi  366 (520)
T KOG0359         324 AVN-----SVDDLTPDYLGYAGLVYEYT------------------------------LGEEKFTFIEKC-N-NPSSVTI  366 (520)
T ss_pred             EEC-----CCCCCCHHHCCCCCEEEEEE------------------------------CCCEEEEEEECC-C-CCCCEEE
T ss_conf             004-----40118966615111367764------------------------------065336764227-9-9870699


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5676531468989887788999987540278-10555379999999974508--99689999999999999999999997
Q gi|254780849|r  380 EVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSVKG--DNEDQCAGIEIVRKALSYPCRQIIKN  456 (551)
Q Consensus       380 ~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~~~--~~~~~~~~i~~fa~AL~~ip~~La~N  456 (551)
                      ++.|||++.+...+++++|+|++++++++++ ++||+|+.|.+++++|+..-  ..++-++|+++|++||.++|++|++|
T Consensus       367 LikGpnkht~tQikDAirDgLrav~ntled~~~i~Gaga~eva~~~~lr~~k~~vkgra~~g~~afa~AlLvipKtLa~N  446 (520)
T KOG0359         367 LIKGPNKHTITQIKDAIRDGLRAVKNTLEDKCGIPGAGAFEVALGRHLRESKKSVKGRAYLGVKAFANALLVIPKTLAKN  446 (520)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98478621189888887667999998762325325851788999999997530367356662799986553234999875


Q ss_pred             CCCCHHHHHHHHHHCCCCC-EEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7999899999998168986-658866872721388398370478999999999999986609999715877
Q gi|254780849|r  457 AGDESELIVSKIQESKTAN-YGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK  526 (551)
Q Consensus       457 aG~d~~~~i~~l~~~~~~~-~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~~  526 (551)
                      +|+|+.+.+.+|...|... +|+|+.+|+..+....||||.+.|+++.|.+++-+|+.+|.+|+|+++..+
T Consensus       447 sg~D~qe~l~~l~~e~~~~~~g~dl~~G~~~~~~~~gi~Dny~V~~~~l~s~~viA~nlLlvDEi~rAG~~  517 (520)
T KOG0359         447 SGLDEQETLVSLKKEHEVTLRGLDLFRGEECDPSRKGIYDNYSVKKQLLRSEAVIATNLLLVDEIIRAGMS  517 (520)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             38765778988787654433053100278555555055312788887740317999988879999973563


No 39 
>KOG0364 consensus
Probab=100.00  E-value=0  Score=500.48  Aligned_cols=465  Identities=20%  Similarity=0.290  Sum_probs=362.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98999999999999999977367898635988858998388320888777603478522578899999998662551886
Q gi|254780849|r    9 GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDG   88 (551)
Q Consensus         9 g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDG   88 (551)
                      |..+...|+.|+++++|+++|+|||+.|.||+.++.|.+..||||..||++|++.||    +|+-++++|++||+|+|||
T Consensus        17 g~kvq~~ni~aak~iadvirtclgp~am~kmlld~~g~i~~tndg~ailrei~Vahp----aaksmiel~rtqdeevgdg   92 (527)
T KOG0364          17 GRKVQLGNIQAAKAIADVIRTCLGPRAMLKMLLDPMGGIVLTNDGNAILREIDVAHP----AAKSMIELSRTQDEEVGDG   92 (527)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCEEEECCCHHHHHHHHHCCC----CHHHHHHHHHCCCCCCCCC
T ss_conf             530334522567788789998518698899862668846993582787777765372----1353764342155524687


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHH------HHHHHH
Q ss_conf             66799999999999999997698899999989864477776765322212760--2422212255533------456888
Q gi|254780849|r   89 TTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSR--EEIIQVATISANG------DREIGE  160 (551)
Q Consensus        89 TTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~--~~L~~vA~tS~~~------~~~l~~  160 (551)
                      ||||++||+|+|.++..++++++||+.|++.|.+|++.++..++..+.+++.+  ..++.+...+...      +..+++
T Consensus        93 ttsvi~lagE~L~~~~~~l~~~~Hp~~i~ka~~~aled~~~~~~~~~~~~d~~~~~km~~vi~~~v~tk~~~~~~~~~~~  172 (527)
T KOG0364          93 TTSVIILAGEMLNVAEPFLEEGIHPTVIIKAYIKALEDNIRALDKISIPVDVKDQAKMLRVINSSVGTKFNSRWSDLICN  172 (527)
T ss_pred             CEEEEEEHHHHHHHCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             41342104877620103332375669999999999999999887621667763289997456654203324333101023


Q ss_pred             HHHHHHHHCCCC-C-------HHHHCCC-CCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             999999842432-0-------0011014-655203333023200112247654233101344411310220135644100
Q gi|254780849|r  161 KIAYAMEQIGPH-G-------IITIDQA-KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQ  231 (551)
Q Consensus       161 li~~A~~~i~~d-~-------vi~i~~~-~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~  231 (551)
                      +..+|+++++.+ |       ...+++. +|...++.+++|+.+.+...||       +|...++||+|.++|++|++.+
T Consensus       173 lal~avk~V~~~~g~e~dik~y~kveKvpgg~l~~s~vl~Gv~~nkdv~Hp-------kmrr~IenprivLlD~~Leykk  245 (527)
T KOG0364         173 LALDAVKTVGVENGREIDIKRYAKVEKVPGGLLEDSCVLKGVMINKDVTHP-------KMRRAIENPRIVLLDCPLEYKK  245 (527)
T ss_pred             HHHHHHHHHHHCCCCEECHHHHCCCCCCCCCCCCCCCEECCEEECCCCCCH-------HHHHHHHCCCEEEECCCCCCCC
T ss_conf             789888776404684420566434565676301344101146631225768-------8888752672799537866788


Q ss_pred             CCHHH-HHHHHH--CCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHH----------------HHH
Q ss_conf             11146-775311--16212222233358888653121356832322221230567669988----------------652
Q gi|254780849|r  232 PLLPI-LESATQ--SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVL----------------RDI  292 (551)
Q Consensus       232 ~~~~~-le~~~~--~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L----------------~di  292 (551)
                      -.-.. .+....  .++-|.+ .    ++....+-..++. -.+.+++...++.|.+++||                .++
T Consensus       246 GeSqtnve~~~eed~~r~Lqi-e----ee~v~~mc~~Ii~-v~pDlVitekG~sdla~hyl~k~~iT~~rr~rKtDn~ri  319 (527)
T KOG0364         246 GESQTNVEIVKEEDFTRILQI-E----EEQVQAMCEVIIA-VKPDLVITEKGVSDLAQHYLLKANITAIRRLRKTDNNRI  319 (527)
T ss_pred             CCCCCCEEEEECHHHHHHHHH-H----HHHHHHHHHHHHE-ECCCEEEECCCHHHHHHHHHHHCCCHHHHHHHCCCCCHH
T ss_conf             765201355300257888774-3----9999999889870-156379823543489999987557255533201666413


Q ss_pred             HHHCCCCCCCHHHCCCCCCCCCCCCCCEE-EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC
Q ss_conf             11011233210106322112222244102-78980467301377421777765433467765413563111101222102
Q gi|254780849|r  293 AAVVGATVISEEIGLKLEKATIADLGSAK-KVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAK  371 (551)
Q Consensus       293 a~~tGa~vi~~~~~~~l~~~~~~~LG~~~-~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~  371 (551)
                      +.+|||++++     +.+++...+.|.-. -..+.+.                        -++..       -+-..|+
T Consensus       320 a~acga~iv~-----rpedl~e~dvGt~agLf~~kK~------------------------gdeyf-------~f~~~Ck  363 (527)
T KOG0364         320 ARACGARIVN-----RPEDLPERDVGTGAGLFEVKKI------------------------GDEYF-------TFFTDCK  363 (527)
T ss_pred             HHHCCCEECC-----CHHHCCHHCCCCCCCEEEEECC------------------------CCHHH-------HHHHHCC
T ss_conf             2430761216-----8455741005766440223204------------------------75455-------3334037


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHH
Q ss_conf             334432125676531468989887788999987540-27810555379999999974508--996899999999999999
Q gi|254780849|r  372 LAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAAS-DEGIVPGGGIALVRAAQALSVKG--DNEDQCAGIEIVRKALSY  448 (551)
Q Consensus       372 l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~-~~~vvpGGGa~e~~ls~~l~~~~--~~~~~~~~i~~fa~AL~~  448 (551)
                      -+ +.|+|+.||+|..+++|++|.+.||+.+.|+.+ ++.++|||||+||.+|+.|++++  .++-++.-+.+.|.||+.
T Consensus       364 ~p-kaCtillrg~skdil~e~ernlqda~~varn~ii~PklvPGGGAtEMAvs~~L~qksa~~~GVekwPY~Ava~AlEv  442 (527)
T KOG0364         364 EP-KACTILLRGPSKDILNEVERNLQDAMGVARNVIINPKLVPGGGATEMAVSHELRQKSALMTGVEKWPYGAVAGALEV  442 (527)
T ss_pred             CC-CCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHCCCHHHHHCCCEE
T ss_conf             87-41389941672667789998765677778873158721688548889999999988742254220634665157441


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHCCCCC---EEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             999999977999899999998168986---65886687272138839837047899999999999998660999971587
Q gi|254780849|r  449 PCRQIIKNAGDESELIVSKIQESKTAN---YGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP  525 (551)
Q Consensus       449 ip~~La~NaG~d~~~~i~~l~~~~~~~---~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~~~  525 (551)
                      +||+|++|+|-+|+..++.+++.|..+   +|+|..+|.+.||.+.++|+|..+|.+..++|.|+++.+||||+|+..+.
T Consensus       443 iPrtliqncGan~Ir~lTalr~kh~~G~~~~gi~g~tg~iVDm~~~~iwep~~vK~Q~~ktavesa~~LLRIddIvsg~k  522 (527)
T KOG0364         443 IPRTLIQNCGANPIRALTALRAKHKEGQRVWGIDGETGVIVDMVELGIWEPEAVKLQTGKTAVESACLLLRIDDIVSGKK  522 (527)
T ss_pred             CCHHHHHHCCCCHHHHHHHHHHHHCCCCEEECCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEE
T ss_conf             40777764485388999999987457643431167502685311002256055553145279998988886522243012


Q ss_pred             CC
Q ss_conf             78
Q gi|254780849|r  526 KD  527 (551)
Q Consensus       526 ~~  527 (551)
                      ..
T Consensus       523 k~  524 (527)
T KOG0364         523 KR  524 (527)
T ss_pred             EC
T ss_conf             13


No 40 
>KOG0357 consensus
Probab=100.00  E-value=0  Score=460.03  Aligned_cols=369  Identities=23%  Similarity=0.278  Sum_probs=314.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             66343798999999999999999977367898635988858998388320888777603478522578899999998662
Q gi|254780849|r    3 AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTE   82 (551)
Q Consensus         3 ~~~~~~g~~a~~~~~~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd   82 (551)
                      -|+..+|.+|.++++.+.++++++++|||||+|+|||++++.|++++||||         .|+    .++++...|.+||
T Consensus        20 ~~~Ri~G~ea~Ks~I~agkaVA~~lrtSLGPkGlDK~l~~pdgditvtndg---------d~~----IakLmv~LS~sqd   86 (400)
T KOG0357          20 RKDRLFGLDAVKSHIGAAKAVARILRTSLGPKGLDKMLVSPDGDITVTNDG---------VHQ----IAKLIVILSKSQD   86 (400)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECC---------CHH----HHHHHHHHCCCCH
T ss_conf             774146788765225788899999886127654432102688884044156---------047----8888888605522


