BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus
Liberibacter asiaticus str. psy62]
         (551 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040526|gb|ACT57322.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62]
          Length = 551

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/551 (100%), Positives = 551/551 (100%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI
Sbjct: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI
Sbjct: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA
Sbjct: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA
Sbjct: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV
Sbjct: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY
Sbjct: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV
Sbjct: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA
Sbjct: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM
Sbjct: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540

Query: 541 GGGMGGMDMMM 551
           GGGMGGMDMMM
Sbjct: 541 GGGMGGMDMMM 551


>gi|315122727|ref|YP_004063216.1| chaperonin GroEL [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496129|gb|ADR52728.1| chaperonin GroEL [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 555

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/536 (85%), Positives = 501/536 (93%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKDIKLG  ARD++AYGVN LA+AVKCTLGPKGRCVII NSFGAPRVTKDGV+VAKSI
Sbjct: 1   MSAKDIKLGINARDSVAYGVNALADAVKCTLGPKGRCVIIANSFGAPRVTKDGVSVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           SFKNHFHEVGARMIRDVATN ED+SGDGTTTATCLAQAI NEGRKYV AGLNPMD++RGI
Sbjct: 61  SFKNHFHEVGARMIRDVATNAEDNSGDGTTTATCLAQAIINEGRKYVAAGLNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           +LAVQEVV+YLK NHKKVGSREEIIQVATISANGDR+IGEKIA+AME+IGPHGIITIDQA
Sbjct: 121 NLAVQEVVDYLKVNHKKVGSREEIIQVATISANGDRDIGEKIAFAMEKIGPHGIITIDQA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTATTEVRVV+GMQ DRGYISPYF+T++E+MTAE ENPYIL+YDKKISALQPLLP+LE  
Sbjct: 181 KTATTEVRVVKGMQFDRGYISPYFMTNSEKMTAEAENPYILVYDKKISALQPLLPLLEIV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPLCIIAEDVEGDALATLVVNR+RC L VLAVKAPAFGDRRK VL+DIA +VGATV
Sbjct: 241 AQSGRPLCIIAEDVEGDALATLVVNRLRCNLSVLAVKAPAFGDRRKAVLQDIAVLVGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+GLKLEKAT+ADLGSAKKVVM+KDDTTIVGG G  E ++ RI+EIQ AIE+TKSDY
Sbjct: 301 ISDEVGLKLEKATVADLGSAKKVVMTKDDTTIVGGCGSQELVQARISEIQAAIEETKSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKLKERLAKLAGGVAV+EVGDVTEAAL EKKDRYQDSLDATRAASDEGIV GGGI+L+
Sbjct: 361 DRDKLKERLAKLAGGVAVIEVGDVTEAALSEKKDRYQDSLDATRAASDEGIVVGGGISLI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAAQALSVKGDN DQCAGIEIVRK L YPCRQII+NAGDE+ LIVSKIQE+K  N+GY+A
Sbjct: 421 RAAQALSVKGDNSDQCAGIEIVRKVLGYPCRQIIENAGDEAALIVSKIQENKNVNFGYDA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           QK VFGDMFEMGIIDPVKVVRNALQSA S+A M+LITEAVVVD PKDE+A+PQMPA
Sbjct: 481 QKGVFGDMFEMGIIDPVKVVRNALQSAASVASMLLITEAVVVDLPKDESAAPQMPA 536


>gi|110635424|ref|YP_675632.1| chaperonin GroEL [Mesorhizobium sp. BNC1]
 gi|118597097|sp|Q11DQ8|CH602_MESSB RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|110286408|gb|ABG64467.1| chaperonin GroEL [Chelativorans sp. BNC1]
          Length = 542

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/541 (60%), Positives = 425/541 (78%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDAAGDGTTTATVLTQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +VE LK N +KV   +EI QV TISANGD+EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVEELKKNARKVTKNDEIAQVGTISANGDQEIGRFLAQAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  E++ PY+LI++KK+++LQPLLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQEKMRVELDEPYLLIHEKKLASLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + I+GR+N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGLLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL +V G+NEDQ  GI IVR+A+  P RQI +NAG E  +IV +++E     YG+N
Sbjct: 421 RAAKALDNVTGENEDQKVGISIVRRAIEAPIRQIAENAGAEGSIIVGRVREKPDFGYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD+++MG+IDPVKVVR ALQ A S+AG+++ TEA+V D PK ETA P MPAG G
Sbjct: 481 AQTGEYGDLYQMGVIDPVKVVRAALQDAASVAGLLITTEAMVADRPKKETA-PAMPAGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|13472184|ref|NP_103751.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452874|sp|Q98IH9|CH602_RHILO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|14022929|dbj|BAB49537.1| heat shock protein GroEL [Mesorhizobium loti MAFF303099]
          Length = 542

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/539 (59%), Positives = 419/539 (77%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V+ LK N +KV   +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E PY+LI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + I+GR+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL SV+ +NEDQ  GIEIVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAAKALDSVQAENEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ + FGD++  G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK E A P MPAGG
Sbjct: 481 AQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKKEPAVPAMPAGG 539


>gi|260466933|ref|ZP_05813116.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|259029329|gb|EEW30622.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
          Length = 543

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/541 (59%), Positives = 416/541 (76%), Gaps = 1/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHTEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  LKAN + V   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAVVAELKANARNVTRNDEIAQVGTISANGDAEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E++ PY+LI++KK+S LQ LLP LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELDEPYVLIHEKKLSNLQALLPALEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVVEKENTTIVDGVGRKEEIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL +V+ DN DQ  G+EIVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAARALDAVQTDNPDQKTGVEIVRRAIETPVRQIAENAGAEGSIIVGKLREKSEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + FGD++  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK E ASP MPAG G
Sbjct: 481 AQTNEFGDLYGQGVIDPAKVVRTALQDAASVAGLLVTTEAMVAEKPKKEAASPAMPAGAG 540

Query: 540 M 540
           M
Sbjct: 541 M 541


>gi|222085003|ref|YP_002543532.1| Chaperonin GroEL [Agrobacterium radiobacter K84]
 gi|221722451|gb|ACM25607.1| Chaperonin GroEL [Agrobacterium radiobacter K84]
          Length = 546

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/526 (60%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKEKKDRIDDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  PCRQI +NAGDE+ ++V KI +    N+GYNA
Sbjct: 421 RSSVKITVKGENDDQEAGVNIVRRALQAPCRQIAENAGDEASIVVGKILDKNEDNWGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q  V+GDM  MGI+DPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGVYGDMIAMGIVDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|209548077|ref|YP_002279994.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226704162|sp|B5ZRD6|CH60_RHILW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|209533833|gb|ACI53768.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 547

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    NYGYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S FGDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|241203263|ref|YP_002974359.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857153|gb|ACS54820.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 547

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    NYGYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|325292065|ref|YP_004277929.1| GroEL chaperonin [Agrobacterium sp. H13-3]
 gi|325059918|gb|ADY63609.1| GroEL chaperonin [Agrobacterium sp. H13-3]
          Length = 544

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRTAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGENDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDRNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+ ++GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIQLGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|16262848|ref|NP_435641.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|20137878|sp|Q92ZQ4|CH604_RHIME RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|14523485|gb|AAK65053.1| groEL2 chaperonin [Sinorhizobium meliloti 1021]
          Length = 545

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|116250657|ref|YP_766495.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841]
 gi|118597090|sp|Q1MKX4|CH601_RHIL3 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|115255305|emb|CAK06380.1| putative 60 kda chaperonin (protein cpn60) [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 547

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|150395633|ref|YP_001326100.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470674|sp|A6U6I5|CH601_SINMW RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|150027148|gb|ABR59265.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 545

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|222106811|ref|YP_002547602.1| chaperonin [Agrobacterium vitis S4]
 gi|254813866|sp|B9K1Y8|CH60_AGRVS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|221737990|gb|ACM38886.1| chaperonin [Agrobacterium vitis S4]
          Length = 547

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/530 (59%), Positives = 415/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ + +GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLHGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANGD ++G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKISTSEEVAQVGTISANGDTQVGKDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYVLLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK+ ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGRAKKISITKENTTIVDGAGQKSDIEGRVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKERKDRIDDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI  NAGDE+ +IV KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRRALQSLVRQIATNAGDEASIIVGKILDKDNDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   FGDM  MGI+DPVKVVR ALQ+A S+A +++ TEA++ + PK ++A
Sbjct: 481 QTGEFGDMIAMGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKDSA 530


>gi|15964545|ref|NP_384898.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|307316014|ref|ZP_07595493.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|7404333|sp|P35469|CH601_RHIME RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|643068|gb|AAA61955.1| GroEL [Sinorhizobium meliloti]
 gi|15073723|emb|CAC45364.1| 60 KD chaperonin A [Sinorhizobium meliloti 1021]
 gi|306898339|gb|EFN29047.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 545

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/526 (59%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|218682519|ref|ZP_03530120.1| chaperonin GroEL [Rhizobium etli CIAT 894]
          Length = 546

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 415/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQALVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q S FGDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK
Sbjct: 481 QTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPK 526


>gi|86361060|ref|YP_472947.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|123508568|sp|Q2JYW6|CH604_RHIEC RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|86285162|gb|ABC94220.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 542

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/541 (58%), Positives = 415/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSVEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +VE LKAN +K+ +  EI QV TISANGD EIG  +A A++++G  G+IT+++A
Sbjct: 121 DLAVSAIVEELKANARKISNNAEIAQVGTISANGDAEIGRFLAEAVQKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK+ + K++TTI+ G G  E I GRI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKITVEKENTTIIDGVGSKEEISGRIAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL ++K  N+DQ  G+EIVR+AL  P RQI +NAG E  ++V K++E    +YG+N
Sbjct: 421 RAVKALDNIKTANDDQRVGVEIVRRALEAPARQIAENAGAEGSVVVGKLREKSDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK + A P MPAG G
Sbjct: 481 AQTGEFGDLYAQGVIDPAKVVRTALQDASSIAGLLVTTEAMIAEKPKKD-APPAMPAGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|86356474|ref|YP_468366.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|119366183|sp|Q2KBZ7|CH601_RHIEC RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|86280576|gb|ABC89639.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 545

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/526 (60%), Positives = 413/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  +S KG N+DQ AGI IVR+AL  P RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSVKISAKGVNDDQEAGINIVRRALQAPARQIAENAGDEASIVVGKILDKDQDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIGMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|83945762|ref|ZP_00958106.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633]
 gi|83850852|gb|EAP88713.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633]
          Length = 546

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/536 (58%), Positives = 414/536 (77%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVKFGASAREKMLKGVDILADAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK+    +    E+ QV TISANG++EIGE IA AME++G  G+IT+++A
Sbjct: 121 DKAVALVIEQLKSTATPIKGSSEVAQVGTISANGEKEIGEMIANAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT +E+M A++E+PYIL+++KK+S+LQP+LP+LE+ 
Sbjct: 181 KSLATELDVVEGMQFDRGYLSPYFVTDSEKMIADLEDPYILLFEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSNRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG+AKKV ++KDDTTIV G G  E IEGR+N+I++ IEDT SDY
Sbjct: 301 VSEDLGIKLENVTLDMLGTAKKVSITKDDTTIVDGAGEKEAIEGRVNQIRRQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGASEIEVKERKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  V GDNEDQ  GI IV +AL  P RQI++NAG E  ++V K+ E+K  N+GYN
Sbjct: 421 KATKALDGVTGDNEDQNQGIAIVARALQAPIRQIVENAGSEGSIVVGKVLENKDPNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+ + G+IDPVKV R ALQ A S+A +++ TEA + + PK +  +P  P
Sbjct: 481 AQTGEYEDLVKSGVIDPVKVSRIALQDAASVASLLITTEAAIAEKPKKDGGAPAAP 536


>gi|150378066|ref|YP_001314661.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470758|sp|A6UM48|CH605_SINMW RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|150032613|gb|ABR64728.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 545

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/526 (59%), Positives = 414/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  K + + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKTINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVDGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|90419968|ref|ZP_01227877.1| chaperonin groEL [Aurantimonas manganoxydans SI85-9A1]
 gi|90336009|gb|EAS49757.1| chaperonin groEL [Aurantimonas manganoxydans SI85-9A1]
          Length = 551

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 417/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV +VVE L    + + + +E+ QV TISANG++EIGE IA AM+++G  G+IT+++A
Sbjct: 121 DAAVLKVVEALGVAARSIDTSDEVAQVGTISANGEKEIGEMIASAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+ YIL+++KK+S LQ LLP+LES 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVAELEDCYILLHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G   +IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVSITKENTTIVDGAGEKTQIEARVGQIKGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ A+++KG N DQ AGI IVRKAL  P RQI++NAG E  +IV KI E+++ ++GYNA
Sbjct: 421 RASNAVTIKGINADQDAGIAIVRKALQAPIRQIVQNAGAEGSIIVGKILENESLSFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               +GDM +MGI+DPVKVVR+ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 ATGEYGDMIQMGIVDPVKVVRSALQDAASVAGLLVTTEAMISEAPKKESA 530


>gi|15888025|ref|NP_353706.1| chaperonin GroEL [Agrobacterium tumefaciens str. C58]
 gi|20141227|sp|P30779|CH60_AGRT5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15155641|gb|AAK86491.1| GroEL chaperonin [Agrobacterium tumefaciens str. C58]
          Length = 544

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/530 (59%), Positives = 417/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  +GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIALGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|152235|gb|AAA26285.1| groEL [Sinorhizobium meliloti]
          Length = 545

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/526 (59%), Positives = 415/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G + R+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSGREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|190890535|ref|YP_001977077.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190695814|gb|ACE89899.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
          Length = 545

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/526 (60%), Positives = 413/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++ KG N+DQ AG+ IVR+AL  P RQI +NAGDE+ ++V KI +    N+GYNA
Sbjct: 421 RSSVKITAKGINDDQEAGVNIVRRALQAPARQIAENAGDEASIVVGKILDKDQDNWGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIGMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|150396499|ref|YP_001326966.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470755|sp|A6U901|CH603_SINMW RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|150028014|gb|ABR60131.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 542

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQADARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K + +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAIASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK+N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKSNARKISQNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT+ TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTSDTELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+ LE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIMLENVTLEMLGRAKKVSIEKENTTIIDGAGSKTEIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +K  N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVNALDGLKTANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKVEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDPVKVVR ALQ A S+AG+++ TEA++ + PK E+ +P +PAGGG
Sbjct: 481 AQTNEYGDLYTMGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKES-TPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|307313307|ref|ZP_07592931.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|306899320|gb|EFN29955.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 542

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANHDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|110632718|ref|YP_672926.1| chaperonin GroEL [Mesorhizobium sp. BNC1]
 gi|118597088|sp|Q11LG4|CH601_MESSB RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|110283702|gb|ABG61761.1| chaperonin GroEL [Chelativorans sp. BNC1]
          Length = 544

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/529 (58%), Positives = 409/529 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVQEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+YL    KK+ + EE+ QV TISANG++EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVDYLAKAAKKIKTSEEVAQVGTISANGEKEIGQMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNPEKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V ++K+ TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKRVSIAKETTTIVDGAGQKSEIEGRVAQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +  KG+N DQ AG+ IVR+A+  P RQI  NAG E+ ++V KI ++    +GYNA
Sbjct: 421 RASSEIKAKGENADQEAGVNIVRRAIQAPARQIASNAGAEASIVVGKILDNNAVTFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           Q   +GDM  MGI+DP+KVVR ALQ A S+AG+++ TEA++ + PK ++
Sbjct: 481 QTGEYGDMIGMGIVDPMKVVRTALQDAASVAGLLITTEAMIAELPKKDS 529


>gi|16264754|ref|NP_437546.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|17380427|sp|P35471|CH605_RHIME RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|15140892|emb|CAC49406.1| putative heat shock protein groEL [Sinorhizobium meliloti 1021]
          Length = 542

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|227820987|ref|YP_002824957.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227339986|gb|ACP24204.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 545

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/526 (59%), Positives = 413/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKKVSISKENTTIVDGAGQKADIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++ KG+N+DQ AG+ IVR+AL  P RQI +NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITAKGENDDQDAGVNIVRRALQAPARQIAENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK 526


>gi|307320760|ref|ZP_07600171.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|306893578|gb|EFN24353.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
          Length = 542

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + +++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIDEENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANHDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|461734|sp|P34939|CH60_RHILV RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|387874|gb|AAA26246.1| chaperonin 60 [Rhizobium leguminosarum]
          Length = 546

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/526 (59%), Positives = 413/526 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G   R+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTGREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKRMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALA 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPK 526


>gi|190894865|ref|YP_001985158.1| chaperonin GroEL [Rhizobium etli CIAT 652]
 gi|190700526|gb|ACE94608.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|327189040|gb|EGE56226.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CNPAF512]
          Length = 542

