BLAST/PSIBLAST alignment of GI: 254780849 and GI: 209548077 at iteration 1
>gi|209548077|ref|YP_002279994.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 547
>gi|226704162|sp|B5ZRD6|CH60_RHILW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein; AltName: Full=Protein Cpn60 Length = 547
>gi|209533833|gb|ACI53768.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 547
 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    NYGYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S FGDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530