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55188666799999999999999997698899999989864477776765322212760242221225553345688899
Q gi|254780849|r   83 DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKI  162 (551)
Q Consensus        83 ~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~~~L~~vA~tS~~~~~~l~~li  162 (551)
                      .++|||||.+|+|++.+++++.+|+..|+||..|.+||+.+...|+++|++.+.+++                       
T Consensus        87 ~eIgdGtTgVvvLa~alleqa~~li~~~ihpiki~~g~e~~~~~av~~l~~i~~~~e-----------------------  143 (400)
T KOG0357          87 DEIGDGTTGVVVLAGALLEQAHELIDRGIHPIKIAQGYEKAKVVAVEHLDEISDPFE-----------------------  143 (400)
T ss_pred             HHHCCCCCCCEEECCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-----------------------
T ss_conf             330468765078335666768862114564067777656677766546665424334-----------------------


Q ss_pred             HHHHHHCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99998424320001101465520333302320011224765423310134441131022013564410011146775311
Q gi|254780849|r  163 AYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ  242 (551)
Q Consensus       163 ~~A~~~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~~  242 (551)
                                                                                            +....+++.+
T Consensus       144 ----------------------------------------------------------------------f~emi~~vK~  153 (400)
T KOG0357         144 ----------------------------------------------------------------------FEEMIQQIKE  153 (400)
T ss_pred             ----------------------------------------------------------------------HHHHHHHHHH
T ss_conf             ----------------------------------------------------------------------9999999985


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEE
Q ss_conf             16212222233358888653121356832322221230567669988652110112332101063221122222441027
Q gi|254780849|r  243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKK  322 (551)
Q Consensus       243 ~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~  322 (551)
                      .+..+.|.++.|+.++...|..|.+-.      |+|-+-     ..++-+|++||+++++     ++++++.+.||++..
T Consensus       154 ~ga~l~icqwgfddeanhll~~n~lpa------vrwVGG-----pEiEliAiaT~grIVp-----rF~eL~~~kLG~agl  217 (400)
T KOG0357         154 TGANLAICQWGFDDEANHLLLQNNLPA------VRWVGG-----PEIELIAIATGGRIVP-----RFSELTAEKLGFAGL  217 (400)
T ss_pred             HCCCEEEEECCCCCHHHHHHHHCCCCC------EEECCC-----CCEEEEEEECCCEEEC-----CHHHHCHHHCCCCCE
T ss_conf             078279986366722456776458872------365078-----5347898613975403-----476638766264315


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89804673013774217777654334677654135631111012221023344321256765314689898877889999
Q gi|254780849|r  323 VVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDA  402 (551)
Q Consensus       323 v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v  402 (551)
                      |......|+                            -+|....|. |+.++.+++ .+||.+.++++|.+|++||||||
T Consensus       218 VrE~sfgtt----------------------------kdkmlviEq-c~nskaVTi-fvRg~Nkmii~EakrslhdalCv  267 (400)
T KOG0357         218 VREISFGTT----------------------------KDKMLVIEQ-CKNSKAVTI-FVRGGNKMIIEEAKRSLHDALCV  267 (400)
T ss_pred             EEEEECCCC----------------------------CCEEEEEEE-CCCCCEEEE-EEECCCCEEHHHHHHHHHHHHHH
T ss_conf             888731655----------------------------651899880-688733899-99459610188888776534899


Q ss_pred             HHHHC-CCCCCCCCCHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC----CCC
Q ss_conf             87540-278105553799999999745089--96899999999999999999999977999899999998168----986
Q gi|254780849|r  403 TRAAS-DEGIVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESK----TAN  475 (551)
Q Consensus       403 ~~~~~-~~~vvpGGGa~e~~ls~~l~~~~~--~~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~~~----~~~  475 (551)
                      +|+.+ ++++|+|||++|+.+|..+++.+.  .+.+|+++.+||+||++||..||+|||++|++.++++++.+    ...
T Consensus       268 irnlird~rivYgGGaaEiscslav~~ead~~~g~eqya~rafa~ale~ipmalaensgl~pi~~ls~~ka~q~~~~~~~  347 (400)
T KOG0357         268 IRNLIRDNRVVYGGGAAEISCALAVSQEADKIPGIEQYAFRAFADALESIPMALAENSGLDPIETLSDVKARQVKEMNPA  347 (400)
T ss_pred             HHHHHHCCEEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             98775047068658457744566766764048718889888888777413234554168883034667678898732754


Q ss_pred             EEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             658866872721388398370478999999999999986609999715
Q gi|254780849|r  476 YGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD  523 (551)
Q Consensus       476 ~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~iI~~  523 (551)
                      +|+|+....-.||++.+|+|++..|++.+..||+++.|||+||++++.
T Consensus       348 lGidcl~~G~nDMk~~~vie~l~~KkqQi~laTQ~vrMiLKiddv~~~  395 (400)
T KOG0357         348 LGIDCLHKGTNDMKEQHVIETLIGKKQQISLATQMVRMILKIDDVRKP  395 (400)
T ss_pred             CCCCHHCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCEECC
T ss_conf             475012037514655110787640688999999999882000332068


No 41 
>cd03333 chaperonin_like chaperonin_like superfamily. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. There are 2 main chaperonin groups. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). The symmetry of type II is eight- or nine-fold and they are found in archea (thermosome), thermophilic bacteria (TF55) and  in the eukaryotic cytosol (CTT). Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. This superfamily also contains related domains from Fab1-like phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinases that only contain the intermediate and apical domains.
Probab=99.94  E-value=7.8e-27  Score=195.17  Aligned_cols=197  Identities=34%  Similarity=0.466  Sum_probs=153.4

Q ss_pred             CHHHHHHHHHHHH-----HHHHHHHHHHHHHHHCCCC------CHHHHCCC-CCCCCHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             0242221225553-----3456888999999842432------00011014-6552033330232001122476542331
Q gi|254780849|r  141 REEIIQVATISAN-----GDREIGEKIAYAMEQIGPH------GIITIDQA-KTATTEVRVVQGMQIDRGYISPYFVTST  208 (551)
Q Consensus       141 ~~~L~~vA~tS~~-----~~~~l~~li~~A~~~i~~d------~vi~i~~~-~~~~~d~~li~G~~id~g~~~~~fi~~~  208 (551)
                      ++.|.++|+||++     +++.+++++++|+..++++      +.+.+++. +|+..|+++++|++|++++.||      
T Consensus         1 ~~~l~~va~tal~sK~~~~~~~l~~lvv~A~~~v~~~~~~~~~~~I~I~k~~Ggs~~ds~li~Gi~~~k~~~~~------   74 (209)
T cd03333           1 RELLLQVATTSLNSKLSSWDDFLGKLVVDAVLKVGPDNRMDDLGVIKVEKIPGGSLEDSELVVGVVFDKGYASP------   74 (209)
T ss_pred             CHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEEEEECCCCCC------
T ss_conf             97799999987552310308899999999999860556778888389998369982024999648994356789------


Q ss_pred             HHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHH
Q ss_conf             01344411310220135644100111467753111621222223335888865312135683232222123056766998
Q gi|254780849|r  209 ERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEV  288 (551)
Q Consensus       209 ~~~~~~~~n~~Ili~d~~Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~  288 (551)
                       .||++++||+|++++++|++                 +++..+.+++.++..+..+      ++++++.     .+++.
T Consensus        75 -~m~~~~~n~kIli~~~~le~-----------------vii~~~~I~~~a~~~l~~~------~I~~v~~-----~~~~~  125 (209)
T cd03333          75 -YMPKRLENAKILLLDCPLEY-----------------VVIAEKGIDDLALHYLAKA------GIMAVRR-----VKKED  125 (209)
T ss_pred             -CCCEECCCCEEEEECCCCCE-----------------EEEECCCCCHHHHHHHHHC------CCEEEEE-----CCHHH
T ss_conf             -98416147469998588219-----------------9998887679999999985------9699994-----24888


Q ss_pred             HHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHH
Q ss_conf             86521101123321010632211222224410278980467301377421777765433467765413563111101222
Q gi|254780849|r  289 LRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKER  368 (551)
Q Consensus       289 L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~er  368 (551)
                      |+|+|.+|||++++.     ++.++.++||+|.++.+.+...                              .+..+++.
T Consensus       126 l~~ia~~tGa~ii~~-----~~~~~~~~lG~~~~v~~~~~~~------------------------------~~~~~~~~  170 (209)
T cd03333         126 LERIARATGATIVSS-----LEDLTPEDLGTAELVEETKIGE------------------------------EKLTFIEG  170 (209)
T ss_pred             HHHHHHHHCCEEECC-----HHHCCHHHCCEEEEEEEEEECC------------------------------EEEEEEEE
T ss_conf             899999729999823-----2129987898107999999888------------------------------48999995


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             10233443212567653146898988778899998754027
Q gi|254780849|r  369 LAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDE  409 (551)
Q Consensus       369 ~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~~~~  409 (551)
                      +.  .++++||++||+|+++++|++|++||||+|+++++++
T Consensus       171 ~~--~~~~~TI~lrG~t~~~l~E~~r~l~Dal~vv~~ai~e  209 (209)
T cd03333         171 CK--GGKAATILLRGATEVELDEVKRSLHDALCAVRAAVEE  209 (209)
T ss_pred             CC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             68--9998999987999899999999999999999999539


No 42 
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1.  Fab1p is important for vacuole size regulation, presumably by modulating PtdIns(3,5)P2 effector activity. In the human homolog p235/PIKfyve deletion of this domain leads to loss of catalytic activity. However no exact function this domain has been defined. In general, chaperonins are involved in productive folding of proteins.
Probab=99.85  E-value=8.3e-22  Score=162.03  Aligned_cols=211  Identities=17%  Similarity=0.154  Sum_probs=144.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCC----------CHHHHC-CCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHH
Q ss_conf             33456888999999842432----------000110-1465520333302320011224765423310134441131022
Q gi|254780849|r  153 NGDREIGEKIAYAMEQIGPH----------GIITID-QAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYIL  221 (551)
Q Consensus       153 ~~~~~l~~li~~A~~~i~~d----------~vi~i~-~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Il  221 (551)
                      .+...+++++.+|+..+.++          ..+.|+ ..+|+..||++++|++|+|+..|+       +||++++||+|+
T Consensus        18 ~W~d~l~~l~~~a~~~v~~~~~~g~~~di~~yVkI~ki~GG~~~dS~lv~Gvv~~K~~~h~-------~Mp~~i~npkIl   90 (261)
T cd03334          18 SWLDILLPLVWKAASNVKPDVRAGDDMDIRQYVKIKKIPGGSPSDSEVVDGVVFTKNVAHK-------RMPSKIKNPRIL   90 (261)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCEEEEEECCCCHHHCEEEEEEEEECCCCCC-------CCCCCCCCCEEE
T ss_conf             6999999999999985250657997326326079999379897775788759982777886-------798725586599


Q ss_pred             HCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHH----------------
Q ss_conf             0135644100111467753111621222223335888865312135683232222123056766----------------
Q gi|254780849|r  222 IYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRR----------------  285 (551)
Q Consensus       222 i~d~~Le~~~~~~~~le~~~~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~----------------  285 (551)
                      +++++|++.+....+.    +. .++  .  .-|++.+..++..+...|.++++++. ++.+.+                
T Consensus        91 ll~~~Le~~k~e~~~~----~~-~~~--~--~qE~~~l~~~v~~I~~~g~nVVl~~k-~I~d~A~~~l~k~gI~~vr~vk  160 (261)
T cd03334          91 LLQGPLEYQRVENKLL----SL-DPV--I--LQEKEYLKNLVSRIVALRPDVILVEK-SVSRIAQDLLLEAGITLVLNVK  160 (261)
T ss_pred             EEECCCCCCCCCCCHH----HH-HHH--H--HHHHHHHHHHHHHHHHHCCCEEEECC-CCCHHHHHHHHHCCCEEEECCC
T ss_conf             9805424441434453----09-999--9--99999999999999960999999889-7798999999987996890389