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/541 (58%), Positives = 413/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNVEAREKLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN + + +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVAAIVAELKANARNISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGRI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSVEKENTTIVDGSGAKSDIEGRIAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +V+  N DQ  G++IVR+AL  P RQI +NAG E  ++V K++E    +YG+N
Sbjct: 421 RAVKALENVQTANSDQRVGVDIVRRALEAPARQIAENAGAEGSVVVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD++  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK + A+P +P G G
Sbjct: 481 AQTGEFGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMVAEKPKKD-AAPPLPPGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|114705804|ref|ZP_01438707.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
 gi|114538650|gb|EAU41771.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
          Length = 550

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/526 (58%), Positives = 416/526 (79%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A+ +VVE L    + + + +E+ QV TISANG++++GE IA AM+++G  G+IT+++A
Sbjct: 121 DAAIAKVVEALGEAARSIDTSDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+ YIL+++KK+S LQ +LP+LES 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNGEKMVAELEDAYILLHEKKLSNLQAMLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKK+ ++K++TTIV G G +E+I+ R+ +I+  IE+T SDY
Sbjct: 301 VSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ A+ +KG N DQ AGI IVRKAL  P RQI++NAG E  ++V KI E+++ ++GYNA
Sbjct: 421 RASNAVDLKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESLSFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           Q   +GDM +MGI+DPVKVVR+ALQ AGS+AG+++ TEA++ +APK
Sbjct: 481 QTGEYGDMIQMGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPK 526


>gi|75676299|ref|YP_318720.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255]
 gi|119366180|sp|Q3SQS3|CH601_NITWN RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|74421169|gb|ABA05368.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255]
          Length = 542

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  + AR+ +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFSSDAREKMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV+ L  N KK+ S  EI QVATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVKDLTKNAKKITSNSEIAQVATISANGDTEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT  E+M  E E+PY+LI++KK+S LQ ++P+LES 
Sbjct: 181 KSLETELEVVEGMQFDRGYVSPYFVTDAEKMRVEFEDPYVLIHEKKLSGLQAMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL +IAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLVIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVVIDKENTTIVDGAGRKKDIEARVTQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +VK DN DQ AG++IVR+A+  P RQII+NAG++  L+V K+ E  T N+G+N
Sbjct: 421 RALKALDAVKPDNPDQKAGVDIVRRAIQVPARQIIQNAGEDGSLVVGKLLEKNTYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+  +G+IDP KVVR ALQ A S+A +++ TEA+V + PK + A P +P GGG
Sbjct: 481 AATGEYQDLVGVGVIDPAKVVRTALQDAASVASLLITTEALVAEKPKKDVA-PALPPGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|239834971|ref|ZP_04683299.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
 gi|239823034|gb|EEQ94603.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
          Length = 542

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 415/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+ S  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKTNARKITSNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + K++TTI+ G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKRVAIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  G+EIVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALEGLPIANDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD++  G+IDPVKVVR ALQ A S+AG+++ TEA++ + PK E A+P +PA  G
Sbjct: 481 AQTGEYGDLYAQGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-ATPALPASAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|15964949|ref|NP_385302.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|307301020|ref|ZP_07580789.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|307317754|ref|ZP_07597192.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|7404334|sp|P35470|CH602_RHIME RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|15074128|emb|CAC45775.1| 60 KD chaperonin B (GroEL) protein [Sinorhizobium meliloti 1021]
 gi|306896516|gb|EFN27264.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|306903975|gb|EFN34561.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 542

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V+ L+ N +KV    EI QVATISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVEAIVKELRNNARKVSKNAEIAQVATISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GM+ DRGY+SPYF+T+ E+M  E+E+ YIL+++KK+S LQ ++PILES 
Sbjct: 181 KTAEIELEVVEGMEFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNLQAMIPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKSMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG AK++++ K+ TTIV G G  E I GR+ +I+  IEDT SDY
Sbjct: 301 ISEELGIKLENTTMDTLGRAKRIMVDKETTTIVDGAGSKEDIGGRVAQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R   AL+ +   N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E +   +G+N
Sbjct: 421 RVVSALNGLATANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKQDFAFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD+F+MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK +   PQMP GGG
Sbjct: 481 AQTGEFGDLFQMGVIDPAKVVRAALQDAASIAGLLVTTEAMIAEKPKKD-GQPQMPPGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|227818754|ref|YP_002822725.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|75519427|sp|Q6W1D5|CH602_RHISN RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|36959008|gb|AAQ87433.1| 60 kDa chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227337753|gb|ACP21972.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFHTEAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE L+ N +KV   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVDAVVEELRRNARKVTKNDEIAQVGTISANGDTEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PY+LI++KK+S LQ LLP+LES 
Sbjct: 181 KTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYVLIHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKKVVVEKENTTIVDGAGSKTEIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  V+ +N DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E     YG+N
Sbjct: 421 RAVKALDRVQTENPDQRHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFGYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ + FGD+FE G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK E
Sbjct: 481 AQTNEFGDLFEQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKKE 529


>gi|20804205|emb|CAD31231.1| PROBABLE CHAPERONIN GROEL DF PROTEIN [Mesorhizobium loti R7A]
          Length = 552

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/530 (58%), Positives = 410/530 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N KK+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTDVVATLIKNAKKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDVYILLHEKKLSNLQTMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G  E I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASLSINAVGANSDQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|149185484|ref|ZP_01863800.1| chaperonin GroEL [Erythrobacter sp. SD-21]
 gi|148830704|gb|EDL49139.1| chaperonin GroEL [Erythrobacter sp. SD-21]
          Length = 549

 Score =  637 bits (1644), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 412/536 (76%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ I  GV+TLA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGRDAREGIQRGVDTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ + D++GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLKEVASKSNDAAGDGTTTATVLAQSIVTEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV++VVE LK+  K V    EI QV  ISANGDRE+GEKIA AME++G  G+IT+D++
Sbjct: 121 DLAVEKVVENLKSRSKDVSGSSEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+  V+GMQ DRGY+SPYF+T+ E+MT E+ENPYILI++KK+S LQ +LP+LE+A
Sbjct: 181 KGLEFELETVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSNLQAMLPVLEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L+DI+ +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDISILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + KD+TTIV G G  + I+ R++EI+  I++T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVSEIRTQIDNTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++AL  + G N+DQ  GI+IVR+AL+ P RQI  NAG +  ++  K+ +S   N G+N
Sbjct: 421 YASKALDGLSGGNDDQTRGIDIVRRALTAPVRQIATNAGHDGAVVSGKLTDSNDENLGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + ++   G+IDP KVVR ALQ+A S+AG+++ TEA VVD P+D++++P MP
Sbjct: 481 AATDTYENLVSAGVIDPTKVVRTALQNAASVAGLLITTEAAVVDKPEDKSSAPAMP 536


>gi|312115563|ref|YP_004013159.1| chaperonin GroEL [Rhodomicrobium vannielii ATCC 17100]
 gi|311220692|gb|ADP72060.1| chaperonin GroEL [Rhodomicrobium vannielii ATCC 17100]
          Length = 542

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 412/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G  AR+ +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFGQDARERMIRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVKEGAKSVAAGANPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ L++  KKV S  E+ QV TISANGD E+G KIA AME++G  G+IT++++
Sbjct: 121 DIAVAAVVKDLQSKAKKVTSSSEVAQVGTISANGDVEVGAKIAEAMEKVGNEGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGYISPYF+T  E+M  ++++PYILIY+KK+S LQPLLP+LE+ 
Sbjct: 181 KSLDFELEVVEGMQFDRGYISPYFITDAEKMRVDLDDPYILIYEKKLSNLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G  +
Sbjct: 241 VQSARPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAVLTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   I  LG AKK+ ++KDDTTIV G+G  + IE RIN+I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENVNITMLGRAKKITITKDDTTIVDGSGDQKEIEARINQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EG +PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGFLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG+NEDQ AGI IVR+A+  P R I  NAG++  +I  K+ E+   N+GYN
Sbjct: 421 RAISALEGLKGENEDQKAGINIVRRAIQTPIRTIAANAGEDGAVIAGKVLENGDYNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+   G+IDPVKVVR ALQ A S+AG+++ TEA++ + PK ++  P MP GGG
Sbjct: 481 AATGEYSDLVAAGVIDPVKVVRIALQDAASVAGLLITTEAMIAEKPKKDSPMPAMP-GGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|197106643|ref|YP_002132020.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
 gi|196480063|gb|ACG79591.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
          Length = 547

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/524 (60%), Positives = 407/524 (77%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVNTLA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDRMLRGVNTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA++IR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELSDKFENLGAQLIREVASKTNDKAGDGTTTATVLAQAIVVEGLKSVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV +V+E +KA  KKV +  EI QV TISANGD E+GE IA AME++G  G+IT+++A
Sbjct: 121 DKAVAKVIEEIKATSKKVSANSEIAQVGTISANGDVEVGEMIARAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M A++E P IL+++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMEADLEEPLILLFEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AKKV ++K+DTTIV G+G    IEGRI +I+K IEDT SDY
Sbjct: 301 ISEDLGIKLENVSLDMLGRAKKVTITKEDTTIVDGSGDKSGIEGRIAQIKKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++ L   KGDN+DQ AGI IVR+AL  P RQI +NAG E  ++V K+ E+ +  +G+N
Sbjct: 421 KASKVLDGFKGDNDDQEAGIAIVRRALQAPIRQISENAGVEGSIVVGKVLENASPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + D+ + G+IDP KVVR ALQ A S+AG+++ TEA +V+
Sbjct: 481 AQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAIVE 524


>gi|295691041|ref|YP_003594734.1| chaperonin GroEL [Caulobacter segnis ATCC 21756]
 gi|295432944|gb|ADG12116.1| chaperonin GroEL [Caulobacter segnis ATCC 21756]
          Length = 547

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 317/524 (60%), Positives = 409/524 (78%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVN LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE +K + KKV +  EI QV TISANGD+E+GE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVLVAVEEIKKSSKKVTTNAEIAQVGTISANGDKEVGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + GA V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGAQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV ++KDDTTIV G G  E IE RI++I++ IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSITKDDTTIVDGIGEKEAIEARISQIKRQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA+DEGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++AL+ + G+N+DQ AGI IVR+AL  P RQI +NAG E  ++V KI ES +A++G+N
Sbjct: 421 KASKALAGLVGENDDQTAGIAIVRRALQSPIRQIAENAGVEGSIVVGKILESDSASFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + D+   G+IDP KVVR ALQ+A S+AG+++ TEA +V+
Sbjct: 481 AQTEQYVDLVTDGVIDPAKVVRTALQNAASVAGLLITTEAAIVE 524


>gi|39095|emb|CAA48331.1| groEL [Agrobacterium tumefaciens str. C58]
          Length = 544

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 314/530 (59%), Positives = 415/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKPGASAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPPITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ LATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGERLATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  +GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIALGIVDPVKVVRTALQNAASVASVLITTEAMIAELPKKESA 530


>gi|110678132|ref|YP_681139.1| chaperonin GroEL [Roseobacter denitrificans OCh 114]
 gi|118597092|sp|Q16C40|CH601_ROSDO RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|109454248|gb|ABG30453.1| chaperonin GroEL protein, putative [Roseobacter denitrificans OCh
           114]
          Length = 543

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/542 (58%), Positives = 418/542 (77%), Gaps = 2/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  TAAR  +  GVNTLA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFDTAARSRMLRGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTT+T LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDQAGDGTTTSTVLAQAIVNEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+P+ILI++KK+S+LQPL+P+LES 
Sbjct: 181 KGLETETEVVEGMQFDRGYLSPYFVTNPDKMTAELEDPFILIHEKKLSSLQPLVPLLESI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +IAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQAGKPLLVIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AKKV ++KD+TT+V G G    I+ R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTIDMLGTAKKVAITKDETTVVNGAGEKAEIDARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL  ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES  A +G+N
Sbjct: 421 QGAKALDGLQGANPDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESDDATFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE-TASPQMPAGG 538
           AQ   +GD+F  G+IDP KVVR AL+ A S+AG+++ TEA+V   P  +  ASP MP  G
Sbjct: 481 AQTEEYGDLFSFGVIDPAKVVRTALEDASSVAGLLITTEAMVAVKPAGKGAASPAMPDMG 540

Query: 539 GM 540
           GM
Sbjct: 541 GM 542


>gi|254421167|ref|ZP_05034888.1| chaperonin GroL [Brevundimonas sp. BAL3]
 gi|196183865|gb|EDX78844.1| chaperonin GroL [Brevundimonas sp. BAL3]
          Length = 547

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 318/527 (60%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK ++  T ARD +  GVN LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKIVQFNTDARDKMLRGVNVLANAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+MIR+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDAFENMGAQMIREVASKTNDKAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+  +KA+ KKV +  EI QV TISANGD E+GE IA AM ++G  G+IT+++A
Sbjct: 121 DKAVTAVLADIKASAKKVENNSEIAQVGTISANGDAEVGEMIAKAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+++KK+S+LQ +LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDIEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KDDTTIV G G  E IE RI +I++ IEDT SDY
Sbjct: 301 ISEDLGIKLENVTIDMLGKAKKVTITKDDTTIVDGVGGKEEIEARIGQIKRQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  + GDN DQ AGI I+R+A+  P RQI++NAG E  ++V K+ E+ +A YG+N
Sbjct: 421 KATKALDGLTGDNADQTAGIAIIRRAIQAPIRQIVENAGVEGSIVVGKVLENSSATYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD+  MG+IDP KVVR AL  A S+A +++ TEA V DAPK
Sbjct: 481 AQTEEYGDLVAMGVIDPAKVVRTALTDAASVASILITTEAAVADAPK 527


>gi|116249307|ref|YP_765148.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841]
 gi|118597102|sp|Q1M3H2|CH603_RHIL3 RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|115253957|emb|CAK12352.1| putative 60 kDa chaperonin [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 542

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 318/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +V+  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDNVETANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + P+ + A P MPAG G
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPRKD-APPPMPAGHG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|302381305|ref|YP_003817128.1| chaperonin GroEL [Brevundimonas subvibrioides ATCC 15264]
 gi|302191933|gb|ADK99504.1| chaperonin GroEL [Brevundimonas subvibrioides ATCC 15264]
          Length = 550

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/527 (59%), Positives = 405/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK ++  T AR+ +  GVN LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKQVQFSTDAREKMLRGVNVLANAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+MIR+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDAFENMGAQMIREVASKTNDKAGDGTTTATVLAQSIVQEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+  +KA+ KKV +  EI QV TISANGD E+GE IA AM ++G  G+IT+++A
Sbjct: 121 DKAVTAVLADIKASAKKVENNSEIAQVGTISANGDAEVGEMIAKAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+++KK+S+LQ +LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DI+ + G  V
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDISVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KDDTTIV G G  + IE RI++I+K IEDT SDY
Sbjct: 301 ISEDLGIKLENVTIDMLGKAKKVTITKDDTTIVDGVGGKDEIEARISQIKKQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  + GDN DQ AGI I+R+A+  P RQI++NAG E  ++V K+ E+ +A YG+N
Sbjct: 421 KATKALDGLTGDNADQTAGIAIIRRAIQAPIRQIVENAGVEGSIVVGKVLENTSATYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD+  MG+IDP KVVR AL  A S+A +++ TEA V DAPK
Sbjct: 481 AQTEEYGDLVAMGVIDPAKVVRTALTDAASVASILITTEAAVADAPK 527


>gi|227818822|ref|YP_002822793.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|75519418|sp|Q6W163|CH601_RHISN RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|36959080|gb|AAQ87505.1| 60 kDa chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227337821|gb|ACP22040.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAAKEVRFHTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK N ++V   +EI QV TISANGD EIG  +A A+E++G  G+IT+++A
Sbjct: 121 DKAVDAIVEELKTNARRVTKNDEIAQVGTISANGDIEIGRFLAEAVEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PY+LI++KK+S LQ LLP+LES 
Sbjct: 181 KTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYLLIHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALAT VVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATPVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVVVEKENTTIVDGAGSKSEIQGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S++ +N DQ  GIEIVR+AL  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAVKALDSIRTENADQKHGIEIVRRALEAPVRQIAENAGAEGSIIVGKLREKTEFGFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + FGD+++ G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK +   P MP GGG
Sbjct: 481 AQTNEFGDLYDQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKKDAPLPPMP-GGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|13474837|ref|NP_106407.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452873|sp|Q98AX9|CH603_RHILO RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|14025593|dbj|BAB52193.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
          Length = 552

