BLAST/PSIBLAST alignment of GI: 254780849 and GI: 16262848 at iteration 1
>gi|16262848|ref|NP_435641.1| chaperonin GroEL [Sinorhizobium meliloti 1021] Length = 545
>gi|20137878|sp|Q92ZQ4|CH604_RHIME RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4; AltName: Full=Protein Cpn60 4 Length = 545
>gi|14523485|gb|AAK65053.1| groEL2 chaperonin [Sinorhizobium meliloti 1021] Length = 545
 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526