Q ss_pred             HHHHHHHHHHCCCCCCCHHHCCCCCC-CCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99886521101123321010632211-22222441027898046730137742177776543346776541356311110
Q gi|254780849|r  286 KEVLRDIAAVVGATVISEEIGLKLEK-ATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDK  364 (551)
Q Consensus       286 ~~~L~dia~~tGa~vi~~~~~~~l~~-~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~  364 (551)
                      +++|+++|.+|||++++.     +++ .+...||+|..+.+.+-...                         ........
T Consensus       161 ~~dl~rlar~tGa~iv~s-----~d~l~~~~~LG~c~~f~v~~i~~e-------------------------~~~~Kt~~  210 (261)
T cd03334         161 PSVLERISRCTGADIISS-----MDDLLTSPKLGTCESFRVRTYVEE-------------------------HGRSKTLM  210 (261)
T ss_pred             HHHHHHHHHHHCCEEECC-----HHHCCCCCCCCEEEEEEEEEEECC-------------------------CCCCEEEE
T ss_conf             999999999869903346-----777468653845126999999525-------------------------77733699


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCC
Q ss_conf             122210233443212567653146898988778899998754-027810
Q gi|254780849|r  365 LKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAA-SDEGIV  412 (551)
Q Consensus       365 ~~er~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~~~~-~~~~vv  412 (551)
                      +++.+. -+ ..|||++||+|+.+++|++|++|||+|++++. ++..++
T Consensus       211 ~~egc~-~~-~~~TIlLRG~~~~~L~evkR~l~dal~vv~nl~lE~~~l  257 (261)
T cd03334         211 FFEGCP-KE-LGCTILLRGGDLEELKKVKRVVEFMVFAAYHLKLETSFL  257 (261)
T ss_pred             EEECCC-CC-CEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             996789-98-677999987988799999999999999999999889875


No 43 
>KOG0230 consensus
Probab=98.29  E-value=4.6e-06  Score=58.26  Aligned_cols=214  Identities=17%  Similarity=0.228  Sum_probs=122.6

Q ss_pred             HHHHHHHHHHHHHCCCC----------CHHHHC-CCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHCC
Q ss_conf             56888999999842432----------000110-1465520333302320011224765423310134441131022013
Q gi|254780849|r  156 REIGEKIAYAMEQIGPH----------GIITID-QAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYD  224 (551)
Q Consensus       156 ~~l~~li~~A~~~i~~d----------~vi~i~-~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~Ili~d  224 (551)
                      +.+..++-+|...+.++          +.+.++ ..+|...++++++|+++.|...+       ..|..++++|+|+++-
T Consensus       335 ~ii~~L~~eaa~~~kp~~~~~~~md~~~YVkvK~I~~g~~~dS~vi~Gvv~sKn~~~-------k~M~~~~e~prilll~  407 (1598)
T KOG0230         335 DIITSLCWEAANLLKPDTDSGGLMDPGNYVKVKCVAGGSRVDSEVIKGVVCSKNVAH-------KRMATKYENPRILLLG  407 (1598)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCCCEEEEEEEEECCHHH-------HHHHHHCCCCCEEEEE
T ss_conf             999999999998548675667775722326899834887424545667885041234-------3321104688369984


Q ss_pred             CCCCCCCCCH------HHHHHHHHC----------CCHHHH-HHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHH
Q ss_conf             5644100111------467753111----------621222-22333588886531213568323222212305676699
Q gi|254780849|r  225 KKISALQPLL------PILESATQS----------GRPLCI-IAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKE  287 (551)
Q Consensus       225 ~~Le~~~~~~------~~le~~~~~----------~~~l~i-i~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~  287 (551)
                      ++|++.+-.-      ..+.+..+.          .+|-++ +...+...+...|.    ..++.++       -+..++
T Consensus       408 g~leyqrisn~lsS~etvlqqE~e~lk~~varI~s~~p~vllVeksVS~~aqe~L~----~k~I~lv-------lnvK~s  476 (1598)
T KOG0230         408 GPLEYQRISNQLSSIETVLQQEKEYLKKVVARIESLRPDVLLVEKSVSRIAQELLL----DKGISLV-------LNVKRS  476 (1598)
T ss_pred             CCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHH----CCCEEEE-------EECCHH
T ss_conf             44001334065131478876189999999999870388769983007799999863----1572799-------842389


Q ss_pred             HHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             88652110112332101063221122222441027898046730137742177776543346776541356311110122
Q gi|254780849|r  288 VLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE  367 (551)
Q Consensus       288 ~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~~~ie~~~~~~~~~~~~e  367 (551)
                      .|++|+..|||.++.     +++.++.-.||.|....+.+-                        .++. ...-.-.+++
T Consensus       477 ~leRIsR~tga~I~~-----siDslt~~klg~C~~F~v~~~------------------------~e~h-k~sKTlmffe  526 (1598)
T KOG0230         477 LLERISRCTGADIVP-----SVDSLTSQKLGYCELFRVENY------------------------VEEH-KPSKTLMFFE  526 (1598)
T ss_pred             HHHHHHHHHCCCEEC-----CHHHHHCCCCCCCCCHHHHHH------------------------HHCC-CCHHHHHHHH
T ss_conf             999999885473231-----255542022577743766532------------------------3103-5224668860


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH-HHHCCCCCCCCCCHHH
Q ss_conf             210233443212567653146898988778899998-7540278105553799
Q gi|254780849|r  368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDAT-RAASDEGIVPGGGIAL  419 (551)
Q Consensus       368 r~~~l~g~~~tI~vgg~t~~~~~E~~r~~~DAl~v~-~~~~~~~vvpGGGa~e  419 (551)
                      .|.+-.|  |||+.+|+...++.++++-+.=.+-+. ..+++..++.--|+..
T Consensus       527 gc~~~lG--~TiLLrG~~~~eLkkVK~Vvq~~v~aay~l~LE~SflaDe~asi  577 (1598)
T KOG0230         527 GCPKPLG--CTILLRGDSLEELKKVKHVVQYLVFAAYHLALETSFLADEGASI  577 (1598)
T ss_pred             CCCCCCC--CEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             6997778--56872477789998778899999999999998642320247763


No 44 
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit; InterPro: IPR012718    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT epsilon chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=94.30  E-value=0.014  Score=35.23  Aligned_cols=157  Identities=17%  Similarity=0.258  Sum_probs=82.2

Q ss_pred             HCCCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCHH---HHCCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             42432000110146552033330232001122476542331013444113102---201356441001114677531116
Q gi|254780849|r  168 QIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYI---LIYDKKISALQPLLPILESATQSG  244 (551)
Q Consensus       168 ~i~~d~vi~i~~~~~~~~d~~li~G~~id~g~~~~~fi~~~~~~~~~~~n~~I---li~d~~Le~~~~~~~~le~~~~~~  244 (551)
                      .+.+++|+.|-....-..+.+||+-               .++.-..+++-+.   .++|+.+++|+..-.+.......+
T Consensus       185 eiav~AVL~VaD~eRrDvdfdLIk~---------------~~kvGg~L~dt~LI~Gi~idKdfSHPQM~K~v~d~~g~dg  249 (541)
T TIGR02343       185 EIAVDAVLAVADLERRDVDFDLIKV---------------EGKVGGSLEDTKLIKGIIIDKDFSHPQMPKEVKDKEGSDG  249 (541)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHEEE---------------CCCCCCCCCCCCCCCCEEEECCCCCCCCCCEECCCCCCCC
T ss_conf             9999988743055565565120120---------------4343885332113300586225787888641346667773


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHH---HHHHHHH---HHHHHCCCCCCCHHHCCCCCCCC---CC
Q ss_conf             212222233358888653121356832322221230567---6699886---52110112332101063221122---22
Q gi|254780849|r  245 RPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGD---RRKEVLR---DIAAVVGATVISEEIGLKLEKAT---IA  315 (551)
Q Consensus       245 ~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~---~~~~~L~---dia~~tGa~vi~~~~~~~l~~~~---~~  315 (551)
                      ..+.|+...||+-+.++      |..++|-.++  -|..   +.+++|+   +-+.-+||+++-|+||.+-+...   ..
T Consensus       250 akiAiLtCPFEPPKpKT------KH~l~i~~~e--~Y~~L~~yE~~kF~EMi~~~K~~Ga~~v~CQWGFDDEANhLLl~~  321 (541)
T TIGR02343       250 AKIAILTCPFEPPKPKT------KHKLDISSVE--EYKKLQKYEQQKFKEMIDDIKKSGANIVICQWGFDDEANHLLLQN  321 (541)
T ss_pred             CEEEEEECCCCCCCCCC------CCEEECCCHH--HHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHC
T ss_conf             13878537464226885------4314207878--999999998899888899986424869996378856788898747


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             24410278980467301377421777765433467
Q gi|254780849|r  316 DLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQ  350 (551)
Q Consensus       316 ~LG~~~~v~i~~~~~~ii~~~~~~~~i~~~i~~l~  350 (551)
                      +|.-+.+|-..+-+..-+...|   +|.+|.+++.
T Consensus       322 ~LPAVRWVgG~elEliAi~TgG---rIVpRF~eL~  353 (541)
T TIGR02343       322 DLPAVRWVGGQELELIAIATGG---RIVPRFEELS  353 (541)
T ss_pred             CCCEEEECCCCCEEHHEECCCC---CCCCCCCCCC
T ss_conf             8972874175520021012288---1511513378


No 45 
>PTZ00212 T-complex protein 1 beta subunit; Provisional
Probab=92.21  E-value=0.084  Score=30.19  Aligned_cols=174  Identities=10%  Similarity=0.058  Sum_probs=88.7

Q ss_pred             HHHHHHHHHHHH------HHHHHHHCCCCCCCEEEEECCCC-----CEEEEEHHHHHHHHHCCCCC------C---HHHH
Q ss_conf             999999999999------99997736789863598885899-----83883208887776034785------2---2578
Q gi|254780849|r   11 AARDAIAYGVNT------LAEAVKCTLGPKGRCVIIGNSFG-----APRVTKDGVTVAKSISFKNH------F---HEVG   70 (551)
Q Consensus        11 ~a~~~~~~~~~~------ia~~i~ttlGP~G~~kmi~~~~g-----~~~iTnDGaTIlk~l~~~hp------~---~~~~   70 (551)
                      +|-.++..+++.      .--++.+++|+...-...+.+.|     ++.+-|=||.+++++--..-      +   --++
T Consensus        29 ~g~~~ladaV~tTLGPkG~nk~i~~~~~~~~~G~~~ITnDGvTIak~i~le~p~Akll~e~a~~q~~~aGDGTTTavvLa  108 (533)
T PTZ00212         29 VGAIAVADLVKTTLGPKGMDKILQPMNEGPRSQHVTVTNDGATILKSVWVDNPAAKILIDISKTQDDEVGDGTTSVVVLA  108 (533)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCEEEECCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             99999998873887988785999836777888983796429999887518598999999999977888678768999999