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 309/530 (58%), Positives = 409/530 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N  K+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVSDVVWTLIKNATKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G  E I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLDMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +G+NA
Sbjct: 421 RASLSINAVGANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|13488302|ref|NP_085869.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452871|sp|Q981J9|CH605_RHILO RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|14028118|dbj|BAB54710.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
          Length = 549

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/530 (58%), Positives = 407/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N KK+ + EE+ QV TI+ NGD  +G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVATLIKNAKKIKTSEEVAQVGTIAGNGDSSVGSMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLVIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A YGYNA
Sbjct: 421 RASLSINAVGANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++  EA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTAEAMIAEAPKKESA 530


>gi|260463304|ref|ZP_05811505.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|259030894|gb|EEW32169.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
          Length = 551

 Score =  635 bits (1638), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 312/530 (58%), Positives = 406/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVAALGKAAKKIKTSEEVAQVGTISANGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +   G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASANIKATGVNADQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QSGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|319784305|ref|YP_004143781.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170193|gb|ADV13731.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 551

 Score =  634 bits (1636), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 312/530 (58%), Positives = 406/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVSALGKAAKKIKTSEEVAQVGTISANGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +   G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASANIKATGVNADQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGDYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|319407640|emb|CBI81289.1| groEL chaperonin [Bartonella sp. 1-1C]
          Length = 547

 Score =  634 bits (1636), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGHKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|319782610|ref|YP_004142086.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168498|gb|ADV12036.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 543

 Score =  634 bits (1636), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 313/529 (59%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHTEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK N +KV   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVDAVVAELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E++ PY+LI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELDEPYVLIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLQMLGRAKKVVIEKENTTIVDGVGRKEEIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL +V+ DN DQ  G++IVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAAKALDTVQTDNSDQRTGVDIVRRAIETPVRQIAENAGAEGSIIVGKLREKSEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ + FGD+F  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK E
Sbjct: 481 AQTNEFGDLFGQGVIDPAKVVRTALQDAASVAGLLVTTEAMVAEKPKKE 529


>gi|540992|pir||B36917 heat shock protein GroEL - Agrobacterium tumefaciens
          Length = 544

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 313/530 (59%), Positives = 413/530 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKPGASAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPPITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ LATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGERLATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L  TRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGVSTEVEVKEKKDRIDDALKPTRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  +GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIALGIVDPVKVVRTALQNAASVASVLITTEAMIAELPKKESA 530


>gi|167648109|ref|YP_001685772.1| chaperonin GroEL [Caulobacter sp. K31]
 gi|189082203|sp|B0SXR2|CH60_CAUSK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|167350539|gb|ABZ73274.1| chaperonin GroEL [Caulobacter sp. K31]
          Length = 548

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/524 (60%), Positives = 406/524 (77%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVN LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADRFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ +KA+ KKV +  EI QV TISANGD+++GE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVHVVVDSIKASSKKVTTNNEIAQVGTISANGDKDVGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + GA V
Sbjct: 241 VQSGRPLVIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGAQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AKKV ++KDDTTIV G G    IE RI +I+K IEDT SDY
Sbjct: 301 ISEDLGIKLENVSLDMLGKAKKVSITKDDTTIVDGVGEKTAIEARIGQIKKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++AL ++ GDN+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+ +  +G+N
Sbjct: 421 KASKALATLVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDSPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA +V+
Sbjct: 481 AQTEQYVDLIADGVIDPAKVVRTALQDAASVAGLLITTEAAIVE 524


>gi|329847960|ref|ZP_08262988.1| chaperonin GroL [Asticcacaulis biprosthecum C19]
 gi|328843023|gb|EGF92592.1| chaperonin GroL [Asticcacaulis biprosthecum C19]
          Length = 549

 Score =  633 bits (1633), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 322/535 (60%), Positives = 412/535 (77%), Gaps = 2/535 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G+ ARD +  GVN LA AVK TLGPKGR V++  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKLVYFGSDARDKMLRGVNILANAVKVTLGPKGRNVVLEKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRYENMGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE +K + KKV S EEI QV TISANGD E+G+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVAVVVEQIKLSSKKVTSNEEIAQVGTISANGDAEVGQMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M A +E+PYIL++DKKIS+LQP+LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNPDKMEAVLEDPYILVFDKKISSLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLRVAAVKAPGFGDRRKAMLEDIAVLTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV ++K++TTIV G G    IE RI++I+K IE+T SDY
Sbjct: 301 ISEDLGIKLETVGLDMLGRAKKVTITKENTTIVDGIGEKSEIEARISQIKKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++AL ++KG N DQ AGI IVRKA+  P RQI +N+G E  ++V+K+  +  AN+G+N
Sbjct: 421 KASKALVNLKGANADQNAGIAIVRKAIQAPLRQIAENSGVEGSVVVNKVLANADANFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS-PQ 533
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA V +APK ++ S PQ
Sbjct: 481 AQTEKYVDLVADGVIDPAKVVRTALQDAASVAGILITTEAAVAEAPKKDSGSQPQ 535


>gi|329891117|ref|ZP_08269460.1| chaperonin GroL [Brevundimonas diminuta ATCC 11568]
 gi|328846418|gb|EGF95982.1| chaperonin GroL [Brevundimonas diminuta ATCC 11568]
          Length = 548

 Score =  633 bits (1633), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/531 (59%), Positives = 409/531 (77%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKIVKFNTDARDKMLKGVNVLADAVKVTLGPKGRNVVIQKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+MIR+VA+   D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDAFENMGAQMIREVASKANDNAGDGTTTATVLAQAIVQEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   ++ +K   K V +  EI QV TISANGD EIGE IA AM ++G  G+IT+++A
Sbjct: 121 DQAVAVALDEVKTISKPVSNNSEIAQVGTISANGDAEIGELIALAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA T V +V+GMQ DRGY+SPYF+T+ ++M   +E P IL+++KK+++LQP+LP+LE+ 
Sbjct: 181 KTAETTVDIVEGMQFDRGYLSPYFITNPDKMEVALEEPLILLHEKKLTSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++KDDTTIV G+G  + IE R+ +I++ IEDT SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGKAKKVSITKDDTTIVEGSGEKDGIEARVGQIKRQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAVL VG  TE  + EKKDR  D+L+ATRAA+DEGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++ L  +KG N DQ AGI IVR+AL  P RQI +N+G E  ++V K+ +S  A++G+N
Sbjct: 421 QASKKLIDLKGVNADQNAGINIVRRALQAPIRQISENSGVEGSIVVGKVMDSTDASFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GD+ +MG+IDP KVVR+AL+SA S+AG+M+ TEA + DAPK  +A
Sbjct: 481 AQTEEYGDLVQMGVIDPAKVVRSALKSAASVAGIMITTEAAIADAPKKASA 531


>gi|146339700|ref|YP_001204748.1| chaperonin GroEL [Bradyrhizobium sp. ORS278]
 gi|187470736|sp|A4YRI5|CH601_BRASO RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|146192506|emb|CAL76511.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. ORS278]
          Length = 539

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 412/537 (76%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V+ LKA+ KK+ S +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVKDLKAHAKKITSNDEIAQVGTISANGDSEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT++E+M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T++ LG AKKVV+ K++TTIV G G  + IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIRLQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L  VK  N DQ AG++I+R+A+  P RQI++NAGD+  L+V K+ E  + ++G+N
Sbjct: 421 RATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGDDGSLVVGKLLEKDSYSWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK--DETASPQM 534
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V D PK  +  A+P M
Sbjct: 481 AATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAETAAAPAM 537


>gi|332188320|ref|ZP_08390046.1| chaperonin GroL [Sphingomonas sp. S17]
 gi|332011633|gb|EGI53712.1| chaperonin GroL [Sphingomonas sp. S17]
          Length = 539

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 317/537 (59%), Positives = 409/537 (76%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFSTDARDRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++IR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLIREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LKA+ +++ +  EI QVATISANGD E+G+ +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAVVDDLKAHARRISANSEIAQVATISANGDTEVGQILAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T+ E++  E+E+PYILI++KK+S LQ L+P+LE  
Sbjct: 181 KSLATELEVVEGMQFDRGYLSPYFITNPEKLRVELEDPYILIHEKKLSNLQALVPLLEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEGDALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 IQSGRPLLIIAEDVEGDALATLVVNKLRGGLQVAAVKAPGFGDRRKAMLEDIAVLTGGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKVV+ KDDTTI+ G G    I+GR  +I++ IE T SDY
Sbjct: 301 VSEDLGIKLENVTVNMLGRAKKVVIDKDDTTIIDGAGQKSDIDGRAAQIRQQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+  ATRAA +EGI+PGGGI L+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAFHATRAAVEEGILPGGGIPLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S+   N+DQ AGIEIVR+AL  P RQI+ NAG++   +V K+ E    N+G+N
Sbjct: 421 RAVKALESLSAANDDQKAGIEIVRRALKAPARQIVDNAGEDGAYVVGKLGEGSDYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    + D+   G+IDP KVVR ALQ A S+AG+++ TEA+V + PKDE  +P +PA
Sbjct: 481 AATGEYEDLVRAGVIDPAKVVRTALQDAASVAGLLITTEALVAELPKDEKPAP-VPA 536


>gi|148254475|ref|YP_001239060.1| chaperonin GroEL [Bradyrhizobium sp. BTAi1]
 gi|187470725|sp|A5EG60|CH603_BRASB RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|146406648|gb|ABQ35154.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 540

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 409/537 (76%), Gaps = 1/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKA+ KK+ S +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAIVADLKAHAKKITSNDEIAQVGTISANGDNEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT++E+M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T++ LG AKKVV+ K++TTIV G G  + IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIKLQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L  VK  N DQ AG++I+R+A+  P RQI++NAG++  L+V K+ E  T ++G+N
Sbjct: 421 RATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGEDGSLVVGKLLEKDTYSWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V D PK   A+   PA
Sbjct: 481 AATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAEATQAAPA 537


>gi|319409219|emb|CBI82863.1| groEL chaperonin [Bartonella schoenbuchensis R1]
          Length = 547

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 314/529 (59%), Positives = 407/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKEVKFGREARERLVRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVVE L    KK+ +  EI QV TISANG  EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DSAVAEVVESLFKKAKKIQTSAEIAQVGTISANGASEIGKIIADAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKICAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G   +I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVHISKENTTIVDGSGQKAQISARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA A++VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANAITVKGSNADQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLISLGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|319404658|emb|CBI78260.1| groEL chaperonin [Bartonella rochalimae ATCC BAA-1498]
 gi|319404677|emb|CBI78279.1| groEL chaperonin [Bartonella rochalimae ATCC BAA-1498]
          Length = 547

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPM +KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMCLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QVATISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVATISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGHKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|319406166|emb|CBI79803.1| groEL chaperonin [Bartonella sp. AR 15-3]
          Length = 550

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 315/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGIKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGRKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKDT 529


>gi|260461328|ref|ZP_05809576.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|319785493|ref|YP_004144969.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032865|gb|EEW34128.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|317171381|gb|ADV14919.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 555

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 310/530 (58%), Positives = 407/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K +K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAVKLVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L  N KK+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVATLIKNAKKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++V G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASLSINVVGVNSDQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|16124938|ref|NP_419502.1| chaperonin GroEL [Caulobacter crescentus CB15]
 gi|221233658|ref|YP_002516094.1| chaperonin GroEL [Caulobacter crescentus NA1000]
 gi|239977086|sp|B8H163|CH60_CAUCN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|239977087|sp|P0CAT9|CH60_CAUCR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|13421906|gb|AAK22670.1| chaperonin, 60 kDa [Caulobacter crescentus CB15]
 gi|220962830|gb|ACL94186.1| chaperonin GroEL [Caulobacter crescentus NA1000]
          Length = 547

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/524 (60%), Positives = 405/524 (77%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVN LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E +K + KKV +  EI QV TISANGD+E+GE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVAIAIEDIKTSSKKVTTNAEIAQVGTISANGDKEVGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + GA V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGAQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE+IG+KLE  ++  LG AKKV ++KDDTTIV G G    IE RI +I++ IEDT SDY
Sbjct: 301 VSEDIGIKLENVSLEMLGRAKKVSITKDDTTIVDGVGEKADIEARIAQIKRQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA+DEGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++AL+ V GDN+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+  + +G+N
Sbjct: 421 KASKALAGVVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDNSAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + D+   G+IDP KVVR ALQ+A S+AG+++ TEA +V+
Sbjct: 481 AQTEQYVDLVVDGVIDPAKVVRTALQNAASVAGLLITTEAAIVE 524


>gi|319899294|ref|YP_004159389.1| groEL chaperonin [Bartonella clarridgeiae 73]
 gi|319403260|emb|CBI76819.1| groEL chaperonin [Bartonella clarridgeiae 73]
          Length = 547

 Score =  632 bits (1630), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 314/529 (59%), Positives = 405/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGASEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M  ++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVTDLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGHKAEITARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL++KG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTIKGKNPDQEAGIHIVRRALQAPARQIATNAGEEAAIIVGKVLENSSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|240851180|ref|YP_002972583.1| chaperonin GroEl [Bartonella grahamii as4aup]
 gi|240268303|gb|ACS51891.1| chaperonin GroEl [Bartonella grahamii as4aup]
          Length = 547

 Score =  632 bits (1630), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 403/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKSEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    YGYN 
Sbjct: 421 RAANALTVKGSNPDQEAGIHIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDT 529


>gi|315498218|ref|YP_004087022.1| chaperonin groel [Asticcacaulis excentricus CB 48]
 gi|315416230|gb|ADU12871.1| chaperonin GroEL [Asticcacaulis excentricus CB 48]
          Length = 547

 Score =  632 bits (1629), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 322/529 (60%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD I  GVN LA AVK TLGPKGR VI+  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVLFSSDARDKILRGVNVLANAVKVTLGPKGRNVILEKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA++IR+VA+ T D +GDGTTTAT LAQAI  EG K V++G NPMD+KRGI
Sbjct: 61  ELADKFENLGAQLIREVASKTNDKAGDGTTTATVLAQAIAVEGLKSVSSGRNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +  +KA+ K V S  EI QV TISANGD E+G+ IA AM ++G  G+IT+++A
Sbjct: 121 DKAVAVAIAEIKASSKPVTSNSEIAQVGTISANGDTEVGQMIADAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A +E+PYILI+DKKIS LQP+LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNPDKMEAVLEDPYILIFDKKISTLQPILPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLRVAAVKAPGFGDRRKAMLEDIAILTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IG+KLE  T+  LG AKKV ++K+ TT+V G G    IEGR+ +I++ IE+T SDY
Sbjct: 301 ISEDIGIKLETVTLDMLGRAKKVTITKETTTVVDGVGEKAEIEGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA DEGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVDEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++ L+ + GDN+DQ AGI IVRKAL  P RQI +NAG E  ++V K+ ES  AN+G+N
Sbjct: 421 KASKKLADLTGDNDDQTAGIAIVRKALQAPIRQISENAGVEGSIVVGKVLESNDANFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+   G+IDP KVVR ALQ A S++G+++ TEA VV+APK E
Sbjct: 481 AQTEKYVDLVADGVIDPAKVVRTALQDAASVSGLLITTEAAVVEAPKKE 529


>gi|304319878|ref|YP_003853521.1| putative heat shock protein groEL [Parvularcula bermudensis
           HTCC2503]
 gi|303298781|gb|ADM08380.1| putative heat shock protein groEL [Parvularcula bermudensis
           HTCC2503]
          Length = 547

 Score =  631 bits (1628), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 307/530 (57%), Positives = 414/530 (78%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA++I++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +V+E +++N   V     I QV TISANG++EIGE IA AME++G  G+IT++++
Sbjct: 121 DLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+MT E+E+PYIL+++KK+S LQ +LP+LESA
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILLHEKKLSNLQSMLPLLESA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG+AK+V ++KD+TTIV G G  + IEGR  +++K IEDT SDY
Sbjct: 301 VSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKDDIEGRTAQLRKQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+AL  ++G N+DQ AGI I+R+A+  P RQI++NAG E  ++V K+ E     +G+N
Sbjct: 421 YAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENAGQEGSIVVGKLLEQDDTKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +G++ +MGI+DP KVVR+ALQ A S+AG+++ TEA++ +APK ++
Sbjct: 481 AQTEEYGNLLDMGIVDPAKVVRHALQDAASVAGLLITTEAMIAEAPKKDS 530


>gi|83591502|ref|YP_425254.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170]
 gi|119366187|sp|Q2RY28|CH601_RHORT RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|83574416|gb|ABC20967.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170]
          Length = 543