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH----HHHCC-----CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999999866255188666799999999999999----99769-----8899999989864477776765322212760
Q gi|254780849|r   71 ARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRK----YVTAG-----LNPMDIKRGIDLAVQEVVEYLKANHKKVGSR  141 (551)
Q Consensus        71 akll~~~a~~qd~~~GDGTTtvvvLa~eLL~~a~~----Li~~g-----ihP~~Ii~G~~~a~~~al~~L~~~s~~i~~~  141 (551)
                      ..|+.++-+..    =.|..-..+.-|  ++.|.+    .+..-     .+|....           +.|...+...-  
T Consensus       109 ~~ll~~~~~ll----~~G~~p~~I~~G--~~~A~~~~~~~L~~~s~~~~~~~~~~~-----------~~l~~va~ts~--  169 (533)
T PTZ00212        109 GELLRNAEKLL----DQKIHPQTIIEG--YRMALDVARKALEESAFDHDADSKKFH-----------EDLLNIARTTL--  169 (533)
T ss_pred             HHHHHHHHHHH----HCCCCHHHHHHH--HHHHHHHHHHHHHHHCCCCCCCHHHHH-----------HHHHHHHHHHH--
T ss_conf             99999999999----879987999999--999999999999985255678567779-----------99999999887--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC----CHHHHCCCCCCCCHHHHHCCCCCCCC--CCCCCCCCCC
Q ss_conf             2422212255533456888999999842432----00011014655203333023200112--2476542331
Q gi|254780849|r  142 EEIIQVATISANGDREIGEKIAYAMEQIGPH----GIITIDQAKTATTEVRVVQGMQIDRG--YISPYFVTST  208 (551)
Q Consensus       142 ~~L~~vA~tS~~~~~~l~~li~~A~~~i~~d----~vi~i~~~~~~~~d~~li~G~~id~g--~~~~~fi~~~  208 (551)
                           ..+...+.++.+++++++|+..+..+    .+..++..+++..++.+++|+++++.  +..|.++.+.
T Consensus       170 -----~ski~~~~~~~~~~l~~~av~~~~~~~~~d~i~i~k~~Gg~~~~s~l~~G~vl~~~~~~~~~~~~~n~  237 (533)
T PTZ00212        170 -----SSKLLTVEKDHFAKLAVDAVLRLKGSGNLDLIQIIKKPGGTLRDSYLEDGFILEKRIGIGQPKRLENA  237 (533)
T ss_pred             -----HHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCEEECCEEEEEEEECCCCCCCCCEECCCH
T ss_conf             -----65888989999999999999751577872248999983978861355554576044566784130568


No 46 
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
Probab=88.38  E-value=0.3  Score=26.55  Aligned_cols=79  Identities=15%  Similarity=0.248  Sum_probs=49.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCC----HHHHCCCCCCCCHHHHHCCCCCCCCC--CCCCCCCCCHHH--HHHHCCCHH
Q ss_conf             2555334568889999998424320----00110146552033330232001122--476542331013--444113102
Q gi|254780849|r  149 TISANGDREIGEKIAYAMEQIGPHG----IITIDQAKTATTEVRVVQGMQIDRGY--ISPYFVTSTERM--TAEVENPYI  220 (551)
Q Consensus       149 ~tS~~~~~~l~~li~~A~~~i~~d~----vi~i~~~~~~~~d~~li~G~~id~g~--~~~~fi~~~~~~--~~~~~n~~I  220 (551)
                      +...+.++.+++++++|+..++.+.    +..++..++..+++.+++|+++++.+  ..|.++.+..-.  .+.++.+++
T Consensus       160 Ki~~~~~~~~~~l~~~av~~v~~~~~~~~i~i~~~~gg~~~~~~l~~g~i~d~~~~~~~~~~~~n~~ill~~~~le~~~~  239 (517)
T cd03336         160 KILTQDKEHFAELAVDAVLRLKGSGNLDAIQIIKKLGGSLKDSYLDEGFLLDKKIGVNQPKRIENAKILIANTPMDTDKI  239 (517)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEECCEEEEEEEECCEEEECCCCCCCCEEECCHHHHCCCCCCCHHHH
T ss_conf             88899999999999999975168886036999997187886316772578703225678535226343101676541466


Q ss_pred             HHCCCCC
Q ss_conf             2013564
Q gi|254780849|r  221 LIYDKKI  227 (551)
Q Consensus       221 li~d~~L  227 (551)
                      .+++..+
T Consensus       240 ~~~~~~i  246 (517)
T cd03336         240 KIFGAKV  246 (517)
T ss_pred             HHHCCHH
T ss_conf             5301121


No 47 
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases; InterPro: IPR005958   This entry describes tyrosine aminotransferase (2.6.1.5 from EC) as found in animals and Trypanosoma cruzi (Euglenozoa). It is the first enzyme of a pathway of tyrosine degradation via homogentisate.  L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate. Several plant enzyme designated as probable tyrosine aminotransferases are very closely related to an experimentally demonstrated nicotianamine aminotransferase, an enzyme in a siderophore (iron uptake chelator) biosynthesis pathway are included in this family. ; GO: 0008483 transaminase activity, 0030170 pyridoxal phosphate binding, 0006519 amino acid and derivative metabolic process.
Probab=77.13  E-value=2.4  Score=20.65  Aligned_cols=105  Identities=20%  Similarity=0.247  Sum_probs=65.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99999999977367898635988858998388320888777603478522578899999998662551886667999999
Q gi|254780849|r   18 YGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQ   97 (551)
Q Consensus        18 ~~~~~ia~~i~ttlGP~G~~kmi~~~~g~~~iTnDGaTIlk~l~~~hp~~~~~akll~~~a~~qd~~~GDGTTtvvvLa~   97 (551)
                      .-+|++++.++.+..|-+--+||-=+.||++       +-..+.-. +   -+.+=+.++.+|+.-.             
T Consensus        19 ~~iR~i~~~~~~~~~~~~~Kp~i~L~~GDPs-------~f~~lrT~-~---ea~~Av~~al~Sg~~N-------------   74 (424)
T TIGR01265        19 VPIRKIVDSLKVSPNPEDVKPVIPLSHGDPS-------VFGNLRTA-P---EAEEAVKDALRSGKFN-------------   74 (424)
T ss_pred             CCHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCC-H---HHHHHHHHHHHCCCCC-------------
T ss_conf             4289999984137888888300158887888-------77788887-8---9999999998347856-------------


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-------HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999976988999999898644777767653-------2221276024222122555334568889999998
Q gi|254780849|r   98 AIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKA-------NHKKVGSREEIIQVATISANGDREIGEKIAYAME  167 (551)
Q Consensus        98 eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~-------~s~~i~~~~~L~~vA~tS~~~~~~l~~li~~A~~  167 (551)
                                  ||-|+   -|+..|.+.+-+++..       ...+++ .+   .|..||-.+.  ==+++..|+.
T Consensus        75 ------------gYap~---~G~~~AR~AvA~y~~~sfvhn~~~~~~l~-a~---DV~ltsGCsq--AIe~~I~aLA  130 (424)
T TIGR01265        75 ------------GYAPS---VGALAAREAVAEYLSNSFVHNQRLPGKLS-AD---DVVLTSGCSQ--AIEIVIEALA  130 (424)
T ss_pred             ------------CCCCC---CCHHHHHHHHHHHHHCCEEECCCCCCCCC-CC---CEEEECCCHH--HHHHHHHHHH
T ss_conf             ------------76643---68678889999996622212578888757-66---4488477226--8999999972


No 48 
>COG3962 Acetolactate synthase [Amino acid transport and metabolism]
Probab=74.40  E-value=1.5  Score=22.01  Aligned_cols=13  Identities=38%  Similarity=0.537  Sum_probs=6.6

Q ss_pred             HHHHHHCCCHHHH
Q ss_conf             6625518866679
Q gi|254780849|r   80 NTEDSSGDGTTTA   92 (551)
Q Consensus        80 ~qd~~~GDGTTtv   92 (551)
                      .|-+..+|||-|+
T Consensus       130 QQ~E~~~d~~it~  142 (617)
T COG3962         130 QQLEQFGDGTITT  142 (617)
T ss_pred             HHHHCCCCCCEEC
T ss_conf             8653035672220


No 49 
>TIGR01500 sepiapter_red sepiapterin reductase; InterPro: IPR006393   These sequences represent sepiapterin reductase, a member of the short chain dehydrogenase/reductase family. The enzyme catalyzes the last step in the biosynthesis of tetrahydrobiopterin. A similar enzyme in Bacillus cereus was isolated for its ability to convert benzil to (S)-benzoin, a property sepiapterin reductase also shares. ; GO: 0004757 sepiapterin reductase activity, 0006729 tetrahydrobiopterin biosynthetic process.
Probab=68.44  E-value=6.2  Score=17.86  Aligned_cols=86  Identities=14%  Similarity=0.127  Sum_probs=43.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEE-CCCCCEEEEEHHHHHHHH-HCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             9999999999999773678986359888-589983883208887776-03478522578899999998662551886667
Q gi|254780849|r   14 DAIAYGVNTLAEAVKCTLGPKGRCVIIG-NSFGAPRVTKDGVTVAKS-ISFKNHFHEVGARMIRDVATNTEDSSGDGTTT   91 (551)
Q Consensus        14 ~~~~~~~~~ia~~i~ttlGP~G~~kmi~-~~~g~~~iTnDGaTIlk~-l~~~hp~~~~~akll~~~a~~qd~~~GDGTTt   91 (551)
                      ..+..++..+..+++-+-+|++..|+|+ +..|.+-=+.=+     + .++.|-            - ...+-+---+||
T Consensus        68 l~~~~~~e~~~k~l~e~~~~~~~~r~~~inNaGtlgd~sk~-----~d~~~sD~------------~-~~q~y~~~N~tS  129 (267)
T TIGR01500        68 LEAAKDVEDLLKALRESIKKEEYERLLLINNAGTLGDVSKR-----EDKDLSDS------------K-NVQKYYDLNVTS  129 (267)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCH-----HCCCCCCH------------H-HHHHHHHHHHHH
T ss_conf             12200179999999843794554048888168640001310-----00235522------------6-775355434788


Q ss_pred             HHHHHHHHHHHHHHHHHC-CCCHHHHHH
Q ss_conf             999999999999999976-988999999
Q gi|254780849|r   92 ATCLAQAIYNEGRKYVTA-GLNPMDIKR  118 (551)
Q Consensus        92 vvvLa~eLL~~a~~Li~~-gihP~~Ii~  118 (551)
                      .|+|++++++.-.++=.+ |+ |.+|++
T Consensus       130 ~~~lts~~~k~fk~~Gs~yg~-~~tvVN  156 (267)
T TIGR01500       130 AVVLTSELLKKFKELGSQYGL-EKTVVN  156 (267)
T ss_pred             HHHHHHHHHHHHHHCCCCCCC-CCEEEE
T ss_conf             999989999873313775676-500440


No 50 
>TIGR00784 citMHS citrate transporter; InterPro: IPR014738   This entry consists of known and predicted citrate transporters. It includes two characterised citrate/proton symporters, CitM and CitH, from Bacillus subtilis . Both of these proteins couple the uptake of citrate in complex with a divalent cation to the uptake of protons, but differ in their metal ion specificities. CitM transports citrate in complex with Mg(2+), Ni(2+), Mn(2+), Co(2+), and Zn2(+), while CitH transports citrate in complex with Ca(2+), Ba(2+), and Sr(2+). A third paralog, YraO, exists in B. subtilis, but the function of this protein is not known. .
Probab=63.46  E-value=9.1  Score=16.77  Aligned_cols=33  Identities=33%  Similarity=0.438  Sum_probs=25.5

Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             551886667999999999999999976988999999
Q gi|254780849|r   83 DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKR  118 (551)
Q Consensus        83 ~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~  118 (551)
                      .-=||||||=-+=.+++|== ++++  |++|....-
T Consensus       110 aLDGDGtTTYMIT~sAMLPL-Ykrl--Gmnp~vlAg  142 (439)
T TIGR00784       110 ALDGDGTTTYMITVSAMLPL-YKRL--GMNPLVLAG  142 (439)
T ss_pred             HHCCCCCHHHHHHHHHHHHH-HHHH--CCCHHHHHH
T ss_conf             61698942689999887678-8872--551789999


No 51 
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type; InterPro: IPR012846   Two groups of proteins form acetolactate from two molecules of pyruvate. The type of acetolactate synthase described in this entry also catalyzes the formation of acetohydroxybutyrate from pyruvate and 2-oxobutyrate, an early step in the branched chain amino acid biosynthesis; it is therefore also termed acetohydroxyacid synthase. In bacteria, this catalytic chain is associated with a smaller regulatory chain in an alpha2/beta2 heterotetramer. Acetolactate synthase is a thiamine pyrophosphate enzyme. In this type, FAD and Mg++ are also found. Several isozymes of this enzyme are found in E. coli K12, one of which contains a frameshift in the large subunit gene and is not expressed.; GO: 0000287 magnesium ion binding, 0003984 acetolactate synthase activity, 0030976 thiamin pyrophosphate binding, 0050660 FAD binding, 0009082 branched chain family amino acid biosynthetic process.
Probab=56.27  E-value=7.8  Score=17.23  Aligned_cols=14  Identities=21%  Similarity=0.351  Sum_probs=5.2

Q ss_pred             CCCCHHHHHHHCCC
Q ss_conf             23310134441131
Q gi|254780849|r  205 VTSTERMTAEVENP  218 (551)
Q Consensus       205 i~~~~~~~~~~~n~  218 (551)
                      +.+.+.+|..++.+
T Consensus       132 V~~~edlp~~~~~A  145 (593)
T TIGR00118       132 VKSAEDLPRIIKEA  145 (593)
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             25878999999987


No 52 
>PRK12705 hypothetical protein; Provisional
Probab=53.03  E-value=11  Score=16.36  Aligned_cols=12  Identities=50%  Similarity=0.512  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             799999999745
Q gi|254780849|r  417 IALVRAAQALSV  428 (551)
Q Consensus       417 a~e~~ls~~l~~  428 (551)
                      +.+..++-+|+.
T Consensus       381 a~lV~aADaiSa  392 (485)
T PRK12705        381 SVLVQIADALSA  392 (485)
T ss_pred             HHHHHHHHHHHC
T ss_conf             899999999850


No 53 
>PRK06555 pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated
Probab=49.19  E-value=5.4  Score=18.25  Aligned_cols=52  Identities=23%  Similarity=0.285  Sum_probs=33.1

Q ss_pred             HCCCH-HHHHHHHHHHHHHHHHH--------HHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             18866-67999999999999999--------976988999999898644777767653222
Q gi|254780849|r   85 SGDGT-TTATCLAQAIYNEGRKY--------VTAGLNPMDIKRGIDLAVQEVVEYLKANHK  136 (551)
Q Consensus        85 ~GDGT-TtvvvLa~eLL~~a~~L--------i~~gihP~~Ii~G~~~a~~~al~~L~~~s~  136 (551)
                      -|||| +++--|+.++-++.+.+        |++.+.++.-.-||.-|.+.+.+.++....
T Consensus       120 GGDgS~~~A~~La~~~~~~~~~i~VVGIPKTIDNDl~~tD~TfGF~TAv~~a~~aid~l~~  180 (403)
T PRK06555        120 GGDDTNTTAADLAAYLAANGYDLTVVGLPKTIDNDVVPIRQSLGAWTAAEQGARFFDNVVN  180 (403)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8805999999999999973999528961455217887768886858899999999999998


No 54 
>PRK11595 gluconate periplasmic binding protein; Provisional
Probab=49.05  E-value=15  Score=15.37  Aligned_cols=16  Identities=31%  Similarity=0.356  Sum_probs=10.3

Q ss_pred             CCHHHHHHHHHHHHCC
Q ss_conf             5379999999974508
Q gi|254780849|r  415 GGIALVRAAQALSVKG  430 (551)
Q Consensus       415 GGa~e~~ls~~l~~~~  430 (551)
                      =|++.-++++.|.+.+
T Consensus       199 TGaTl~~~a~~L~~aG  214 (227)
T PRK11595        199 TGSTVAEIAQLLLRNG  214 (227)
T ss_pred             CHHHHHHHHHHHHHHC
T ss_conf             3999999999999809


No 55 
>TIGR02483 PFK_mixed phosphofructokinase; InterPro: IPR012829    Members of this family that are characterised, save one, are phosphofructokinases dependent on pyrophosphate (2.7.1.90 from EC) rather than ATP (2.7.1.11 from EC). The exception is one of three phosphofructokinases from Streptomyces coelicolor. Family members are both bacterial and archaeal.; GO: 0005524 ATP binding, 0008443 phosphofructokinase activity, 0006002 fructose 6-phosphate metabolic process, 0006096 glycolysis.
Probab=47.41  E-value=12  Score=15.97  Aligned_cols=22  Identities=27%  Similarity=0.659  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             5688899999984243200011
Q gi|254780849|r  156 REIGEKIAYAMEQIGPHGIITI  177 (551)
Q Consensus       156 ~~l~~li~~A~~~i~~d~vi~i  177 (551)
                      ..+++.+..-+++.+.|+.|-|
T Consensus        92 ~DvSd~~~~n~~~~GlDAlIaI  113 (339)
T TIGR02483        92 RDVSDKIVANLKELGLDALIAI  113 (339)
T ss_pred             EECCHHHHHHHHHCCCEEEEEE
T ss_conf             7320899998996498189986


No 56 
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]
Probab=45.54  E-value=8.7  Score=16.89  Aligned_cols=75  Identities=25%  Similarity=0.363  Sum_probs=47.9

Q ss_pred             HHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHH-HHHHHHHHHHCCCCCCCHH-HCCCCCCCCCCCCCCEEEEEEE
Q ss_conf             3335888865312135683232222123056766-9988652110112332101-0632211222224410278980
Q gi|254780849|r  252 EDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRR-KEVLRDIAAVVGATVISEE-IGLKLEKATIADLGSAKKVVMS  326 (551)
Q Consensus       252 ~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~-~~~L~dia~~tGa~vi~~~-~~~~l~~~~~~~LG~~~~v~i~  326 (551)
                      |-...++....+...++.|+++++..-+.+.|.. .+-|+.++..+|+++.--. ..--++-+...-+|....|.++
T Consensus        66 EaAS~~Av~e~~~~~L~~g~d~iV~SVGALad~~l~erl~~lak~~~~rv~~pSGAiGGlD~l~aar~g~i~~V~lt  142 (255)
T COG1712          66 EAASPEAVREYVPKILKAGIDVIVMSVGALADEGLRERLRELAKCGGARVYLPSGAIGGLDALAAARVGGIEEVVLT  142 (255)
T ss_pred             EECCHHHHHHHHHHHHHCCCCEEEEECHHCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCCEEEEEEE
T ss_conf             30788999998699996599889995122068679999999985389479933764012788887432770279997


No 57 
>KOG1301 consensus
Probab=44.65  E-value=18  Score=14.79  Aligned_cols=115  Identities=14%  Similarity=0.193  Sum_probs=54.4

Q ss_pred             HHHHHHHHHHHHHHHH----HHHHCCCCCCCEEEE-ECCCCCEEEEE---------HHHHHHH-------------HHCC
Q ss_conf             8999999999999999----977367898635988-85899838832---------0888777-------------6034
Q gi|254780849|r   10 TAARDAIAYGVNTLAE----AVKCTLGPKGRCVII-GNSFGAPRVTK---------DGVTVAK-------------SISF   62 (551)
Q Consensus        10 ~~a~~~~~~~~~~ia~----~i~ttlGP~G~~kmi-~~~~g~~~iTn---------DGaTIlk-------------~l~~   62 (551)
                      ..-|.+-+.+++.+-+    ..+...+|.---|++ .|..|.-+|+-         -|+|+--             .+=|
T Consensus        10 ~slRe~Qi~al~~mlnLN~~~~~~~~~~epvWKVLI~Dr~gq~iISpll~VkeLRe~GvTlH~li~~dR~Pi~DVPAVYF   89 (621)
T KOG1301          10 ASLRERQIVALKKMLNLNKPVNKNGTAAEPVWKVLILDRFGQDIISPLLRVKELREHGITLHLLITSDRDPIPDVPAVYF   89 (621)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCCCHHHCCCCCHHHHHHCCCEEEEEECCCCCCCCCCCEEEE
T ss_conf             35789999999999973677552345667753899971355423235312799996294799862366687889974799


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH-HHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             7852257889999999866255188666799999999999999-9976988999999898644777
Q gi|254780849|r   63 KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRK-YVTAGLNPMDIKRGIDLAVQEV  127 (551)
Q Consensus        63 ~hp~~~~~akll~~~a~~qd~~~GDGTTtvvvLa~eLL~~a~~-Li~~gihP~~Ii~G~~~a~~~a  127 (551)
                      .-|++.=.-+++-++++.-.+++-=.=+|.  +.-.+|++-.. ..+.|- ...|.+=|..-++.+
T Consensus        90 V~Pt~eNid~i~~Dl~~~lY~~~ylNF~Ss--i~R~~LE~lA~~a~~~g~-v~~I~kVyDQYlnFI  152 (621)
T KOG1301          90 VSPTEENIDRIIQDLSKGLYDSYYLNFISS--ISRSLLEDLASAASETGA-VLQIHKVYDQYLNFI  152 (621)
T ss_pred             ECCCHHHHHHHHHHHHHHHHHHHEEECCCC--CCHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHHE
T ss_conf             677267699999999876655640301352--668889999998863255-787999998672212


No 58 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such..
Probab=44.38  E-value=15  Score=15.36  Aligned_cols=12  Identities=17%  Similarity=0.180  Sum_probs=4.2

Q ss_pred             CHHHHHHHHHHH
Q ss_conf             305676699886
Q gi|254780849|r  279 PAFGDRRKEVLR  290 (551)
Q Consensus       279 ~~~~~~~~~~L~  290 (551)
                      +|.|..--+.++
T Consensus       161 GGVGSI~iQLAR  172 (338)
T TIGR02817       161 GGVGSILIQLAR  172 (338)
T ss_pred             CCHHHHHHHHHH
T ss_conf             517899999999


No 59 
>PRK13890 conjugal transfer protein TrbA; Provisional
Probab=44.19  E-value=18  Score=14.86  Aligned_cols=31  Identities=16%  Similarity=0.275  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999999999999999977999899999998
Q gi|254780849|r  438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQ  469 (551)
Q Consensus       438 ~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~  469 (551)
                      .+++.|+||++|.-.|.++..+|+.. +..|-
T Consensus        49 tLe~IA~AL~VPL~~Lle~~dld~~~-l~~l~   79 (119)
T PRK13890         49 VMEDIAQALETPLPLLLESTDLDKEA-LDALA   79 (119)
T ss_pred             HHHHHHHHHCCCHHHHHHHCCCCHHH-HHHHC
T ss_conf             99999999879779987623589899-98873


No 60 
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012691    This entry represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see IPR012689 from INTERPRO). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the members of this family are found in the operon for 4-hydroxyphenylacetic acid catabolism.; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process, 0005737 cytoplasm.
Probab=43.55  E-value=12  Score=16.04  Aligned_cols=21  Identities=19%  Similarity=0.175  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999866099997158
Q gi|254780849|r  504 LQSAGSLAGMMLITEAVVVDA  524 (551)
Q Consensus       504 l~~A~e~a~~iLriD~iI~~~  524 (551)
                      ++.|-|.-=.||...|+|...
T Consensus       227 ~~~A~~LHF~Ll~~N~~~F~D  247 (294)
T TIGR02313       227 IKRARDLHFELLELNDVLFKD  247 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHHC
T ss_conf             346889999998754665406