 Score =  631 bits (1628), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 316/542 (58%), Positives = 414/542 (76%), Gaps = 4/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSSDARDRLLRGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKSADVAGDGTTTATVLAQAIVREGSKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ +K   +K+ + +EI QV TISANGD E+G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAAVVKDVKTRSRKIATNDEIAQVGTISANGDEEVGKIIARAMDKVGHEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ E+M A++ENPYILI++KK+S LQPLLP+LE+ 
Sbjct: 181 KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILIHEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V +VKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVASVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK V ++KD+TTIV G G    I+ R  +I+  IEDT SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGTAKTVTITKDNTTIVDGAGVKADIDARCAQIRATIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ VG  +E  + EKKDR  D++ ATRAA +EGI+ GGG+AL+
Sbjct: 361 DREKLQERLAKLSGGVAVIRVGGASEVEVKEKKDRVDDAMHATRAAVEEGIIAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+AL ++   N DQ  GIEIVR+AL  P RQI +NAG +  ++  K+ ES  A++GYN
Sbjct: 421 HAAKALDALSPANADQKVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLESSDADFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ  V+ ++ ++G+IDP KVVR ALQ A S+A +++ TEA+V + P+ +   P +PAGGG
Sbjct: 481 AQTGVYENLVKVGVIDPTKVVRTALQGAASVASLLITTEAMVAEIPEKK---PALPAGGG 537

Query: 540 MG 541
           MG
Sbjct: 538 MG 539


>gi|163869040|ref|YP_001610271.1| chaperonin GroEL [Bartonella tribocorum CIP 105476]
 gi|189044129|sp|A9IY10|CH60_BART1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|161018718|emb|CAK02276.1| groEL chaperonin [Bartonella tribocorum CIP 105476]
          Length = 547

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 403/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    YGYN 
Sbjct: 421 RAASALTVKGGNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEMPKKDT 529


>gi|49476034|ref|YP_034075.1| chaperonin GroEL [Bartonella henselae str. Houston-1]
 gi|6226790|sp|O33963|CH60_BARHE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|2358234|gb|AAB69094.1| heat shock protein HSP60 [Bartonella henselae str. Houston-1]
 gi|49203113|emb|CAG44447.1| heat shock protein [Bartonella henselae str. Houston-1]
 gi|49238842|emb|CAF28126.1| Chaperonin protein groEL [Bartonella henselae str. Houston-1]
          Length = 547

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 315/529 (59%), Positives = 403/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKSEINARVNQIKVQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    +GYN 
Sbjct: 421 RAANALTVKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDT 529


>gi|121602875|ref|YP_989430.1| chaperonin GroEL [Bartonella bacilliformis KC583]
 gi|166198436|sp|A1UTX7|CH60_BARBK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|143846|gb|AAA22898.1| immunoreactive protein [Bartonella bacilliformis]
 gi|50404498|gb|AAT76912.1| chaperonin GroEL [Bartonella bacilliformis]
 gi|120615052|gb|ABM45653.1| chaperonin GroL [Bartonella bacilliformis KC583]
          Length = 544

 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 314/528 (59%), Positives = 406/528 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERLLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V A +NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAASMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L    KK+ + EEI QVATISANG  +IG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEAVVADLFKKAKKIQTSEEIAQVATISANGAEDIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT++E+M  ++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNSEKMMVDLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK+ TTIV G G    I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLEMLGRAKKVHVSKETTTIVDGAGQKSEINARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA+ALS+KG N DQ AGI I+R+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAAKALSIKGKNPDQEAGIGIIRRALQAPARQIAHNAGEEAAVIVGKVLENCSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
             + FGD+   GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK E
Sbjct: 481 ATAQFGDLISFGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKE 528


>gi|182678711|ref|YP_001832857.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039]
 gi|226704088|sp|B2ICU4|CH60_BEII9 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|182634594|gb|ACB95368.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 548

 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 309/533 (57%), Positives = 410/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + ARD +  GV  LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+   D++GDGTTTAT LA +I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LKAN KKV S +EI QV TISANGD+ +G+ I+ AM+++G  G+IT+++A
Sbjct: 121 DHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYIL+++KK+S+LQ +LP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T+
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+A LG AK++ + K+ TTI+ G G  + IEGRI++I+  I +T SDY
Sbjct: 301 ISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAVL VG  TE  + EKKDR  D+L+ATRAA +EG+ PGGG+AL+
Sbjct: 361 DREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL ++  DN DQ AGIEIVRKA+  P +QI+ N+G +  ++V K+ ES    +GYN
Sbjct: 421 RAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDM ++GIIDP KVVR ALQ A S+AG+++ TEA + +APK E   P
Sbjct: 481 AQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAPLP 533


>gi|27380338|ref|NP_771867.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|2829663|sp|P77829|CH601_BRAJA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|1613782|gb|AAC44753.1| heat shock protein GroEL1 [Bradyrhizobium japonicum]
 gi|27353502|dbj|BAC50492.1| heat shock protein [Bradyrhizobium japonicum USDA 110]
          Length = 540

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 309/536 (57%), Positives = 409/536 (76%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARDRVLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LKA+ KKV + EEI Q+ATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVNDLKAHAKKVTTNEEIAQIATISANGDIEIGRFLADAMQKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY SPYFVT+ E+M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYASPYFVTNAEKMRVEFEDPYILIHEKKLSTLQSMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL ++AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 VQSGKPLLVVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLKMLGRAKKVVIDKENTTIVNGAGSKKDIEARVTQIKMQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  +AL ++K  N DQ AG++IVR+A+  P RQI++NAG++  L+V K+ E+ + N+G+N
Sbjct: 421 RGLKALDAIKTVNADQKAGVDIVRRAIQVPARQIVQNAGEDGSLVVGKLLENSSYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA++ + PK    +P  P
Sbjct: 481 AASGEYQDLAKAGVIDPAKVVRTALQDAASVAALLITTEALIAEKPKKSEPAPAAP 536


>gi|328545072|ref|YP_004305181.1| 60 kDa chaperonin [polymorphum gilvum SL003B-26A1]
 gi|326414814|gb|ADZ71877.1| 60 kDa chaperonin [Polymorphum gilvum SL003B-26A1]
          Length = 546

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 311/529 (58%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K GT AR+ +  GV+ LA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDVAGDGTTTATVLAQSIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E V+YL AN K + + EE+ QV TISANGD ++G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAAAEAVKYLVANSKTITTSEEVAQVGTISANGDTQVGKDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E PYIL+++KK+S LQ +LPILES 
Sbjct: 181 KSLETELEVVEGMQFDRGYLSPYFVTNAEKMLAELEKPYILLHEKKLSNLQAMLPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGRPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG A+KV +SK++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGKAEKVSISKENTTIVDGAGAKEDIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +  DN D  AGI+IV +AL  P RQI++NAG E  ++V KIQE+   ++G++
Sbjct: 421 RAKSAVEKLTSDNADIQAGIKIVLRALESPIRQIVENAGVEGSIVVGKIQENNDPSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + +M + GIIDP KVVR ALQ A S+AG+++ T A+V + PK E
Sbjct: 481 AQSETYVNMIQAGIIDPTKVVRTALQDAASVAGLLITTGAMVAELPKKE 529


>gi|227821518|ref|YP_002825488.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227340517|gb|ACP24735.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 312/539 (57%), Positives = 408/539 (75%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFNTDARDRMLRGVDIMANAVRVTLGPKGRNVVIDRSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T + +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSEIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LK   ++V   EEI QVATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDALVTELKGKARQVSKNEEIAQVATISANGDAEIGRYLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GMQ DRGY+SPYF+T+ ++M AE+E+ YILI++KK+S LQ ++PILE+ 
Sbjct: 181 KTAQIELEVVEGMQFDRGYLSPYFITNQDKMRAELEDVYILIHEKKLSNLQAMIPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQAGKPLLIIAEDVEGEALATLVVNKLRGGLKISAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AK+V++ KD TTIVGG G  E I GR+ +I+  I++T SDY
Sbjct: 301 VSEDLGIKLENVTMEALGRAKRVMVEKDATTIVGGGGTKEDISGRVAQIKAQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  + L  +  DN+DQ  G+EIVR+A+  P RQI +NAG E  +IV +++E     YG+N
Sbjct: 421 RIVKVLEGLSTDNDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGRLREKTDFAYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   FGD+F MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E   P  PA G
Sbjct: 481 AQTGEFGDLFAMGVIDPAKVVRAALQDAASVAGLLVTTEAMIAEKPKKEGQMPMPPAPG 539


>gi|150396028|ref|YP_001326495.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470719|sp|A6U7N0|CH602_SINMW RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|150027543|gb|ABR59660.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 542

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 408/541 (75%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K+++  + ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAVKEVRFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  L+ N +KV    EI QVATISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVEAIVRELRTNARKVSKNAEIAQVATISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GMQ DRGY+SPYF+T+ E+M  E+E+ YIL+++KK+S LQ ++PILES 
Sbjct: 181 KTAEIELEVVEGMQFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNLQAMIPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKSMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G KLE ATI  LG AK+V++ K+ TTIV G G    I GR+ +I+  IEDT SDY
Sbjct: 301 ISEELGTKLESATIDILGRAKRVMVEKETTTIVDGAGSKADIGGRVAQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R    L+ +   N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E +   +G+N
Sbjct: 421 RVVSVLNGLATANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKEDFAFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD+F+MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK +   PQMP   G
Sbjct: 481 AQTGEFGDLFQMGVIDPAKVVRAALQDAASVAGLLVTTEAMIAEKPKKD-GQPQMPPAPG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|190890943|ref|YP_001977485.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190696222|gb|ACE90307.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
          Length = 542

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 310/529 (58%), Positives = 406/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVGELKANARKISNNSEIAQVGTISANGDSEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    ++GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N+DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDIIKTANDDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKNEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK E
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE 529


>gi|25452890|sp|Q9L691|CH602_RHILE RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|7578866|gb|AAF64160.1|AF239163_2 GroEL [Rhizobium leguminosarum]
          Length = 542

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 312/527 (59%), Positives = 405/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVAAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +VK  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDAVKTANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPK 527


>gi|304393170|ref|ZP_07375098.1| chaperonin GroL [Ahrensia sp. R2A130]
 gi|303294177|gb|EFL88549.1| chaperonin GroL [Ahrensia sp. R2A130]
          Length = 549

 Score =  628 bits (1620), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 305/528 (57%), Positives = 412/528 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA+AVK TLGPKGR VI+  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGSDARTRMMRGVDILADAVKVTLGPKGRNVILDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  LK   KK+ + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++A
Sbjct: 121 DAAVDEVVASLKKMSKKIKTSDEVAQVGTISANGEAEIGGRIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  + + VV+GMQ DRGY+SPYFVT+ E+M  E+++PYIL+++KK+++LQ +LPILE+ 
Sbjct: 181 KSLESTLDVVEGMQFDRGYLSPYFVTNPEKMLCELDDPYILLHEKKLTSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A + G +V
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDLAVLTGGSV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG+AK+V +SK++TT+V G G  + +EGR+++I+K I++T SDY
Sbjct: 301 ISEELGIKLEGVTLDMLGTAKRVSISKEETTLVDGAGKKKDVEGRVSQIKKQIDETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ +G  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVISIGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +  +G+N DQ AG+ IV++AL  P RQI +NAGDE  ++V KI + K+A YGYNA
Sbjct: 421 RASNNMKTEGENADQAAGVAIVKRALQAPIRQIAENAGDEGSVVVGKILDQKSATYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
               +GDM  MGIIDPVKVVR+ALQ A S+A +++ TEA+V + P  E
Sbjct: 481 ANGEYGDMVAMGIIDPVKVVRHALQDAASIASLLITTEAMVAEKPAKE 528


>gi|241113378|ref|YP_002973213.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861586|gb|ACS59252.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 542

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 312/527 (59%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA  EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVQEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +VK  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDNVKTANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPK 527


>gi|152238|gb|AAA26287.1| groEL [Sinorhizobium meliloti]
          Length = 541

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 311/538 (57%), Positives = 407/538 (75%), Gaps = 1/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE  
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLERV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAVHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           AQ + +GD++ MG+IDP KVVR  LQ A S+AG+++ TEA++ + PK E A    P G
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTGLQDAASVAGLLVTTEAMIAEKPKKEAAPAFRPRG 538


>gi|103487560|ref|YP_617121.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
 gi|118597101|sp|Q1GRD4|CH602_SPHAL RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|98977637|gb|ABF53788.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
          Length = 539

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 313/537 (58%), Positives = 409/537 (76%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGSKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV+ L+ + KKV +  EI QVATISANGD E+G  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVKAVVKDLETHAKKVSANSEIAQVATISANGDEEVGRILAEAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+  V+GMQ DRGY+SPYF+T+ E++  E+++PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLATELETVEGMQFDRGYLSPYFITNAEKLKVELDDPYILIHEKKLSNLQAMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKVV+ KD+TTIV G G    I+ RI +I++ I+ T SDY
Sbjct: 301 VSEDLGIKLENVTVNMLGRAKKVVIDKDNTTIVDGVGARTDIDARIAQIRQQIDTTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N+DQ +GI+IVR+AL  P RQI  NAG++   IV K+ ES   N+G+N
Sbjct: 421 RALKALDGLKAANDDQQSGIDIVRRALRAPARQIADNAGEDGAWIVGKLLESSDYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V + PK+E A+P MPA
Sbjct: 481 AATGEYEDLVKAGVIDPAKVVRTALQDAASVAALLITTEALVAELPKEEKAAP-MPA 536


>gi|86356879|ref|YP_468771.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|119366207|sp|Q2KAU2|CH602_RHIEC RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|86280981|gb|ABC90044.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 542

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 309/529 (58%), Positives = 406/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVGELKANARKISNNSEIAQVGTISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    ++GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S+K  N+DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDSIKTANDDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKSDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK E
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE 529


>gi|152232|gb|AAA26283.1| groEL [Sinorhizobium meliloti]
          Length = 541

 Score =  626 bits (1615), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 310/539 (57%), Positives = 409/539 (75%), Gaps = 2/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V+ L+ N +KV    EI QVATISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVEAIVKELRNNARKVSKNAEIAQVATISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GM+ DRGY+SPYF+T+ E+M  E+E+ YIL+++KK+S LQ ++PILES 
Sbjct: 181 KTAEIELEVVEGMEFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNLQAMIPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R  L + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRASLKIAAVKAPGFGDRRKSMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+ +KLE  T+  LG AK++++ K+ TTIV G G  E I GR+ +I+  IEDT SDY
Sbjct: 301 ISEELRIKLENTTMDTLGRAKRIMVDKETTTIVDGAGSKEDIGGRVAQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
               AL+ +   N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E +   +G+N
Sbjct: 421 PVVSALNGLATANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKQDFAFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   FGD+F+MG+IDP KVVR A+Q A S+AG+++ TEA++ + PK +   PQMP GG
Sbjct: 481 AQTGEFGDLFQMGVIDPAKVVRTAVQDAASIAGLLVTTEAMIAEKPKKD-GQPQMPPGG 538


>gi|300024052|ref|YP_003756663.1| chaperonin GroEL [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525873|gb|ADJ24342.1| chaperonin GroEL [Hyphomicrobium denitrificans ATCC 51888]
          Length = 548

 Score =  625 bits (1613), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 311/527 (59%), Positives = 409/527 (77%), Gaps = 2/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFAQDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMLKEVASKTADLAGDGTTTATVLAQAIVREGAKSVAAGSNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAVQ +++ LK N KKV ++++I QV TISANGD  +G+KIA AM+++G  G+IT++++
Sbjct: 121 DLAVQAIIDDLKTNSKKV-TKDQIAQVGTISANGDEVVGKKIAEAMDKVGSEGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT   E+ VV+GMQ DRGY+SPYF+T+ ++M AE+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 180 KTLDFELDVVEGMQFDRGYLSPYFITNADKMIAELESPYILIHEKKLSGLQAMLPVLEAV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 240 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTGGTV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IE R+ +I+  IE+T SDY
Sbjct: 300 ISEDLGIKLETVTLDMLGRAKKVTIDKENTTIVDGSGKKGDIEARVKQIKAQIEETTSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 419

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA++L ++K +N+DQ  GI IVRKAL  P RQI  NAG++  +IV KI E+    YGYN
Sbjct: 420 RAAKSLDALKPENDDQKVGINIVRKALQAPARQIATNAGEDGSVIVGKILENSKYAYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD++  G+IDP KVVR ALQ A S++G+++ TEA++ D PK
Sbjct: 480 AQSHEYGDLYAQGVIDPTKVVRCALQDAASVSGLLITTEAMIADVPK 526


>gi|188584508|ref|YP_001927953.1| chaperonin GroEL [Methylobacterium populi BJ001]
 gi|226704150|sp|B1ZAU5|CH60_METPB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|179348006|gb|ACB83418.1| chaperonin GroEL [Methylobacterium populi BJ001]
          Length = 546

 Score =  625 bits (1612), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 313/531 (58%), Positives = 407/531 (76%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKFVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA Q  V+ + A  KKV S EE+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATQAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVALPMLGRAKRVRIEKENTTIIDGLGEKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESK-TANYGY 478
           RA +A++ +K D  D  AGI+IV KAL  P RQI +NAG E  ++V KI ++  +  YG+
Sbjct: 421 RAKKAVAELKSDVPDVQAGIKIVLKALEAPIRQIAQNAGVEGSIVVGKITDNTGSETYGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           NAQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 NAQTEEYVDMIQSGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 531


>gi|4033510|sp|P35635|CH60_BARBA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; Short=HSP 60;
           AltName: Full=Immunoreactive protein Bb63; AltName:
           Full=Immunoreactive protein Bb65; AltName: Full=Protein
           Cpn60
 gi|397596|emb|CAA78859.1| GroEL [Bartonella bacilliformis]
          Length = 544

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 312/528 (59%), Positives = 404/528 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERLLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V A +NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAASMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L    KK+ + EEI QVATISANG  +IG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEAVVADLFKKAKKIQTSEEIAQVATISANGAEDIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT++E+M  ++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNSEKMMVDLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 AQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK+ TTIV G G    I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLEMLGRAKKVHVSKETTTIVDGAGQKSEINARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG  L+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTPLL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA+ALS+KG N DQ AGI I+R+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAAKALSIKGKNPDQEAGIGIIRRALQAPARQIAHNAGEEAAVIVGKVLENCSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
             + F D+   GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK E
Sbjct: 481 ATAQFRDLISFGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKE 528


>gi|170746968|ref|YP_001753228.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
 gi|226704151|sp|B1LVA0|CH60_METRJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|170653490|gb|ACB22545.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
          Length = 546

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 311/531 (58%), Positives = 411/531 (77%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA Q  V+ + A  KKV + +E+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IEGRI++I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGVGEKSDIEGRISQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTA-NYGY 478
           RA +A++ +K D  D  AGI+IV KAL  P RQI +NAG E  ++V KI ++ ++  +G+
Sbjct: 421 RAKKAVAELKSDIPDVQAGIKIVLKALEAPLRQIAQNAGVEGSIVVGKITDNTSSETFGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           NAQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 NAQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 531


>gi|163758403|ref|ZP_02165491.1| chaperonin GroEL [Hoeflea phototrophica DFL-43]
 gi|162284692|gb|EDQ34975.1| chaperonin GroEL [Hoeflea phototrophica DFL-43]
          Length = 533

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/513 (60%), Positives = 400/513 (77%)

Query: 19  GVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVA 78
           GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGVTVAK I  ++ F  +GA+M+R+VA
Sbjct: 4   GVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVA 63

Query: 79  TNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV 138
           + T D +GDGTT+AT LAQAI  EG K V AG+NPMD+KRG+DLAV EV+  L    KK+
Sbjct: 64  SKTNDIAGDGTTSATVLAQAIVREGAKAVAAGMNPMDLKRGVDLAVTEVIADLLKKAKKI 123

Query: 139 GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRG 198
            +  E+ QV TISANG+ +IG+ IA AM+++G  G+IT+++AKTA +E+ VV+GMQ DRG
Sbjct: 124 KTSAEVEQVGTISANGETQIGKDIAEAMQRVGNEGVITVEEAKTAESELEVVEGMQFDRG 183

Query: 199 YISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDA 258
           Y+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LES  Q+ +PL II+EDVEG+A
Sbjct: 184 YLSPYFVTNPDKMVAELEDAYILLHEKKLSNLQAMLPVLESVVQTSKPLLIISEDVEGEA 243

Query: 259 LATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLG 318
           LATLVVN++R GL + AVKAP FGDRRK +L DIA + G  VISE+IG+KLE  T+  LG
Sbjct: 244 LATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEDIGIKLENVTLEMLG 303

Query: 319 SAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV 378
            AKKV ++K++TTIV G G  + IEGRI +I+  IE+T SDYDR+KL+ERLAKLAGGVAV
Sbjct: 304 RAKKVSITKENTTIVDGAGKKKEIEGRIAQIKAQIEETSSDYDREKLQERLAKLAGGVAV 363

Query: 379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAG 438
           + VG  TE  + E+KDR  D+L+ATRAA  EGIVPGGG AL+RA+ A+ VKG N DQ AG
Sbjct: 364 IRVGGSTEVEVKERKDRVDDALNATRAAVQEGIVPGGGTALLRASGAIKVKGANADQEAG 423

Query: 439 IEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVK 498
           I IVR+AL  PCRQI +NAGDE+ ++V KI + K+  +GYNAQ   +GDM  MGI+DPVK
Sbjct: 424 INIVRRALQAPCRQIAENAGDEASIVVGKILDQKSDTFGYNAQTGEYGDMITMGIVDPVK 483

Query: 499 VVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           VVR ALQ A S+AG+++ TEA++ + PK E A+
Sbjct: 484 VVRTALQDAASVAGLLITTEAMIAELPKKEGAA 516


>gi|254293331|ref|YP_003059354.1| chaperonin GroEL [Hirschia baltica ATCC 49814]
 gi|254041862|gb|ACT58657.1| chaperonin GroEL [Hirschia baltica ATCC 49814]
          Length = 552

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 306/525 (58%), Positives = 406/525 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G+ AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR TKDGVTVAK I
Sbjct: 1   MAAKLVHFGSEARNEMLEGVDILANAVKVTLGPKGRNVVIDKSFGAPRTTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELENKFQNMGAQMVREVASKANDVAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L++N KKV + EEI QV  ISANG+REIG+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVAEVVATLESNSKKVKTNEEIAQVGAISANGEREIGDMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T  E+MT  +++PYIL+++ K+++LQP+LPILE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYLSPYFITDAEKMTVALDDPYILLHESKLTSLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L DI+ + G TV
Sbjct: 241 VQSGKPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDISVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG+AK+V ++KD+T IV G G    IEGR+ +I+  IE+T S+Y
Sbjct: 301 ISEDLGIKLENVSLEMLGTAKRVSITKDETVIVDGAGDKADIEGRVAQIRAQIENTTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ AL VKG N D+ AGI+IV KAL  P RQI++NAG E  ++V+ I   K+ +YG++A
Sbjct: 421 RASSALKVKGSNVDEQAGIDIVTKALQAPLRQIVQNAGVEGSVVVNAILADKSISYGFDA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           QK  + D+   GIIDP KVVR++LQ+A S+A +++ TEA + DAP
Sbjct: 481 QKEEYCDLVAAGIIDPTKVVRSSLQNAASIASLIITTEAAICDAP 525


>gi|170740040|ref|YP_001768695.1| chaperonin GroEL [Methylobacterium sp. 4-46]
 gi|168194314|gb|ACA16261.1| chaperonin GroEL [Methylobacterium sp. 4-46]
          Length = 545

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/529 (58%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFASDAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ ++   KKV + EEI QV TISANGD++IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGDKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGIVPGGGAALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +K DN D  AGI+IV KAL  P RQI  NAG E  ++V K+ E+ +A +G++
Sbjct: 421 RAREAIKDLKSDNADVQAGIKIVLKALEAPIRQIAANAGVEGSIVVGKVAENGSATFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+ + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK E
Sbjct: 481 AQNETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKE 529


>gi|1663718|gb|AAB18635.1| heat shock protein [Caulobacter crescentus CB15]
          Length = 545

 Score =  624 bits (1610), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 315/532 (59%), Positives = 404/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVN LA AVK TLGPKGR V+I  SF APR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFAAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E +K + KKV +  EI QV TISANGD+E+GE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVAIAIEDIKTSSKKVTTNAEIAQVGTISANGDKEVGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+  KK+S+LQPL P+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLSRKKLSSLQPL-PVLEAV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + GA V
Sbjct: 240 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGAQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE+IG+KLE  ++  LG AKKV ++KDDTTIV G G    IE RI +I++ IEDT SDY
Sbjct: 300 VSEDIGIKLENVSLEMLGRAKKVSITKDDTTIVDGVGEKADIEARIAQIKRQIEDTTSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA+DEGIVPGGG AL+
Sbjct: 360 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALL 419

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           +A++A +V GDN+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+  + +G+NA
Sbjct: 420 KASKASAVVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDNSAFGFNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           Q   + D+   G+IDP KVVR ALQ+A S+AG+++ TEA +V +P++    P
Sbjct: 480 QTEQYVDLVVDGVIDPAKVVRTALQNAASVAGLLITTEAAIVVSPQEGRRRP 531


>gi|220920707|ref|YP_002496008.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
 gi|219945313|gb|ACL55705.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
          Length = 545

 Score =  624 bits (1610), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 308/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFASDARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ ++   KKV + EEI QV TISANGD++IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +K DN D  AGI+I+ KAL  P RQI  NAG E  ++V K+ E+ +A +G++
Sbjct: 421 RARDAIKDLKSDNADVQAGIKIIVKALEAPIRQIAANAGVEGSIVVGKVSENGSATFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+ + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK E
Sbjct: 481 AQTETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKE 529


>gi|58040332|ref|YP_192296.1| chaperonin GroEL [Gluconobacter oxydans 621H]
 gi|68566253|sp|Q5FPQ6|CH60_GLUOX RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|58002746|gb|AAW61640.1| Chaperonin GroEL [Gluconobacter oxydans 621H]
 gi|77539353|dbj|BAE46549.1| GroEL [Gluconobacter oxydans]
          Length = 543

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 324/552 (58%), Positives = 413/552 (74%), Gaps = 12/552 (2%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ LK+N KK+ S EEI QV TISANG+ EIGE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++++PYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IG+KLE  T+  LG AKK+ + K++TTIV G G S+ I+GR N+I+  IE+T SDY
Sbjct: 301 ISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ AL  +  DN+DQ  G EIVRKAL  P RQI  NAG++  +I  K+ E++   +G++
Sbjct: 421 RASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP--KDETASPQMPAG 537
           AQK  + D+   GIIDP KVVR ALQ A S+ G+++ TEA+V + P  K   A+P     
Sbjct: 481 AQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPEKKAPAAAP----- 535

Query: 538 GGMGGGMGGMDM 549
               GGMG MD 
Sbjct: 536 ----GGMGDMDF 543


>gi|85709559|ref|ZP_01040624.1| chaperonin GroEL [Erythrobacter sp. NAP1]
 gi|85688269|gb|EAQ28273.1| chaperonin GroEL [Erythrobacter sp. NAP1]
          Length = 550

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 308/536 (57%), Positives = 402/536 (75%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSREAREGILKGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT L QAI  EG   V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLKEVASKTNDLAGDGTTTATVLGQAIAREGMTAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE LKA  K V   EEI QV  ISANGDRE+GEKIA AME++G  G+IT+++A
Sbjct: 121 DLATTKVVENLKARSKDVSGSEEIAQVGVISANGDREVGEKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ ++M  E++NPYILI++KK+S LQ +LP+LE+A
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPDKMQVELDNPYILIHEKKLSNLQAMLPVLEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + KD+TTIV G G  + I+ R+ EI+  I++T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVGEIRTQIDNTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A + L  +KGDN+DQ  GI+IVR+A+  P RQI +NAG +  ++   +      + G+N
Sbjct: 421 YATKVLEGLKGDNDDQTRGIDIVRRAIMAPVRQIAQNAGHDGAVVSGNLLREDNESQGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+ + G+IDP KVVR ALQ A S+AG+++ TEA + DAP+D+ A+P MP
Sbjct: 481 AATDTYEDLVKAGVIDPTKVVRTALQDAASVAGLLITTEAAITDAPEDDKAAPAMP 536


>gi|298290627|ref|YP_003692566.1| chaperonin GroEL [Starkeya novella DSM 506]
 gi|296927138|gb|ADH87947.1| chaperonin GroEL [Starkeya novella DSM 506]
          Length = 545

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 307/527 (58%), Positives = 403/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFAGDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV E ++ +    KKV + +E+ QV TISANGD  IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVVEAIKDISKRAKKVKNTDEVAQVGTISANGDASIGQMIAGAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  ++E+P++LI+DKK+S LQP+LP+LE  
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNAEKMIVDLEDPFLLIFDKKLSGLQPILPVLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE   +A LG AKKV++ K+ TT+V G G  + IEGR+ +I++ IE+T SDY
Sbjct: 301 ISEELGIKLESVNLAMLGRAKKVIIEKEKTTLVDGVGKKKDIEGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  +N D  AGI+IV +AL  P RQI +N+G E  ++V K+ ESK  N+G+N
Sbjct: 421 RAKKAVEKLTSENPDIAAGIKIVLRALEAPIRQIAENSGVEGSIVVGKVLESKDQNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   F DM   GI+DP KVVR ALQ A S++G+++ TEA++ D PK
Sbjct: 481 AQSEQFVDMIASGIVDPAKVVRTALQDAASVSGLLITTEAMIADLPK 527


>gi|325168508|ref|YP_004280298.1| chaperonin GroEL [Agrobacterium sp. H13-3]
 gi|325064231|gb|ADY67920.1| chaperonin GroEL [Agrobacterium sp. H13-3]
          Length = 542

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 405/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ LKAN +K+ S  EI QV TISANGD EIG+ +A AME++G  G+IT+++A
Sbjct: 121 DIAVDAVVKELKANARKITSNSEIAQVGTISANGDEEIGKYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PYIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEEPYILVHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VKSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLEMLGRAKKVAIEKENTTIIDGVGSKGEIDSRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DRDKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  GI+IVR+A+  P RQI +NAG E  ++V K++E    ++G+N
Sbjct: 421 RAVKALDGLPTANDDQRVGIDIVRRAIEAPARQIAENAGAEGSIVVGKLREKTDLSFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPK 527


>gi|307941716|ref|ZP_07657071.1| chaperonin GroL [Roseibium sp. TrichSKD4]
 gi|307775324|gb|EFO34530.1| chaperonin GroL [Roseibium sp. TrichSKD4]
          Length = 546

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 310/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + AR+ +  GV+TLA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSSDARERMLRGVDTLANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVKEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E V+ L+A  K + + EE+ QV TISANGD ++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAAAEAVKALEAASKTITTSEEVAQVGTISANGDVQVGADIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+TE+M A++E PYIL+++KK+S LQ +LPILES 
Sbjct: 181 KSLETELEVVEGMQFDRGYLSPYFVTNTEKMLADLEKPYILLHEKKLSNLQAMLPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+A+KV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGTAEKVNITKENTTIVDGAGEKPDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI+IV +AL  P RQI +NAG E  ++V KIQE+    +G+N
Sbjct: 421 RAKKAVEGLASDNADIAAGIKIVLRALEAPIRQIAENAGVEGSIVVGKIQENDDTTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   F +M E GIIDP KVVR ALQ A S+AG+++ TEA+V + PK E
Sbjct: 481 AQTEEFVNMIEAGIIDPTKVVRTALQDAASVAGLLITTEAMVAELPKKE 529


>gi|323135631|ref|ZP_08070714.1| chaperonin GroEL [Methylocystis sp. ATCC 49242]
 gi|322398722|gb|EFY01241.1| chaperonin GroEL [Methylocystis sp. ATCC 49242]
          Length = 546

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 307/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T ARD I  GV  LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSTDARDRILRGVEVLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+   D +GDGTTTAT LA +I  EG K V AGLNPMD+KRG+
Sbjct: 61  ELSDKFENLGAQLVREVASKQNDIAGDGTTTATVLAASIAKEGAKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LKA+ KKV S +EI QV TISANGDR IGE+IA AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVADLKAHSKKVTSNDEIAQVGTISANGDRFIGEEIAKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE  +V+GMQ DRGY+SPYF+T+ E+M AE+++ Y+LI++KK+S LQPLLPILE+ 
Sbjct: 181 KSLETETDIVEGMQFDRGYLSPYFITNAEKMIAELDDAYLLIHEKKLSTLQPLLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQTGKPLVIVAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G  + IE RI +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGDKKDIEARIAQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EG+ PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  VK  N DQ  G++IVRKA+  P RQI+ NAG +  ++V K+ E+    YG++
Sbjct: 421 RAIKALDGVKTANGDQKTGVDIVRKAIQAPARQIVDNAGGDGAVVVGKLLEATEYGYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQK  FGD+ ++GIIDP KVVR ALQ A S+AG+++ TEA + +APK E
Sbjct: 481 AQKGEFGDLMKLGIIDPTKVVRTALQDAASIAGLIITTEATITEAPKKE 529


>gi|154245114|ref|YP_001416072.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
 gi|154159199|gb|ABS66415.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
          Length = 548