No 61 
>PRK05469 peptidase T; Provisional
Probab=39.92  E-value=2.2  Score=20.90  Aligned_cols=23  Identities=13%  Similarity=0.401  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             55334568889999998424320
Q gi|254780849|r  151 SANGDREIGEKIAYAMEQIGPHG  173 (551)
Q Consensus       151 S~~~~~~l~~li~~A~~~i~~d~  173 (551)
                      |..+...+++.+.+-++.+|...
T Consensus        27 St~~q~~la~~L~~eL~~lG~~d   49 (405)
T PRK05469         27 STEGQWDLAKLLVEELKELGLSD   49 (405)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98789999999999999769965


No 62 
>KOG3411 consensus
Probab=36.63  E-value=17  Score=14.99  Aligned_cols=41  Identities=12%  Similarity=0.016  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999769889999998986447777676532221
Q gi|254780849|r   97 QAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKK  137 (551)
Q Consensus        97 ~eLL~~a~~Li~~gihP~~Ii~G~~~a~~~al~~L~~~s~~  137 (551)
                      +.|-+----.-+.|++|+..++++....+++++.|+.+-+-
T Consensus        73 g~~~KiYGg~krrGvrPsh~~~as~~i~rkvlQ~Le~~~~v  113 (143)
T KOG3411          73 GALTKIYGGSKRRGVRPSHFCDASGGIARKVLQALEKMGIV  113 (143)
T ss_pred             HHHHHHHCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCCCE
T ss_conf             68999866654489796122034638999999999867964


No 63 
>TIGR00354 polC DNA polymerase II, large subunit DP2; InterPro: IPR004475 This family represents the large subunit, DP2, of a two subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication, 0006308 DNA catabolic process.
Probab=35.95  E-value=7.7  Score=17.25  Aligned_cols=103  Identities=17%  Similarity=0.244  Sum_probs=42.9

Q ss_pred             CCCCC---CCC--HHHHHHHHHHH-----HCCCC--HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH---C--
Q ss_conf             78105---553--79999999974-----50899--68999999999999999999999779998999999981---6--
Q gi|254780849|r  409 EGIVP---GGG--IALVRAAQALS-----VKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQE---S--  471 (551)
Q Consensus       409 ~~vvp---GGG--a~e~~ls~~l~-----~~~~~--~~~~~~i~~fa~AL~~ip~~La~NaG~d~~~~i~~l~~---~--  471 (551)
                      ..+||   ||-  |.++ |+..+.     .+.-+  .-+.+-.|.|-++|+-|       +--...|.+.++..   .  
T Consensus       944 kkfLPdkRGGqMDAPLV-Ltti~DP~EvD~EvHN~D~~~~yPLEfYE~t~~~p-------sPkEv~d~~e~VedRLgkpe 1015 (1173)
T TIGR00354       944 KKFLPDKRGGQMDAPLV-LTTIVDPKEVDDEVHNMDTMERYPLEFYEKTLEFP-------SPKEVKDYVEKVEDRLGKPE 1015 (1173)
T ss_pred             HHHCCCCCCCCCCCHHH-HHCCCCHHHCCCCCCCCHHHHCCCHHHHHHHCCCC-------CCHHHHHHHHHHHHHCCCCC
T ss_conf             65477878797563245-30124703308763660220027534668860787-------85156888888886548812


Q ss_pred             CCCCEEEECCCCCEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             898665886687272138839837047899999999999998660999
Q gi|254780849|r  472 KTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEA  519 (551)
Q Consensus       472 ~~~~~G~d~~~g~i~d~~~~gI~dp~~vk~~al~~A~e~a~~iLriD~  519 (551)
                      +-.+++|.=.|..|..=.+...|=.+..=+.=..+=.++|.+|-=+|+
T Consensus      1016 qy~Gl~ftH~TsrId~GpKvcaYK~L~tM~eKv~sQ~~lA~kIrAvDe 1063 (1173)
T TIGR00354      1016 QYEGLFFTHDTSRIDAGPKVCAYKSLKTMKEKVESQLELAKKIRAVDE 1063 (1173)
T ss_pred             CEECCCEECCCCHHCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             244020203620010587332101440257899999998756200145


No 64 
>TIGR02142 modC_ABC molybdate ABC transporter, ATP-binding protein; InterPro: IPR011868   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulphate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulphate transporter rather than by a specific molybdate transporter.; GO: 0005524 ATP binding, 0015098 molybdate ion transmembrane transporter activity, 0015689 molybdate ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=35.39  E-value=15  Score=15.42  Aligned_cols=44  Identities=25%  Similarity=0.489  Sum_probs=36.0

Q ss_pred             HHHCCCHHHHCCCCCCCCC-----CCHHHHHHHHH-CCCHHHHHHHHHHH
Q ss_conf             4411310220135644100-----11146775311-16212222233358
Q gi|254780849|r  213 AEVENPYILIYDKKISALQ-----PLLPILESATQ-SGRPLCIIAEDVEG  256 (551)
Q Consensus       213 ~~~~n~~Ili~d~~Le~~~-----~~~~~le~~~~-~~~~l~ii~~~~e~  256 (551)
                      .-+.+|..|+.|-||...+     +++|+|+...+ .+.|.+.+..+.++
T Consensus       145 ALLs~P~LLLMDEPLaaLD~~rk~EilPYLerL~~e~~iP~lyVSHsl~E  194 (361)
T TIGR02142       145 ALLSSPRLLLMDEPLAALDEPRKKEILPYLERLHAELKIPILYVSHSLDE  194 (361)
T ss_pred             HHHCCCCHHHCCCCHHHCCHHHHHHHCCHHHHHHHHHCCCEEEEECCHHH
T ss_conf             87418741110466234064446641616767898727988999049799


No 65 
>pfam07526 POX Associated with HOX. The function of this domain is unknown. It is often found in plant proteins associated with pfam00046.
Probab=33.80  E-value=27  Score=13.69  Aligned_cols=42  Identities=29%  Similarity=0.269  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHH
Q ss_conf             468989887788999987540278-105553799999999745
Q gi|254780849|r  387 AALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSV  428 (551)
Q Consensus       387 ~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~  428 (551)
                      .++||++|+++--..=++..+.+- .|.|.|++-.+.+.+|+.
T Consensus        82 sMLdEVdrRY~qY~~QMq~VvsSFe~vaG~GaA~~YTaLAlqa  124 (138)
T pfam07526        82 SMLEEVDRRYRQYYDQMQMVVSSFEAVAGLGAAKPYTALALQA  124 (138)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             9999999999999999999999999987578418899999999


No 66 
>PTZ00009 heat shock 70 kDa protein; Provisional
Probab=33.05  E-value=27  Score=13.70  Aligned_cols=28  Identities=21%  Similarity=0.294  Sum_probs=14.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             3437989999999999999999773678
Q gi|254780849|r    5 DIKLGTAARDAIAYGVNTLAEAVKCTLG   32 (551)
Q Consensus         5 ~~~~g~~a~~~~~~~~~~ia~~i~ttlG   32 (551)
                      ...+|+.|+....+.-....--+|--+|
T Consensus        48 ~rlvG~~Ak~~~~~np~nti~~~KRliG   75 (657)
T PTZ00009         48 ERLIGDAAKNQVARNPENTVFDAKRLIG   75 (657)
T ss_pred             CEEECHHHHHHHHHCCCCEEHHHHHHHC
T ss_conf             7897099998777686235057688748


No 67 
>PRK13381 peptidase T; Provisional
Probab=32.97  E-value=3.7  Score=19.34  Aligned_cols=21  Identities=24%  Similarity=0.495  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCCH
Q ss_conf             345688899999984243200
Q gi|254780849|r  154 GDREIGEKIAYAMEQIGPHGI  174 (551)
Q Consensus       154 ~~~~l~~li~~A~~~i~~d~v  174 (551)
                      +-..+++.+.+-++.+|...+
T Consensus        35 ~q~~la~~L~~eL~~lGl~~v   55 (413)
T PRK13381         35 GQVELAKLLAKELRELGLEDI   55 (413)
T ss_pred             HHHHHHHHHHHHHHHCCCEEE
T ss_conf             799999999999997699368


No 68 
>PTZ00286 6-phospho-1-fructokinase; Provisional
Probab=30.50  E-value=30  Score=13.34  Aligned_cols=22  Identities=23%  Similarity=0.252  Sum_probs=8.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8899999989864477776765
Q gi|254780849|r  111 LNPMDIKRGIDLAVQEVVEYLK  132 (551)
Q Consensus       111 ihP~~Ii~G~~~a~~~al~~L~  132 (551)
                      +.-+.-.-||.-|.+.|.+.++
T Consensus       230 I~~~D~TFGFdTAVe~AteAI~  251 (486)
T PTZ00286        230 LAFSHRTFGFQTAVEQAVNAVR  251 (486)
T ss_pred             CCCHHCCCCHHHHHHHHHHHHH
T ss_conf             4100100240239999999999


No 69 
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244    This entry describes a family of conserved hypothetical proteins with no known function. .
Probab=29.93  E-value=31  Score=13.28  Aligned_cols=74  Identities=16%  Similarity=0.138  Sum_probs=39.4

Q ss_pred             HHHHHHHHHHHHHC---------CCCHHHHH-----HHHHHHHHHHHHHHH---HHHHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999976---------98899999-----989864477776765---32221276024222122555334568
Q gi|254780849|r   96 AQAIYNEGRKYVTA---------GLNPMDIK-----RGIDLAVQEVVEYLK---ANHKKVGSREEIIQVATISANGDREI  158 (551)
Q Consensus        96 a~eLL~~a~~Li~~---------gihP~~Ii-----~G~~~a~~~al~~L~---~~s~~i~~~~~L~~vA~tS~~~~~~l  158 (551)
                      ..|+++...+.++.         |+||..=+     +-|..-.+.+-...+   +..+.-=+.-++.-.|+.+-.   .+
T Consensus        38 ~eEI~~Kv~ea~~~G~tE~~iQGGlnP~~~~nGssl~yy~~l~~~Ik~~~pPyG~~hiHafSp~Ev~f~A~~~~~---~~  114 (331)
T TIGR00423        38 LEEILRKVKEAVAKGATEICIQGGLNPQLDINGSSLEYYEELFRAIKQEFPPYGDVHIHAFSPMEVYFLAKNEGL---SI  114 (331)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCC---CH
T ss_conf             799999999999719827885234278876454149999999999974178965247614686899999986189---78


Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             88999999842432
Q gi|254780849|r  159 GEKIAYAMEQIGPH  172 (551)
Q Consensus       159 ~~li~~A~~~i~~d  172 (551)
                      -..+.+.++.-|.|
T Consensus       115 e~EvL~~LK~aGL~  128 (331)
T TIGR00423       115 EKEVLKRLKKAGLD  128 (331)
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             89999998885035


No 70 
>pfam05501 DUF755 Domain of unknown function (DUF755). This family is predominated by ORFs from Circoviridae. The function of this family remains to be determined.
Probab=29.86  E-value=31  Score=13.27  Aligned_cols=35  Identities=26%  Similarity=0.340  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998662551886667999999999999999
Q gi|254780849|r   72 RMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKY  106 (551)
Q Consensus        72 kll~~~a~~qd~~~GDGTTtvvvLa~eLL~~a~~L  106 (551)
                      |+.++--+.|..-.-.||+-+..|...||+|+.+-
T Consensus        17 K~~tq~~~~~~~~st~gT~d~~~LqkqLlKEc~kT   51 (122)
T pfam05501        17 KLRTQQQKNPNQSSTTGTTDGALLQKQLLKECQKT   51 (122)
T ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             66440566677766788645889999999999989