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 313/530 (59%), Positives = 404/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDAREKLLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV   +  ++A  KKV S  E+ QV TISANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAAAIADIRARAKKVSSSAEVAQVGTISANGDASIGEMIAGAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M A++E PY+LI++KK+S LQP+LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNAEKMIADLEEPYLLIFEKKLSGLQPILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGRPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TIA LG AKKV++ K+ TTIV G G    IE R+N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIAQLGRAKKVILEKEKTTIVDGVGEKADIEARVNQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  V  +N D  AGI+IV +AL  P RQI +N+G E  ++V K+QES   N+G+N
Sbjct: 421 RAKKAVELVTSENPDITAGIKIVLRALEAPIRQIAENSGVEGSIVVGKVQESNDPNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK ++
Sbjct: 481 AQSEEYVDMIGAGIVDPAKVVRTALQDAASIAALIVTTEALVAELPKRDS 530


>gi|239948350|ref|ZP_04700103.1| chaperonin GroL [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241563431|ref|XP_002401701.1| chaperonin complex component, TCP-1 eta subunit, putative [Ixodes
           scapularis]
 gi|215501893|gb|EEC11387.1| chaperonin complex component, TCP-1 eta subunit, putative [Ixodes
           scapularis]
 gi|239922626|gb|EER22650.1| chaperonin GroL [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 544

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 310/551 (56%), Positives = 415/551 (75%), Gaps = 9/551 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             KN     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKNKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGAAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA-SPQMPAGG 538
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+   +P      
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKKELTP------ 534

Query: 539 GMGGGMGGMDM 549
            M GGMGGMD 
Sbjct: 535 -MRGGMGGMDF 544


>gi|241518551|ref|YP_002979179.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862964|gb|ACS60628.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 542

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ LKAN +K+ S  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DIAVDAVVKELKANARKITSNSEIAQVGTISANGDEEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEEPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VKSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK V + K++TTI+ G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLNMLGRAKTVSIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  GI+IVR+A+  P RQI +NAG E  ++V K++E    ++G+N
Sbjct: 421 RAVKALDGLPTANDDQRVGIDIVRRAIEAPVRQIAENAGAEGSIVVGKLREKSELSFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPK 527


>gi|163854178|ref|YP_001642221.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|218533123|ref|YP_002423939.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|254564146|ref|YP_003071241.1| 60 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|163665783|gb|ABY33150.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|218525426|gb|ACK86011.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|254271424|emb|CAX27438.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens DM4]
          Length = 546

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/530 (58%), Positives = 403/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADRFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  KKV S EE+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQTGKPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVALPMLGRAKRVRIEKETTTIIDGLGEKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +A++ +K D  D  AGI+IV KAL  P RQI  NAG E  ++V KI ++    +G+N
Sbjct: 421 LAKKAVAELKSDIPDVQAGIKIVLKALEAPIRQIASNAGVEGSIVVGKITDNGGETFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 AQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 530


>gi|13476776|ref|NP_108345.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452872|sp|Q983S4|CH604_RHILO RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|14027537|dbj|BAB53806.1| 60kDa chaperonin; GroEL [Mesorhizobium loti MAFF303099]
          Length = 551

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/530 (58%), Positives = 406/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVSEVVAALGKAAKKIKTSEEVAQVGTISANGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +   G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASANIKAAGANADQAAGINIVRRALQAPARQIASNAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|217976980|ref|YP_002361127.1| chaperonin GroEL [Methylocella silvestris BL2]
 gi|254813895|sp|B8ER20|CH60_METSB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|217502356|gb|ACK49765.1| chaperonin GroEL [Methylocella silvestris BL2]
          Length = 547

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 305/536 (56%), Positives = 407/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + ARD +  G++ L  AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSSDARDRMLRGIDILNNAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA++IR+VA+   D++GDGTTTAT LA +I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELSDKFENLGAQLIREVASKQNDAAGDGTTTATILAASIVREGTKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV  LKAN KKV S EEI QV TISANGD+ +GE I+ AM+++G  G+IT+++A
Sbjct: 121 DIAVAAVVADLKANSKKVTSNEEIAQVGTISANGDKSVGEMISTAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+P+IL+++KK+S+LQ LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPFILVHEKKLSSLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +   T+
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGTL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG+KLE  T+  LG AK++ + K+ TTI+ G G    IE RI +I+  I +T SDY
Sbjct: 301 ISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAV+ VG  +E  + EKKDR  D+L+ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +  +N DQ  G++IVRKA+  P RQI+ N+G +  ++V K+ E+ +  YGYN
Sbjct: 421 RAIKALEGLTVENADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   +GD+ ++GIIDP KVVR ALQ A S+ G+++ TEA++ + PK +  SP MP
Sbjct: 481 AQTDEYGDLVKLGIIDPTKVVRTALQDAASVGGLLITTEAIIAEQPKKD--SPAMP 534


>gi|163850181|ref|YP_001638224.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|163661786|gb|ABY29153.1| chaperonin GroEL [Methylobacterium extorquens PA1]
          Length = 548

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV  LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSVEARDKMLRGVELLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D +GDGTTTAT LA +I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADRFENMGAQMVREVASKSSDIAGDGTTTATVLAASIVREGVKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ +    +KV S EEI QV TISANGD+EIGE IA+AME++G  G+IT+++A
Sbjct: 121 DLAVAAVVKDIGERARKVASSEEIAQVGTISANGDKEIGEMIAHAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+PYILI++KK+ +LQ LLPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMIAELEDPYILIHEKKLGSLQALLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQAGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIALLTKGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLEMLGHAKRVRIDKETTTIIDGAGDKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER AKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERQAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA A A  +  +N D  AGI+IV KAL  P RQI +N+G E  ++V KI  + +A YG+N
Sbjct: 421 RAKAAAQGLTNENPDVQAGIKIVLKALEAPIRQIAQNSGVEGSIVVGKILANSSATYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA++ +AP+ E  +PQMP
Sbjct: 481 AQTEEYVDMLQAGIVDPAKVVRAALQGAASVAGLLVTTEAMISEAPRKE--APQMP 534


>gi|2120418|pir||S70667 chaperonin groEL - Caulobacter crescentus
          Length = 544

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 315/532 (59%), Positives = 404/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+   + ARD +  GVN LA AVK TLGPKGR V+I  SF APR TKDGV+VAK I
Sbjct: 1   MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFAAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E +K + KKV +  EI QV TISANGD+E+GE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVAIAIEDIKTSSKKVTTNAEIAQVGTISANGDKEVGE-IAKAMDKVGNEGVITVEEA 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  ++E P IL+  KK+S+LQPL P+LE+ 
Sbjct: 180 KTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLSRKKLSSLQPL-PVLEAV 238

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + GA V
Sbjct: 239 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGAQV 298

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE+IG+KLE  ++  LG AKKV ++KDDTTIV G G    IE RI +I++ IEDT SDY
Sbjct: 299 VSEDIGIKLENVSLEMLGRAKKVSITKDDTTIVDGVGEKADIEARIAQIKRQIEDTTSDY 358

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA+DEGIVPGGG AL+
Sbjct: 359 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALL 418

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           +A++A +V GDN+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+  + +G+NA
Sbjct: 419 KASKASAVVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDNSAFGFNA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           Q   + D+   G+IDP KVVR ALQ+A S+AG+++ TEA +V +P++    P
Sbjct: 479 QTEQYVDLVVDGVIDPAKVVRTALQNAASVAGLLITTEAAIVVSPQEGRRRP 530


>gi|158423936|ref|YP_001525228.1| chaperonin GroEL [Azorhizobium caulinodans ORS 571]
 gi|187470684|sp|A8I5R5|CH602_AZOC5 RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|158330825|dbj|BAF88310.1| chaperonin [Azorhizobium caulinodans ORS 571]
          Length = 542

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 310/524 (59%), Positives = 401/524 (76%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFAGDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGSKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V+ L A  KKV S  EI QV TISANGD ++G+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAIVKDLAAKAKKVTSNAEIAQVGTISANGDADVGKFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E E+PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMRVEFEDPYILIHEKKLSNLQELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQSGKPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   ++ LG AKKVV+ K++TTIV GNG    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVNLSMLGRAKKVVIEKENTTIVDGNGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L  +K +N DQ  GI+IVR+A+  P RQI+ NAGD+  ++V KI E++T  +GYN
Sbjct: 421 RAIKVLEGLKVENTDQKTGIDIVRRAIQAPARQIVANAGDDGSVVVGKILENETYTFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + DM   GIIDP KVVR ALQ A S++ +++ TEA+VV+
Sbjct: 481 AQTGEYVDMVASGIIDPAKVVRTALQDAASISALIITTEALVVE 524


>gi|298292072|ref|YP_003694011.1| chaperonin GroEL [Starkeya novella DSM 506]
 gi|296928583|gb|ADH89392.1| chaperonin GroEL [Starkeya novella DSM 506]
          Length = 545

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 405/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFSGDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LK N +KV S EEI QV TISANGD ++G+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVADLKKNARKVTSNEEIAQVGTISANGDADVGKFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  E E+PYILI++KK+S LQ LLP+LES 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMRVEFEDPYILIHEKKLSGLQELLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G T 
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KL+  T+A LG AKKVV+ K++TTIV G G  + I  R+++I+  IE+T SDY
Sbjct: 301 ISDDLGIKLDSVTLAMLGRAKKVVIEKENTTIVDGAGSKKDINDRVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L ++   N DQ  G++IVRKA+  P RQI  NAG++  LIV +I E  T  YG+N
Sbjct: 421 RATKVLENIATANPDQKTGVDIVRKAIQAPARQIASNAGEDGSLIVGRILEKNTYAYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DMF+ G+IDP KV+R++LQ+A S+A +++ TEA++ + PK
Sbjct: 481 AQSGEYVDMFKAGVIDPAKVLRSSLQNAASVASLLITTEAMIAELPK 527


>gi|299134195|ref|ZP_07027388.1| chaperonin GroEL [Afipia sp. 1NLS2]
 gi|298590942|gb|EFI51144.1| chaperonin GroEL [Afipia sp. 1NLS2]
          Length = 550

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 310/536 (57%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  V++ ++   K V S  E+ QV TISANGD  IG  IA AM+++G  G+IT+++A
Sbjct: 121 DIAVAAVIKDIEKRAKPVASSSEVAQVGTISANGDSTIGSMIAKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+++ YIL+++KK++ LQ +LP+LE+ 
Sbjct: 181 KSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTAELDDAYILLHEKKLTGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AED+EG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIVAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK V+ K++TTIVGG G    IE R+N+I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTLKQLGRAKKAVIDKENTTIVGGAGKKADIEARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PK+  ++P MP
Sbjct: 481 AQNEEYVDMVAKGIIDPAKVVRTALQDAASVAGLLVTTEAMVAELPKE--SAPAMP 534


>gi|83591926|ref|YP_425678.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170]
 gi|119366211|sp|Q2RWV4|CH602_RHORT RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|83574840|gb|ABC21391.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170]
          Length = 548

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 309/533 (57%), Positives = 406/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V++  S+GAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K   KK+ +  E+ QV TISANGD E+G+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ E+M A++ENPYIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AKKV ++K++TT+V G G  + IE R ++I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKKDR  D++ ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A ++L SVKG N DQ  GIEIVR+AL  P RQI +NAG +  ++  K+ E+   ++GYN
Sbjct: 421 HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ  ++ ++   G+IDP KVVR ALQ A S+AG+++ TEA+V + P+ + A P
Sbjct: 481 AQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAMP 533


>gi|296115122|ref|ZP_06833763.1| chaperonin GroEL [Gluconacetobacter hansenii ATCC 23769]
 gi|295978223|gb|EFG84960.1| chaperonin GroEL [Gluconacetobacter hansenii ATCC 23769]
          Length = 549

 Score =  618 bits (1593), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 407/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDEARRRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG++EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVGAVVEELKKNTKKITTPAETAQVGTISANGEKEIGEMISQAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MT ++++PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNAEKMTVDLDSPYILIHEKKLSSLQPMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G  E I+GR ++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLNMLGTAKKVHIDKENTTIVEGAGEGEAIKGRCSQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L+ +   NEDQ  G +I+RKAL  P RQI  NAG++  +I  K+ E++T  YG++
Sbjct: 421 RASTTLAHLHFHNEDQRVGADIIRKALQAPLRQIAHNAGEDGAVIAGKVLENETYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ+  + D+   GIIDP+KVVR ALQ A S+AG+++ TEA+V + P  E  +P MP
Sbjct: 481 AQEGTYKDLVAAGIIDPMKVVRTALQDAASVAGLLITTEAMVAERP--EKKAPAMP 534


>gi|222102161|ref|YP_002546751.1| chaperonin GroL [Agrobacterium radiobacter K84]
 gi|221728278|gb|ACM31287.1| chaperonin GroL [Agrobacterium radiobacter K84]
          Length = 542

 Score =  617 bits (1591), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/539 (56%), Positives = 405/539 (75%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARQRLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNP D+KRGI
Sbjct: 61  ELEDKFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGLNPQDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E +  +K   +KV S EE+ QV TISANG+ EIG+ IA A++++G  G+IT+++A
Sbjct: 121 DLAATEAIRSIKERSRKVASSEEVAQVGTISANGESEIGKLIAEAVQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+G+Q DRGY+SPYFVT+ E++  E E+ YIL+++KK++ LQPLLP+LE+ 
Sbjct: 181 KSFETELDVVEGLQFDRGYLSPYFVTNAEKLIVEFEDAYILLHEKKLATLQPLLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA V G  V
Sbjct: 241 VQTGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKALLEDIAIVTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE+IG+KLE  T+  LG AKK+ + K+ TT+V G G    I  R+ +I+  IEDT SDY
Sbjct: 301 VSEDIGIKLENVTLDQLGRAKKIRIDKETTTVVDGAGEKAEIAARVQQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGSTEIEVKEKKDRVDDALNATRAAIEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++K DN D  AGI I++KAL  P RQI +NAG E  ++V K+ ES +  +G+N
Sbjct: 421 RAKTAVNALKNDNPDIQAGIHILQKALEAPIRQIAENAGVEGSIVVGKVLESNSPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   + D+ + GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++T +P  P GG
Sbjct: 481 AQTEKYVDLLQEGIVDPTKVVRTALQDAASVAGLLVTTEALIAEVPKEKTPTPAAPGGG 539


>gi|75676377|ref|YP_318798.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255]
 gi|119366204|sp|Q3SQJ5|CH602_NITWN RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|74421247|gb|ABA05446.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255]
          Length = 545

 Score =  617 bits (1591), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 308/527 (58%), Positives = 403/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S EEI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLSRNSKKVTSNEEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ E+M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNAEKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV KI E +  +YG++
Sbjct: 421 RASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   +G++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQTGDYGNLISKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPK 527


>gi|209965873|ref|YP_002298788.1| chaperonin GroL, putative [Rhodospirillum centenum SW]
 gi|226704163|sp|B6IU98|CH60_RHOCS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|209959339|gb|ACI99975.1| chaperonin GroL, putative [Rhodospirillum centenum SW]
          Length = 546

 Score =  617 bits (1591), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/527 (57%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGSDARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA  T D +GDGTTTAT LAQAI  EG K + AG+NPMD+KRG+
Sbjct: 61  ELSDKFENMGAQMVKEVAQKTADLAGDGTTTATVLAQAIVREGAKAIAAGMNPMDVKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AVQ VV+ +K+  +KV + +EI QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DVAVQTVVDDIKSRSRKVTTNDEIAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+PYIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KALETELDVVEGMQFDRGYLSPYFVTNADKMVAELESPYILLFEKKLSGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 VQSSRPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDMAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  ++  LG AKKVV++KD+TTIV G G  E I+ RI +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLENVSLEMLGQAKKVVITKDNTTIVDGAGSKEDIQARIVQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +   NEDQ  GI+IVRKAL  P RQI +NAG +  +IV K+ E    N+G+N
Sbjct: 421 YATKALDKLTAVNEDQKFGIDIVRKALQAPVRQIAQNAGFDGSVIVGKLLEKGETNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA++ + P+
Sbjct: 481 AQAGEYGDMFKFGVIDPTKVVRAALQDAASVAGLLITTEAMIGEKPE 527


>gi|86748959|ref|YP_485455.1| chaperonin GroEL [Rhodopseudomonas palustris HaA2]
 gi|119366185|sp|Q2IZ16|CH601_RHOP2 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|86571987|gb|ABD06544.1| chaperonin GroEL [Rhodopseudomonas palustris HaA2]
          Length = 550

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGGDARDRMLRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD++RGI
Sbjct: 61  ELDDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AVQ VV+ ++   + V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVQAVVKDIQKRARPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDVYILLHEKKVSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG+KLE  T+  LG AKKVV+ K++TTIVGG G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGIKLESVTLKMLGRAKKVVIDKENTTIVGGAGKKPDIEARVQQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRIHNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK+  A+P MP
Sbjct: 481 AQTEDYVDMLAKGIVDPAKVVRTALQDASSVAALLVTTEAMVAELPKE--AAPAMP 534


>gi|92118107|ref|YP_577836.1| chaperonin GroEL [Nitrobacter hamburgensis X14]
 gi|119366203|sp|Q1QK71|CH602_NITHX RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|91801001|gb|ABE63376.1| chaperonin GroEL [Nitrobacter hamburgensis X14]
          Length = 546

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/527 (58%), Positives = 405/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S +EI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVRNSKKVTSNDEIAQVGTISANGDSEIGKFLANAMKRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLAMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV KI E +  +YG++
Sbjct: 421 RASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   +G++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQSGEYGNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPK 527


>gi|85373658|ref|YP_457720.1| chaperonin GroEL [Erythrobacter litoralis HTCC2594]
 gi|123409666|sp|Q2NBL8|CH601_ERYLH RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|84786741|gb|ABC62923.1| heat shock protein [Erythrobacter litoralis HTCC2594]
          Length = 539

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 309/537 (57%), Positives = 407/537 (75%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NP+D+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPIDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ L+++ KKV +  EI QVATISANGD  +G  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVGTVVKDLESHAKKVSANSEIAQVATISANGDETVGRFLAEAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+  V+GMQ DRGY+SPYFVT+TE++  E+E+PYILI++KK+S LQ L+P+LE  
Sbjct: 181 KSLETELETVEGMQFDRGYLSPYFVTNTEKLKVELEDPYILIHEKKLSNLQALIPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDVAILTAGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G KLE  TI  LG AKKV++ KD+TTIV G G    I+ R+++I+  IE T SDY
Sbjct: 301 VSEELGTKLENVTIGMLGRAKKVIIDKDNTTIVDGAGNKADIDARVSQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA ++L  +K  N+DQ +GI+IVR+AL  P RQI +NAG++   IV K+ E    N+G+N
Sbjct: 421 RALKSLDGLKAANDDQQSGIDIVRRALRAPARQIAENAGEDGAYIVGKLLEGDDYNHGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V + PK++T +P MPA
Sbjct: 481 AATGEYEDLVKSGVIDPAKVVRTALQDAASVASLLITTEALVAELPKEDTPAP-MPA 536


>gi|162147833|ref|YP_001602294.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542454|ref|YP_002274683.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
 gi|187470746|sp|A9HK37|CH601_GLUDA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|161786410|emb|CAP55992.1| 60 kDa chaperonin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530131|gb|ACI50068.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
          Length = 547

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 312/527 (59%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG+ EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVIAVVEELKKNTKKITTPAETAQVGTISANGEHEIGEMISQAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYF+T+ E+M A+++NPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFITNAEKMVADLDNPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV + K++TTIV G G S+ I+GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLAMLGRAKKVRIEKENTTIVEGAGASDDIKGRCGQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ AL ++   N+DQ  G EI+RKAL  P RQI  NAG++  +I  K+ ES   NYG++
Sbjct: 421 RASTALGNLHFHNDDQRVGAEIIRKALQAPLRQIAHNAGEDGAVIAGKVLESNDYNYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + D+   GIIDP KVVR ALQ A S+AG+++ TEA+V + P+
Sbjct: 481 AQIGDYKDLVAAGIIDPTKVVRTALQDASSVAGLLITTEAMVAEKPE 527


>gi|159045459|ref|YP_001534253.1| chaperonin GroEL [Dinoroseobacter shibae DFL 12]
 gi|189082351|sp|A8LJP9|CH60_DINSH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157913219|gb|ABV94652.1| 60 kDa chaperonin [Dinoroseobacter shibae DFL 12]
          Length = 547

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 305/529 (57%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDIDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKSAARPVNDSAEVAQVGTISANGESEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDAIILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTIDMLGSAKRVSITKDETTIVDGAGAKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L  ++G N DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAAKHLDGLEGANNDQNIGINIVRKALEAPLRQIAENAGVDGSVVAGKIRESSDLAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADKPAKE 529


>gi|85375707|ref|YP_459769.1| chaperonin GroEL [Erythrobacter litoralis HTCC2594]
 gi|123293630|sp|Q2N5R9|CH602_ERYLH RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|84788790|gb|ABC64972.1| 60 kDa chaperonin, GroEL [Erythrobacter litoralis HTCC2594]
          Length = 550

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/531 (57%), Positives = 400/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ I  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGRDAREGILKGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ +  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKYENMGAQMLREVASKTNDLAGDGTTTATVLGQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV +VVE LK+  K V   EEI QV  ISANGDRE+GEKIA AME++G  G+IT+D++
Sbjct: 121 DIAVTKVVENLKSRSKDVAGSEEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+  V+GMQ DRGY+SPYF+T+ ++MT E+ENPYILI++KK+S LQ +LPILE+A
Sbjct: 181 KGLEFELETVEGMQFDRGYLSPYFITNPDKMTVELENPYILIHEKKLSNLQAMLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + KD+TTIV G G    I+ R+NEI+  I++T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGDEADIKARVNEIRTQIDNTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A + L  +KG+N+DQ  GI+IVRKA+  P RQI  NAG +  +I   +      + G+N
Sbjct: 421 YATKVLEGLKGENDDQTRGIDIVRKAIVAPVRQIATNAGHDGAVISGNLLREDNESQGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    + D+ + G+IDP KVVR ALQ A S+AG+++ TEA + + P+D+++
Sbjct: 481 AATDTYEDLVKAGVIDPTKVVRVALQDAASVAGLLITTEAAISEVPEDKSS 531


>gi|114569155|ref|YP_755835.1| chaperonin GroEL [Maricaulis maris MCS10]
 gi|122316675|sp|Q0AS40|CH60_MARMM RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|114339617|gb|ABI64897.1| chaperonin GroEL [Maricaulis maris MCS10]
          Length = 551

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/529 (57%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G+ AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVLFGSDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDVAGDGTTTATVLAQSIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ +KA+   V    E+ QV TISANG  +IGE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVAIVMDDIKASSTPVKDSSEVAQVGTISANGASDIGEMIAKAMDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T  ++M  E+E PYIL+++KK+++LQP+LPILE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYLSPYFITDADKMQVEMEEPYILLFEKKLTSLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAK+V ++KDDTTIV G G   +IE R+ +I++  E+T SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGSAKRVNITKDDTTIVDGVGDKAQIEARVTQIRRQSEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A+  L+ ++GDN DQ  GI IV +AL  P RQI  N+G E  ++V K+ E+ +A +G+N
Sbjct: 421 KASAKLAGLEGDNADQTQGIAIVARALQSPIRQIATNSGVEGSIVVGKVMENPSATFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDM   G+IDP KVVR ALQ A S+A +++ TEA V DAPK+E
Sbjct: 481 AQTEEYGDMLAFGVIDPAKVVRTALQDAASVASLLITTEAAVADAPKEE 529


>gi|220921759|ref|YP_002497060.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
 gi|219946365|gb|ACL56757.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
          Length = 548

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/529 (57%), Positives = 402/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSSDARERMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE LK N +K+   +EI Q+ TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVAAVVEDLKQNSRKITKNDEIAQIGTISANGDAEIGRMLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA A A  V  DN D  AGI IV +AL  P RQI +NAG E  ++V K+ E+ + ++G++
Sbjct: 421 RAKAAAHGVTSDNTDVQAGINIVVRALEAPIRQIAENAGVEGSVVVGKLIENSSRSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   F D+ + GI+DP KVVR ALQ A S+AG+++ TEA+V +APK E
Sbjct: 481 AQTETFVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVAEAPKKE 529


>gi|38422329|emb|CAE45331.1| unnamed protein product [Magnetospirillum gryphiswaldense]
 gi|144898661|emb|CAM75525.1| 60 kDa chaperonin 5 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 547

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/527 (58%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTEARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D  GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVREVASKTADLVGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  +K+  KKV + EEI QV TISANG+R+IG KIA AM ++G  G+IT+++A
Sbjct: 121 DLAVEAVVADVKSRAKKVSTNEEIAQVGTISANGERDIGAKIAEAMSKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E+++PYIL+++KK+S LQPLLP+LE+ 
Sbjct: 181 KGFETELDVVEGMQFDRGYSSPYFVTNAEKMTCELDSPYILLFEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V ++K+DTTIV G G    IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLEMLGTAKRVTITKEDTTIVDGAGARGDIEARCKQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            + +AL  +   N DQ  GI+IVR+AL  P RQI +NAG +  ++  K+ E+   N+G++
Sbjct: 421 YSVRALDGIAVANNDQKVGIDIVRRALQSPVRQIAENAGHDGAVVAGKLLEATDTNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DM + GIIDPVKVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGTYVDMIKAGIIDPVKVVRTALQDAASVAGLLITTEAMIAEKPK 527


>gi|99080438|ref|YP_612592.1| chaperonin GroEL [Ruegeria sp. TM1040]
 gi|118597124|sp|Q1GJ36|CH60_SILST RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|99036718|gb|ABF63330.1| chaperonin GroEL [Ruegeria sp. TM1040]
          Length = 547

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/533 (57%), Positives = 408/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES+  N+G+N
Sbjct: 421 QAGKSLEGLTGVNADQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESEDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPAKEGAAP 533


>gi|332187441|ref|ZP_08389179.1| chaperonin GroL [Sphingomonas sp. S17]
 gi|332012602|gb|EGI54669.1| chaperonin GroL [Sphingomonas sp. S17]
          Length = 547

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/537 (57%), Positives = 405/537 (75%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSRDARERIMKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV +VVE +KA  K V    E+ QV  ISANGDRE+GEKIA AME++G  G+IT+++A
Sbjct: 121 DIAVTKVVEDIKARSKPVSGSNEVAQVGIISANGDREVGEKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+MT E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELNDPYILIHEKKLSNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V + KD+TTIV G G +E I+GR   I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTVGMLGTAKRVTIDKDNTTIVDGAGDAEAIKGRTEAIRAQIENTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  VKG N+DQ  GI+IVRK+L+   RQI +NAG +  ++  K+ +    ++G+N
Sbjct: 421 YATKALDGVKGVNDDQTRGIDIVRKSLTALVRQIAQNAGHDGAVVSGKLLDQTDTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    + ++   G+IDP KVVR ALQ+A S+AG+++ TEA V + P+D+  SP MPA
Sbjct: 481 ASTDTYENLVAAGVIDPTKVVRTALQNAASVAGLLITTEATVAELPEDK--SPAMPA 535


>gi|170743558|ref|YP_001772213.1| chaperonin GroEL [Methylobacterium sp. 4-46]
 gi|168197832|gb|ACA19779.1| chaperonin GroEL [Methylobacterium sp. 4-46]
          Length = 551

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 406/536 (75%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE LK N +K+   +EI Q+ TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVAAVVEDLKQNSRKITRNDEIAQIGTISANGDAEIGRMLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D++ ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAMHATRAAVEEGIVPGGGAALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A   VK DN D  AGI IV +AL  P RQI +NAG E  ++V K+ E+ +A +G++
Sbjct: 421 RAKAAAQGVKSDNPDVQAGINIVVRALEAPIRQIAENAGVEGSIVVGKVAENGSATFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+ + GI+DPVKVVR ALQ A S+AG+++ TEA+V DAPK E A P MP
Sbjct: 481 AQNETYVDLIQAGIVDPVKVVRTALQDAASVAGLLVTTEAMVADAPKKE-APPAMP 535


>gi|259419033|ref|ZP_05742950.1| chaperonin GroL [Silicibacter sp. TrichCH4B]
 gi|259345255|gb|EEW57109.1| chaperonin GroL [Silicibacter sp. TrichCH4B]
          Length = 547

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/533 (57%), Positives = 408/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES+  N+G+N
Sbjct: 421 QAGKSLDGLTGVNADQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESEDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPAKEGAAP 533


>gi|89069034|ref|ZP_01156415.1| chaperonin GroEL [Oceanicola granulosus HTCC2516]
 gi|89045403|gb|EAR51468.1| chaperonin GroEL [Oceanicola granulosus HTCC2516]
          Length = 548

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 305/536 (56%), Positives = 410/536 (76%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFETDARNRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +KA  + V + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVAQIKAAARTVENSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+TE+M AE+++  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNTEKMVAELDDCMILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V ++KD+TTIV G+G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTMDMLGTAKRVSITKDETTIVDGHGDKAEIEARVSQIRGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A++L  +  +N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QGAKSLEGLTAENSDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ E A+   P
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMVADKPQKEGAAAGAP 536


>gi|163745715|ref|ZP_02153075.1| chaperonin GroEL [Oceanibulbus indolifex HEL-45]
 gi|161382533|gb|EDQ06942.1| chaperonin GroEL [Oceanibulbus indolifex HEL-45]
          Length = 548

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 303/529 (57%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG++EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARDVSDSDEVAQVGTISANGEKEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDAIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD T +V G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVSITKDATIVVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVRERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKKLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPSKE 529


>gi|126461754|ref|YP_001042868.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17029]
 gi|166201744|sp|A3PID0|CH60_RHOS1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|126103418|gb|ABN76096.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17029]
          Length = 547

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/537 (56%), Positives = 407/537 (75%), Gaps = 6/537 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+++ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKK+ ++KD+TTIV GNG    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKISINKDNTTIVDGNGDKAEIDARVAQIRNQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QGGKALDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESNEKSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+     P+ PA
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPE-----PKSPA 532


>gi|154248184|ref|YP_001419142.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
 gi|154162269|gb|ABS69485.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
          Length = 543

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 321/542 (59%), Positives = 413/542 (76%), Gaps = 3/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V+ L +N +KV S +EI QV TISANGD E+G+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E PYILI +KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 VQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KL+   ++ LG AKKVV+ K++TTIV G+G    IE RI +I+  IE T SDY
Sbjct: 301 ISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K +ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R+ +AL  +K DN DQ  GIEIVR+A+  P RQI+ NAGD+  ++V KI ES   ++GYN
Sbjct: 421 RSIKALEGLKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP-KDETASPQMPAGG 538
           AQ   + DM + GIIDP KVVR ALQ A S++G+++ TEA++ + P K+  A+P MP GG
Sbjct: 481 AQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNAPAAPAMP-GG 539

Query: 539 GM 540
           GM
Sbjct: 540 GM 541


>gi|77462862|ref|YP_352366.1| chaperonin GroEL [Rhodobacter sphaeroides 2.4.1]
 gi|221638732|ref|YP_002524994.1| chaperonin GroEL [Rhodobacter sphaeroides KD131]
 gi|332557753|ref|ZP_08412075.1| chaperonin GroEL [Rhodobacter sphaeroides WS8N]
 gi|2506273|sp|P20110|CH601_RHOSH RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|119366188|sp|Q3J419|CH601_RHOS4 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|1208543|gb|AAB41336.1| chaperonin 60 [Rhodobacter sphaeroides]
 gi|77387280|gb|ABA78465.1| Chaperonin Cpn60 (GroEL) [Rhodobacter sphaeroides 2.4.1]
 gi|221159513|gb|ACM00493.1| 60 kDa chaperonin 1 [Rhodobacter sphaeroides KD131]
 gi|332275465|gb|EGJ20780.1| chaperonin GroEL [Rhodobacter sphaeroides WS8N]
          Length = 547

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 304/537 (56%), Positives = 407/537 (75%), Gaps = 6/537 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+++ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKK+ ++KD+TTIV GNG    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKISINKDNTTIVDGNGDKAEIDARVAQIRNQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QGGKALDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESNEKSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+     P+ PA
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPE-----PKSPA 532


>gi|146278225|ref|YP_001168384.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025]
 gi|25452866|sp|Q93MH1|CH60_RHOPA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166201745|sp|A4WUL5|CH60_RHOS5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15290745|gb|AAK94943.1| GroEL [Rhodopseudomonas palustris]
 gi|145556466|gb|ABP71079.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025]
          Length = 546

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 303/531 (57%), Positives = 406/531 (76%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V  + E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVESIKAASRPVNDQHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+E+ +IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELEDVFILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQAQRPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KD+TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKVLDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESDDKAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+ ++A
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPEPKSA 531


>gi|296282021|ref|ZP_06860019.1| chaperonin GroEL [Citromicrobium bathyomarinum JL354]
          Length = 546