No 71 
>KOG1588 consensus
Probab=29.84  E-value=30  Score=13.41  Aligned_cols=16  Identities=13%  Similarity=0.034  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999
Q gi|254780849|r  439 IEIVRKALSYPCRQII  454 (551)
Q Consensus       439 i~~fa~AL~~ip~~La  454 (551)
                      ....+.||+.|=+.|.
T Consensus       175 ~~rl~~AleeI~klL~  190 (259)
T KOG1588         175 YARLAYALEEIKKLLV  190 (259)
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999998637


No 72 
>smart00574 POX domain associated with HOX domains.
Probab=28.95  E-value=32  Score=13.17  Aligned_cols=42  Identities=24%  Similarity=0.223  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHH
Q ss_conf             468989887788999987540278-105553799999999745
Q gi|254780849|r  387 AALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALSV  428 (551)
Q Consensus       387 ~~~~E~~r~~~DAl~v~~~~~~~~-vvpGGGa~e~~ls~~l~~  428 (551)
                      .++||++|+++--..=++..+.+- .|.|.|++-.+.+.+|+.
T Consensus        84 sMLdEVdrRY~qY~~QMq~VvsSFe~vAG~gaA~~YTaLAlqt  126 (140)
T smart00574       84 SMLEEVDRRYKHYYEQMQTVVSSFDQAAGLGAAKPYTALALKT  126 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             9999999999999999999999999997578418899999999


No 73 
>PRK13602 putative ribosomal protein L7Ae-like; Provisional
Probab=26.94  E-value=25  Score=13.84  Aligned_cols=48  Identities=15%  Similarity=0.271  Sum_probs=23.6

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             1162122222333588886531213568323222212305676699886521101123
Q gi|254780849|r  242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT  299 (551)
Q Consensus       242 ~~~~~l~ii~~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~~~~L~dia~~tGa~  299 (551)
                      +-.-..+++++|.+......+..-....++++.-+..          +.++..+||..
T Consensus        25 ~g~~~~V~IA~Dad~~v~~~v~~l~~ek~Ipv~~V~S----------mk~LGkacGI~   72 (82)
T PRK13602         25 RGSVKEVVVAKDADPCLTSGVINLANEQGVPVSMVES----------MKKLGKACGIE   72 (82)
T ss_pred             CCCEEEEEEEECCCHHHHHHHHHHHHHCCCCEEEECC----------HHHHHHHHCCC
T ss_conf             6981299998259888999999999972998799628----------99975172825


No 74 
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase; InterPro: IPR012773    Members of this family of class III pyridoxal-phosphate-dependent aminotransferases are diaminobutyrate--2-oxoglutarate aminotransferase (2.6.1.76 from EC) that catalyze the first step in ectoine biosynthesis from L-aspartate beta-semialdehyde. This family is readily separated phylogenetically from enzymes with the same substrate and product but involved in other process such as siderophore (Q9Z3R2 from SWISSPROT) or 1,3-diaminopropane (P44951 from SWISSPROT) biosynthesis. Ectoine is a compatible solute particularly effective in conferring salt tolerance.; GO: 0030170 pyridoxal phosphate binding, 0047307 diaminobutyrate-pyruvate transaminase activity, 0019491 ectoine biosynthetic process.
Probab=26.15  E-value=36  Score=12.85  Aligned_cols=16  Identities=38%  Similarity=0.412  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHH-CCCCH
Q ss_conf             99999999745-08996
Q gi|254780849|r  418 ALVRAAQALSV-KGDNE  433 (551)
Q Consensus       418 ~e~~ls~~l~~-~~~~~  433 (551)
                      +.+.+..+|+. +.++.
T Consensus       299 AFVtA~aAL~~yW~Dd~  315 (413)
T TIGR02407       299 AFVTATAALEYYWSDDA  315 (413)
T ss_pred             HHHHHHHHHHHHCCCHH
T ss_conf             89999999998489626


No 75 
>pfam03823 Neurokinin_B Neurokinin B.
Probab=26.05  E-value=36  Score=12.86  Aligned_cols=10  Identities=60%  Similarity=1.165  Sum_probs=6.2

Q ss_pred             CCCCCCCCCH
Q ss_conf             2781055537
Q gi|254780849|r  408 DEGIVPGGGI  417 (551)
Q Consensus       408 ~~~vvpGGGa  417 (551)
                      .+.++||||-
T Consensus        27 qeqv~pgGG~   36 (59)
T pfam03823        27 QEQVVPGGGR   36 (59)
T ss_pred             HHCCCCCCCC
T ss_conf             7533789986


No 76 
>KOG2387 consensus
Probab=25.57  E-value=37  Score=12.78  Aligned_cols=58  Identities=17%  Similarity=0.192  Sum_probs=28.5

Q ss_pred             HHHHHHHHHHHHHHHHHCCCC-CCCCC----CHHHHHHH-HHHHHCCC-----CHHHHHHHHHHHHHHHHH
Q ss_conf             989887788999987540278-10555----37999999-99745089-----968999999999999999
Q gi|254780849|r  390 GEKKDRYQDSLDATRAASDEG-IVPGG----GIALVRAA-QALSVKGD-----NEDQCAGIEIVRKALSYP  449 (551)
Q Consensus       390 ~E~~r~~~DAl~v~~~~~~~~-vvpGG----Ga~e~~ls-~~l~~~~~-----~~~~~~~i~~fa~AL~~i  449 (551)
                      .|..+.+|.|-.-++.+  +| +||||    |..=+.++ +.-++...     .-..|+++--||+....+
T Consensus       348 ~e~~~~~~~aW~~l~~a--dGilvPGGFG~RGveG~i~Aak~ARen~iP~LGiCLGmQ~AvIEfaRnvLg~  416 (585)
T KOG2387         348 QEDPRKYHAAWQKLKSA--DGILVPGGFGDRGVEGKILAAKWARENKIPFLGICLGMQLAVIEFARNVLGL  416 (585)
T ss_pred             CCCHHHHHHHHHHHCCC--CEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHCC
T ss_conf             45726789999875248--8289678665443057899999987649975763111269999999986177


No 77 
>pfam00752 XPG_N XPG N-terminal domain.
Probab=25.56  E-value=22  Score=14.22  Aligned_cols=36  Identities=17%  Similarity=0.333  Sum_probs=15.5

Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             5518866679999999999999999769889999998
Q gi|254780849|r   83 DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRG  119 (551)
Q Consensus        83 ~~~GDGTTtvvvLa~eLL~~a~~Li~~gihP~~Ii~G  119 (551)
                      .+.|++..+..-|.+ ++.+...|+..|++|..+-+|
T Consensus        45 ~~~~~~~~~~~~l~~-~~~ri~~l~~~~I~PvfVFDG   80 (100)
T pfam00752        45 DQLGNALQNTSHLMG-FFSRLCRLKDFGIKPIFVFDG   80 (100)
T ss_pred             HHHCCCCCCCHHHHH-HHHHHHHHHHCCCEEEEEECC
T ss_conf             231378888289999-999999999889989998789


No 78 
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518   Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate , .   In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation.   AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process.
Probab=25.06  E-value=35  Score=12.92  Aligned_cols=20  Identities=15%  Similarity=0.215  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCC
Q ss_conf             34568889999998424320
Q gi|254780849|r  154 GDREIGEKIAYAMEQIGPHG  173 (551)
Q Consensus       154 ~~~~l~~li~~A~~~i~~d~  173 (551)
                      +-..++++++++.++-|.+.
T Consensus        97 aRPlIA~~lVe~Ak~~Ga~A  116 (420)
T TIGR00032        97 ARPLIAKKLVEVAKKEGAEA  116 (420)
T ss_pred             HHHHHHHHHHHHHHHCCCEE
T ss_conf             45799999999984669549


No 79 
>TIGR00644 recJ single-stranded-DNA-specific exonuclease RecJ; InterPro: IPR004610 All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. RecJ is a single-stranded DNA-specific endonuclease which is required for many types of recombination events, although the stringency of the requirement for RecJ appears to vary with the type of recombinational event monitored, and the other recombination gene products which are available.; GO: 0008409 5'-3' exonuclease activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=24.26  E-value=39  Score=12.62  Aligned_cols=61  Identities=21%  Similarity=0.304  Sum_probs=35.6

Q ss_pred             HHHHHHHHHHHHHHH--HCC----CHHHHHHHHHHHHHHH--HHHHHCCCC-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             889999999866255--188----6667999999999999--999976988-999999898644777767653
Q gi|254780849|r   70 GARMIRDVATNTEDS--SGD----GTTTATCLAQAIYNEG--RKYVTAGLN-PMDIKRGIDLAVQEVVEYLKA  133 (551)
Q Consensus        70 ~akll~~~a~~qd~~--~GD----GTTtvvvLa~eLL~~a--~~Li~~gih-P~~Ii~G~~~a~~~al~~L~~  133 (551)
                      ||.-|.++-..-.+-  +||    |.||++||...|-.-+  ..   -.++ |.++-+||....+..-+..+.
T Consensus        44 Av~ri~~A~~~~eki~i~GDyDvDGiTSt~~l~~~L~~lGp~~~---~~~~IPnR~~egYG~~~~~~~~~~~~  113 (705)
T TIGR00644        44 AVERIIEAIENNEKILIFGDYDVDGITSTAILVEFLRELGPYVQ---VDYYIPNRFTEGYGLSPEALRELKEN  113 (705)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE---EEEEECCCCCCCCCCCHHHHHHHHHC
T ss_conf             99999999972893899961752268999999999995099732---46662663577778898999999866


No 80 
>KOG1924 consensus
Probab=24.11  E-value=39  Score=12.60  Aligned_cols=10  Identities=10%  Similarity=0.129  Sum_probs=5.0

Q ss_pred             HHHHHHHHHH
Q ss_conf             8660999971
Q gi|254780849|r  513 MMLITEAVVV  522 (551)
Q Consensus       513 ~iLriD~iI~  522 (551)
                      ++|.+|.-|-
T Consensus       519 ~~~~~~~~iP  528 (1102)
T KOG1924         519 QLLPIDGGIP  528 (1102)
T ss_pred             CCCCCCCCCC
T ss_conf             6998778999


No 81 
>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132   Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This entry contains one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane.
Probab=23.90  E-value=21  Score=14.38  Aligned_cols=113  Identities=17%  Similarity=0.140  Sum_probs=46.9

Q ss_pred             HHHHHHCCCHHHH------CCCCCCCCC-CCHHHHHHHHHCCCHHHHHHHHH---HHHHHHHHCCCCCCCCEEECCC-CC
Q ss_conf             1344411310220------135644100-11146775311162122222333---5888865312135683232222-12
Q gi|254780849|r  210 RMTAEVENPYILI------YDKKISALQ-PLLPILESATQSGRPLCIIAEDV---EGDALATLVVNRVRCGLPVLAV-KA  278 (551)
Q Consensus       210 ~~~~~~~n~~Ili------~d~~Le~~~-~~~~~le~~~~~~~~l~ii~~~~---e~~~l~~lv~n~~k~gi~v~~v-k~  278 (551)
                      +..--|....|++      +|.|-|+.+ +..-++-...-. ..+.-+..++   .++.|.++...+..+  .++-| =+
T Consensus       423 Q~WQDFQq~~Ia~~RlGDiLn~P~E~~~d~g~aalP~l~G~-i~F~nirFRY~pD~PeVL~nl~L~I~~G--e~IGIvGp  499 (703)
T TIGR01846       423 QLWQDFQQVGIAIERLGDILNSPTEPSSDAGLAALPELKGS-ITFENIRFRYKPDSPEVLSNLSLDIKPG--EVIGIVGP  499 (703)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-EEEEEEEECCCCCCCHHHHCCCCCCCCC--EEEEEECC
T ss_conf             87666887766653121005868488999873035422572-6787533146888717873268765786--57998727


Q ss_pred             CHHHHHH-HHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEEC
Q ss_conf             3056766-998865211011233210106322112222244102789804
Q gi|254780849|r  279 PAFGDRR-KEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSK  327 (551)
Q Consensus       279 ~~~~~~~-~~~L~dia~~tGa~vi~~~~~~~l~~~~~~~LG~~~~v~i~~  327 (551)
                      .|-|..= ...+.++-.==-|+|.-  ++.|+.-.++..|.+=-.|...+
T Consensus       500 SGSGKSTLTKL~QRLYtP~~GqVLV--DG~DLA~~DP~wLRRQ~gVVLQE  547 (703)
T TIGR01846       500 SGSGKSTLTKLLQRLYTPEHGQVLV--DGVDLAIADPAWLRRQVGVVLQE  547 (703)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCEEEE--CCCCCCCCCCCHHHHCCEEEEEC
T ss_conf             8986789999988614888874777--03000101852010223023400


No 82 
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina frisia Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer . The CO dehydrogenase enzyme complex from Methanosarcina thermophila contains a corrinoid/iron-sulphur enzyme composed of two subunits (delta and gamma) . This family consists of carbon monoxide dehydrogenase I/II beta subunit 1.2.99.2 from EC and CO dehydrogenase (acetyl-CoA synthase epsilon subunit).; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=23.75  E-value=22  Score=14.27  Aligned_cols=38  Identities=32%  Similarity=0.523  Sum_probs=29.2

Q ss_pred             HHHHHCCCHHHHHHHHHH-HHHHHHHCCCCCCC-CEEECC
Q ss_conf             753111621222223335-88886531213568-323222
Q gi|254780849|r  238 ESATQSGRPLCIIAEDVE-GDALATLVVNRVRC-GLPVLA  275 (551)
Q Consensus       238 e~~~~~~~~l~ii~~~~e-~~~l~~lv~n~~k~-gi~v~~  275 (551)
                      .-+.+..|||+|+.++.. ++++.+.+..++++ +++|++
T Consensus        23 ~MIkkAkrPLLv~G~~l~~~Ek~~E~~~K~iekF~l~vva   62 (170)
T TIGR00315        23 MMIKKAKRPLLVVGPNLEKDEKLLELVVKFIEKFDLPVVA   62 (170)
T ss_pred             HHHHHCCCCEEEECCCCHHCCHHHHHHHHHHHHCCCCEEE
T ss_conf             7677628860533610012121345555556432886474


No 83 
>COG3333 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.52  E-value=42  Score=12.40  Aligned_cols=22  Identities=18%  Similarity=0.101  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             8899999998662551886667
Q gi|254780849|r   70 GARMIRDVATNTEDSSGDGTTT   91 (551)
Q Consensus        70 ~akll~~~a~~qd~~~GDGTTt   91 (551)
                      ..-++--+.-----++|+-||+
T Consensus        58 ~~alIllagvY~ga~yGGStta   79 (504)
T COG3333          58 ASALILLAGVYYGALYGGSTTA   79 (504)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHE
T ss_conf             7899999999985110773421


No 84 
>PRK13304 L-aspartate dehydrogenase; Reviewed
Probab=22.24  E-value=40  Score=12.54  Aligned_cols=75  Identities=19%  Similarity=0.213  Sum_probs=47.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCEEECCCCCCHHHHHH-HHHHHHHHHHCCCCCCC-HHHCCCCCCCCCCCCCCEEEEEEE
Q ss_conf             3335888865312135683232222123056766-99886521101123321-010632211222224410278980
Q gi|254780849|r  252 EDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRR-KEVLRDIAAVVGATVIS-EEIGLKLEKATIADLGSAKKVVMS  326 (551)
Q Consensus       252 ~~~e~~~l~~lv~n~~k~gi~v~~vk~~~~~~~~-~~~L~dia~~tGa~vi~-~~~~~~l~~~~~~~LG~~~~v~i~  326 (551)
                      |-...+++.......++.|.++++...+.|.|.. .+.|.+.|..+|++++- .-..-=++.+....+|...++.++
T Consensus        67 E~A~~~av~~~~~~~L~~G~dlvv~SvGALaD~~l~~~L~~~A~~~g~~i~ipsGAigGlD~l~aa~~~~l~~V~~~  143 (265)
T PRK13304         67 ECASQKAVEDTVPKSLNNGKDVIIMSVGALADKELFLKLYKLAKENGCKIYLPSGAIAGIDGIKAASLGEIESVTLT  143 (265)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEEEECHHHHCCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             89898999999999997599899981368559899999999997379779982613442788999865897579999


No 85 
>KOG1593 consensus
Probab=22.18  E-value=43  Score=12.36  Aligned_cols=15  Identities=27%  Similarity=0.432  Sum_probs=8.0

Q ss_pred             HCCCCHHHH----HHHHHH
Q ss_conf             779998999----999981
Q gi|254780849|r  456 NAGDESELI----VSKIQE  470 (551)
Q Consensus       456 NaG~d~~~~----i~~l~~  470 (551)
                      -+|.+|.+.    ++.+..
T Consensus       280 r~G~~P~eAa~~~i~RI~k  298 (349)
T KOG1593         280 RAGKKPAEAAQKAISRILK  298 (349)
T ss_pred             HCCCCHHHHHHHHHHHHHH
T ss_conf             8479869999999999998


No 86 
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=22.09  E-value=43  Score=12.35  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=6.9

Q ss_pred             HHHHHHCCCCHHHH
Q ss_conf             99999779998999
Q gi|254780849|r  451 RQIIKNAGDESELI  464 (551)
Q Consensus       451 ~~La~NaG~d~~~~  464 (551)
                      +-+|.-||..+.+|
T Consensus       392 ~RIA~GSG~~v~eV  405 (433)
T PRK00771        392 KRIARGSGVSPEEV  405 (433)
T ss_pred             HHHHCCCCCCHHHH
T ss_conf             99775499899999


No 87 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374    This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly, and is closely related to GspE (IPR013369 from INTERPRO) of type II secretion systems (also referred to as the main terminal branch of the general secretion pathway). Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0009297 pilus biogenesis.
Probab=21.70  E-value=44  Score=12.30  Aligned_cols=23  Identities=17%  Similarity=0.102  Sum_probs=9.4

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             12567653146898988778899998
Q gi|254780849|r  378 VLEVGDVTEAALGEKKDRYQDSLDAT  403 (551)
Q Consensus       378 tI~vgg~t~~~~~E~~r~~~DAl~v~  403 (551)
                      -|+|=|||-.   =.==++.=||+.+
T Consensus       328 MvLVTGPTGS---GKTVSLYTaLniL  350 (577)
T TIGR02538       328 MVLVTGPTGS---GKTVSLYTALNIL  350 (577)
T ss_pred             CEEEECCCCC---CHHHHHHHHHCCC
T ss_conf             2886266598---4168787631125


No 88 
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family; InterPro: IPR004753   Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes. In addition to individual cell shape, the way in which groups of cells are arranged is also typical of some bacterial species, especially Gram-positive coccoids. For many years, it was believed that micro-organisms with other than spheroidal cell shapes maintained morphology by means of their external cell walls. Recently, however, studies of the Gram-positive rod Bacillus subtilis have revealed two related genes that are essential for the integrity of cell morphogenesis . Termed mreB and mbl, the gene products localise close to the cell surface, forming filamentous helical structures. Many homologues have been found in diverse bacterial groups, suggesting a common ancestor .    The crystal structure of MreB from Thermotoga maritima has been resolved using X-ray crystallography . It consists of 19 beta-strands and 15 alpha- helices, and shows remarkable structural similarity to eukaryotic actin. MreB crystals also contain proto-filaments, with individual proteins assembling into polymers like F-actin, in the same orientation. It is hypothesised therefore, that MreB was the forerunner of actin in early eukaryotes .; GO: 0000902 cell morphogenesis.
Probab=21.09  E-value=45  Score=12.22  Aligned_cols=41  Identities=24%  Similarity=0.461  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHH----HHHHHHC------------CCC-CCCCCCHHHHHHHHHHHHCC
Q ss_conf             98988778899----9987540------------278-10555379999999974508
Q gi|254780849|r  390 GEKKDRYQDSL----DATRAAS------------DEG-IVPGGGIALVRAAQALSVKG  430 (551)
Q Consensus       390 ~E~~r~~~DAl----~v~~~~~------------~~~-vvpGGGa~e~~ls~~l~~~~  430 (551)
                      .|+..++.|-+    .++|.++            +.| ||.||||-+=-|-+.|++..
T Consensus       250 ~ev~EaL~epv~~IV~aVk~tLE~tPPELA~DIveRGiVLTGGGaLLrnLDk~lS~eT  307 (337)
T TIGR00904       250 VEVREALQEPVNQIVEAVKSTLEKTPPELAADIVERGIVLTGGGALLRNLDKLLSKET  307 (337)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCEEEECCHHHHHCCCHHHHHHC
T ss_conf             8999988736889999999875168870465776469376263054521015877734


No 89 
>TIGR02663 nifX nitrogen fixation protein NifX; InterPro: IPR013480    NifX is involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-Co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria. This complex catalyses the reduction of atmospheric dinitrogen to ammonia. The role of NifX in cofactor biosynthesis is not fully understood, though it appears to be associated with mature FeMo-Co and may be involved in the addition of heterometal and/or homocitrate .; GO: 0051540 metal cluster binding, 0009399 nitrogen fixation, 0051188 cofactor biosynthetic process.
Probab=20.82  E-value=38  Score=12.65  Aligned_cols=25  Identities=32%  Similarity=0.551  Sum_probs=13.6

Q ss_pred             CCCCCCCCCCCCEEEEE---EECCCCCCC
Q ss_conf             22112222244102789---804673013
Q gi|254780849|r  308 KLEKATIADLGSAKKVV---MSKDDTTIV  333 (551)
Q Consensus       308 ~l~~~~~~~LG~~~~v~---i~~~~~~ii  333 (551)
                      +++.++ +.+|+|+++.   ++.++..++
T Consensus         9 D~~~~n-aHFG~Ak~f~iYdvt~~g~~F~   36 (125)
T TIGR02663         9 DLERLN-AHFGSAKQFAIYDVTAEGARFV   36 (125)
T ss_pred             CHHHHH-CCCCCCCEEEEEEECCCCCEEE
T ss_conf             211211-0036344213676566786575


No 90 
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramate-alanine ligase (MurC). MurC is an essential, cytoplasmic peptidoglycan biosynthetic enzyme, catalyzes the ATP-dependent ligation of L-alanine (Ala) and UDP-N-acetylmuramic acid (UNAM) to form UDP-N-acetylmuramyl-L-alanine (UNAM-Ala). The enzyme is a nonribosomal peptide ligase which utilises ATP to form an amide bond between L-alanine and UNAM.1 Mechanistic studies on the Escherichia coli MurC enzyme using oxygen isotope analyses demonstrated that the enzyme-catalyzed reaction proceeds through an acyl phosphate UNAM intermediate prior to L-alanine addition.; GO: 0005524 ATP binding, 0008763 UDP-N-acetylmuramate-L-alanine ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=20.03  E-value=25  Score=13.88  Aligned_cols=21  Identities=14%  Similarity=0.194  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHCCCCCHH
Q ss_conf             456888999999842432000
Q gi|254780849|r  155 DREIGEKIAYAMEQIGPHGII  175 (551)
Q Consensus       155 ~~~l~~li~~A~~~i~~d~vi  175 (551)
                      |..-+.+++..+...+.|-.+
T Consensus       119 KTTTTamia~~~~~aGLdPt~  139 (491)
T TIGR01082       119 KTTTTAMIAVILKEAGLDPTV  139 (491)
T ss_pred             CHHHHHHHHHHHHHCCCCCCE
T ss_conf             256899999999844999768


Done!