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 306/531 (57%), Positives = 398/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ I  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGREAREGILRGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+MI++VA+   D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMIKEVASKANDAAGDGTTTATVLAQAIVTEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV +VVE LK   K V    EI QV  ISANGD+E+GEKIA AME++G  G+IT+D++
Sbjct: 121 DIAVTKVVEDLKGRSKDVSGSSEIAQVGVISANGDKEVGEKIAEAMEKVGKEGVITVDES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+  V+GMQ DRGY+SPYF+T+ ++MT E+++PYILI++KK+S LQ +LPILE+A
Sbjct: 181 KGLEFELETVEGMQFDRGYLSPYFITNPDKMTVELDDPYILIFEKKLSNLQAMLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AK+V + KD+TTIV G G    IE R+NEI+  I++T SDY
Sbjct: 301 VSEDLGIKLENVTLNMLGQAKRVTIDKDNTTIVDGAGEQADIEARVNEIRTQIDNTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++AL  +KGDNEDQ  GI IVRKA+  P RQI  NAG +  ++   +        G+N
Sbjct: 421 YASKALEGLKGDNEDQTRGIAIVRKAILAPIRQIATNAGHDGAVVSGNLLREGDETQGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    + ++ + G+IDP KVVR ALQ A S+AG+++ TEA + + P+D+ A
Sbjct: 481 AGTDTYENLVKAGVIDPTKVVRTALQGAASVAGLLITTEAAISEVPEDKNA 531


>gi|149203312|ref|ZP_01880282.1| chaperonin GroEL [Roseovarius sp. TM1035]
 gi|149143145|gb|EDM31184.1| chaperonin GroEL [Roseovarius sp. TM1035]
          Length = 546

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 405/531 (76%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVRFNTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAASRPVNDSAEVAQVGTISANGEAEIGRQIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMVADLEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV ++KD TTIV G G    IE R+++I++ IEDT SDY
Sbjct: 301 ISEDLGMKLENVGMDMLGRAKKVSITKDATTIVDGAGEKAEIEARVSQIRQQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L+ ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES  A +GYN
Sbjct: 421 QAAKKLAGLEGVNSDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESSDAKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ E A
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDASSIAGLLITTEAMVADKPQKENA 531


>gi|260425778|ref|ZP_05779758.1| chaperonin GroL [Citreicella sp. SE45]
 gi|260423718|gb|EEX16968.1| chaperonin GroL [Citreicella sp. SE45]
          Length = 546

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR  +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARTRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARPVNDTNEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTVDMLGSAKKVSITKDETTIVDGAGEKAEIEARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A++L  ++G N DQ AGI IVRKAL  P RQI +NAG +  ++  KI+ES+   +GYN
Sbjct: 421 QGAKSLDGLEGANSDQNAGITIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQ 527


>gi|83854816|ref|ZP_00948346.1| chaperonin GroEL [Sulfitobacter sp. NAS-14.1]
 gi|83941339|ref|ZP_00953801.1| chaperonin GroEL [Sulfitobacter sp. EE-36]
 gi|83842659|gb|EAP81826.1| chaperonin GroEL [Sulfitobacter sp. NAS-14.1]
 gi|83847159|gb|EAP85034.1| chaperonin GroEL [Sulfitobacter sp. EE-36]
          Length = 549

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/526 (57%), Positives = 402/526 (76%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K GT AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFGTDARNKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A   VVE +KA  + V   +E+ QV TISANG++EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATTTVVEAIKAAARPVNDSDEVAQVGTISANGEKEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDAIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVTITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKKLEGLTGDNADQNVGIGIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKP 526


>gi|85715613|ref|ZP_01046593.1| chaperonin GroEL [Nitrobacter sp. Nb-311A]
 gi|85697552|gb|EAQ35429.1| chaperonin GroEL [Nitrobacter sp. Nb-311A]
          Length = 546

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 307/530 (57%), Positives = 403/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AV+ TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGVDARDKMLRGVDILANAVRVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  L  N KKV S EEI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAVVADLVRNSKKVTSNEEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ E+M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNAEKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV KI E +  ++G++
Sbjct: 421 RASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYSHGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           +Q   +G++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK  T
Sbjct: 481 SQTGEYGNLISKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPKKNT 530


>gi|254487463|ref|ZP_05100668.1| chaperonin GroL [Roseobacter sp. GAI101]
 gi|214044332|gb|EEB84970.1| chaperonin GroL [Roseobacter sp. GAI101]
          Length = 549

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/526 (57%), Positives = 403/526 (76%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K GT AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFGTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE ++A  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATHKVVEAIRAAARDVTDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDVIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVTITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA++L  + G N DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAAKSLDGMTGMNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESSDLTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRP 526


>gi|258542859|ref|YP_003188292.1| chaperonin GroEL [Acetobacter pasteurianus IFO 3283-01]
 gi|262527536|sp|Q8GBD2|CH60_ACEP3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|256633937|dbj|BAH99912.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-01]
 gi|256636996|dbj|BAI02965.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-03]
 gi|256640049|dbj|BAI06011.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-07]
 gi|256643105|dbj|BAI09060.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-22]
 gi|256646160|dbj|BAI12108.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-26]
 gi|256649213|dbj|BAI15154.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-32]
 gi|256652200|dbj|BAI18134.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655257|dbj|BAI21184.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-12]
          Length = 546

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 308/531 (58%), Positives = 403/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAA 531


>gi|254456437|ref|ZP_05069866.1| chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083439|gb|EDZ60865.1| chaperonin GroL [Candidatus Pelagibacter sp. HTCC7211]
          Length = 553

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 408/532 (76%), Gaps = 5/532 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK IK    AR ++  GVN LA+ VK TLGPKGR V++  S+GAPR+TKDGV+VAK I  
Sbjct: 2   AKIIKFDAEARASMMRGVNILADTVKVTLGPKGRNVVMDKSYGAPRITKDGVSVAKEIDL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T + +GDGTTTAT LAQAI  EG KYVTAG+NPMD+KRGID 
Sbjct: 62  EDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGIDA 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+ V E L ++ KKV   +EI QV TISANGD+EIG  IA AM+++G  G+IT+++AK 
Sbjct: 122 AVENVKENLISSAKKVKDSDEIAQVGTISANGDKEIGTMIAKAMQKVGNEGVITVEEAKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE+ VV+GMQ DRGY+SPYF+T++++MT E++NPYIL+++ K++ LQP++P+LE+  Q
Sbjct: 182 IDTELDVVEGMQFDRGYLSPYFITNSDKMTTELDNPYILLHESKLTNLQPMVPLLEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           SGRPL II+EDVEG+ALATLVVN++R GL V+AVKAP FGDRRK +L DIA + G  VIS
Sbjct: 242 SGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKAMLEDIAILTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           +++G+KLE   + DLGS KK+ + KD++TIV G+G    I  R + I+K +E+T SDYDR
Sbjct: 302 QDLGIKLENVKLEDLGSCKKIKVDKDNSTIVSGSGKKSDIAARCDSIKKQVEETTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV++VG  TE  + E+KDR +D+L+ATRAA +EGIV GGG AL+ A
Sbjct: 362 EKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAVEEGIVTGGGCALLYA 421

Query: 423 AQ---ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           AQ    L VKG  EDQ AG+E+VRKAL  P RQI KNAG +  ++V K+ E K  +YGY+
Sbjct: 422 AQDLEKLKVKG--EDQKAGVELVRKALEAPIRQITKNAGVDGSVVVGKLLEQKKTSYGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   + DMF  GIIDPVKVVR ALQ A S++G+++ TEA++ D P+++ A+
Sbjct: 480 AQSEEYCDMFAKGIIDPVKVVRTALQDAASISGLLVTTEAMIADKPEEKDAA 531


>gi|329114548|ref|ZP_08243307.1| 60 kDa chaperonin 1 [Acetobacter pomorum DM001]
 gi|326696028|gb|EGE47710.1| 60 kDa chaperonin 1 [Acetobacter pomorum DM001]
          Length = 546

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 308/531 (58%), Positives = 403/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENNDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAA 531


>gi|220914718|ref|YP_002490026.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
 gi|219952469|gb|ACL62859.1| chaperonin GroEL [Methylobacterium nodulans ORS 2060]
          Length = 549

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 304/531 (57%), Positives = 402/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSSDARERMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV   V+ +    +KV S EEI QV TISANGD++IG+ IA AM+++G  G+IT ++A
Sbjct: 121 DLAVAAAVKDITGRARKVASSEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITAEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKETTTIIDGAGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVA++ VG  TE  + EKKDR +D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAIIRVGGSTEVEVREKKDRVEDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESK-TANYGY 478
           RA  A+ ++  DN D  +GI IV KAL  P RQI +NAG E  ++V +I ++  +  YG+
Sbjct: 421 RAKAAVAALNSDNSDVQSGIRIVLKALEAPIRQIAENAGVEGSIVVGQISDNTGSETYGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           NAQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK E+
Sbjct: 481 NAQTEEYEDMLQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKES 531


>gi|158422048|ref|YP_001523340.1| chaperonin [Azorhizobium caulinodans ORS 571]
 gi|187470733|sp|A8ILV4|CH601_AZOC5 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|158328937|dbj|BAF86422.1| chaperonin [Azorhizobium caulinodans ORS 571]
          Length = 547

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 302/527 (57%), Positives = 402/527 (76%), Gaps = 2/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFAGEAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ ++A  KKV S  E+ QV TISANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLATAAAVKDIQARAKKVSSSAEVAQVGTISANGDSSIGEMIAGAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M A++E+P++LI++KK+S LQP+LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNAEKMIADLEDPFLLIFEKKLSGLQPILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV++ K+ TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLAQLGRAKKVILEKEKTTIVDGVGEKAEIEARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+ ++  +N D  AGI+IV +AL  P RQI +N+G E  ++V K+ ES+  N+G+N
Sbjct: 421 RAKKAVEALSSENPDIAAGIKIVLRALEAPIRQIAENSGVEGSIVVGKVLESE-GNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + D+   G++DP KVVR ALQ A S+A +++ TEA++ + PK
Sbjct: 480 AQTEQYVDLVAEGVVDPAKVVRTALQDASSVASLLVTTEALIAELPK 526


>gi|34581407|ref|ZP_00142887.1| 60 kD chaperonin [Rickettsia sibirica 246]
 gi|28262792|gb|EAA26296.1| 60 kD chaperonin [Rickettsia sibirica 246]
          Length = 547

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 301/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+ILI++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILIFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|49474597|ref|YP_032639.1| chaperonin GroEL [Bartonella quintana str. Toulouse]
 gi|6225113|sp|O33964|CH60_BARQU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|2358236|gb|AAB69095.1| heat shock protein HSP60 [Bartonella quintana]
 gi|49240101|emb|CAF26542.1| Chaperonin protein groEL [Bartonella quintana str. Toulouse]
          Length = 547

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 313/529 (59%), Positives = 404/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVGNLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGKKAEINARVNQIKVQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL++KG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    +GYN 
Sbjct: 421 RAANALAIKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDT 529


>gi|157828821|ref|YP_001495063.1| chaperonin GroEL [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933547|ref|YP_001650336.1| chaperonin GroEL [Rickettsia rickettsii str. Iowa]
 gi|238651080|ref|YP_002916938.1| chaperonin GroEL [Rickettsia peacockii str. Rustic]
 gi|166201749|sp|A8GT30|CH60_RICRS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189082363|sp|B0BUM0|CH60_RICRO RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|259585914|sp|C4K2T9|CH60_RICPU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157801302|gb|ABV76555.1| chaperonin GroEL [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908634|gb|ABY72930.1| 60 kDa chaperonin GROEL [Rickettsia rickettsii str. Iowa]
 gi|238625178|gb|ACR47884.1| chaperonin GroEL [Rickettsia peacockii str. Rustic]
          Length = 547

 Score =  612 bits (1577), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|27382644|ref|NP_774173.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|68566295|sp|Q89DA6|CH607_BRAJA RecName: Full=60 kDa chaperonin 7; AltName: Full=GroEL protein 7;
           AltName: Full=Protein Cpn60 7
 gi|27355816|dbj|BAC52798.1| 60 KDA chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 543

 Score =  611 bits (1576), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 309/527 (58%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  V++ ++   K V S  E+ QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DIAVAAVIKDIEKRAKPVASSSEVAQVGTISANGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTAELEDAYILLHEKKLSGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L D+A + G  +
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDLAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEELGIKLENVTVKMLGRAKKVVIDKENTTIVNGAGKKPDIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +   N+D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRLTNANDDVQAGINIVLKALEAPIRQISENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DM E GIIDP KVVR ALQ A S+AG+++ TEA+V +APK
Sbjct: 481 AQNEDYVDMVEKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAEAPK 527


>gi|119386362|ref|YP_917417.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|119387310|ref|YP_918344.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|14916973|sp|Q9Z462|CH60_PARDE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|187470762|sp|A1B877|CH60_PARDP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15988025|pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988026|pdb|1IOK|B Chain B, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988027|pdb|1IOK|C Chain C, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988028|pdb|1IOK|D Chain D, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988029|pdb|1IOK|E Chain E, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988030|pdb|1IOK|F Chain F, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988031|pdb|1IOK|G Chain G, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|9081772|dbj|BAA36516.2| chaperonin 60 [Paracoccus denitrificans]
 gi|119376957|gb|ABL71721.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|119377885|gb|ABL72648.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
          Length = 545

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 407/537 (75%), Gaps = 6/537 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNSDARDRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE +K+  + V    E+ QV TISANG+  IG++IA AM+++G  G+IT+++ 
Sbjct: 121 DVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S+LQP++P+LES 
Sbjct: 181 KGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KD+TTIV G G    IE R+++I++ IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+ L  + G N DQ AGI I+R+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QGAKVLEGLSGANSDQDAGIAIIRRALEAPMRQIAENAGVDGAVVAGKVRESSDKAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA++ + P+     P+ PA
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMIAEKPE-----PKAPA 532


>gi|209884642|ref|YP_002288499.1| chaperonin GroL [Oligotropha carboxidovorans OM5]
 gi|209872838|gb|ACI92634.1| chaperonin GroL [Oligotropha carboxidovorans OM5]
          Length = 567

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 304/527 (57%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 21  MSAKEVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDI 80

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 81  ELEDKFENMGAQMVREVASKSADLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 140

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L+ N KKV S +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 141 DLAVEAVVADLQKNSKKVTSNDEIAQVGTISANGDTEIGAFLAKAMQKVGNEGVITVEEA 200

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E ++ Y+LI +KK+S+L  LLP+LE+ 
Sbjct: 201 KSLDTELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYVLINEKKLSSLNELLPLLEAV 260

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 261 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 320

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 321 ISEDLGIKLENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 380

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG AL+
Sbjct: 381 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGTALL 440

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAGD+  +IV K+ E +   YGY+
Sbjct: 441 RASEGLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGDDGSVIVGKVLEKEQYAYGYD 500

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +G++   GIIDP KVVR A+Q+A S+A +++ TEA++ + PK
Sbjct: 501 AQNHEYGNLVSKGIIDPTKVVRAAIQNAASVASLLITTEAMIAELPK 547


>gi|229586974|ref|YP_002845475.1| chaperonin GroEL [Rickettsia africae ESF-5]
 gi|259585913|sp|C3PP72|CH60_RICAE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|228022024|gb|ACP53732.1| 60 kD chaperonin [Rickettsia africae ESF-5]
          Length = 547

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDATSVASLIITTETLIVDEPSDK 529


>gi|148556278|ref|YP_001263860.1| chaperonin GroEL [Sphingomonas wittichii RW1]
 gi|166201753|sp|A5VBQ6|CH60_SPHWW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148501468|gb|ABQ69722.1| chaperonin GroEL [Sphingomonas wittichii RW1]
          Length = 549

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 306/536 (57%), Positives = 401/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENIGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VVE LKA  K V    E+ QV  ISANGD+E+GEKIA AM+++G  G+IT+++A
Sbjct: 121 DLAVTKVVENLKARSKPVAGSNEVAQVGIISANGDKEVGEKIAEAMDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMQVELTDPYILIHEKKLSNLQSILPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTNGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AK+V + KD+TTIV G G ++ I+GR+  I+K IE T SDY
Sbjct: 301 ISEDLGIKLENVTIGMLGTAKRVTIDKDNTTIVDGAGAADAIKGRVEAIRKQIEITTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +KG N+DQ  GI+I+R+A+S P +QI +NAG +  ++   +        G+N
Sbjct: 421 YATKALDGLKGANDDQTRGIDIIRRAISAPVKQIAQNAGQDGAVVAGNLLRENDETKGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A   V+ ++   G+IDP KVVR ALQ A S+AG+++ TEA + + P+D+  +P MP
Sbjct: 481 AATDVYENLVAAGVIDPTKVVRTALQDAASVAGLLITTEATIAELPEDK--APAMP 534


>gi|15892891|ref|NP_360605.1| chaperonin GroEL [Rickettsia conorii str. Malish 7]
 gi|20137860|sp|Q92H04|CH60_RICCN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15620081|gb|AAL03506.1| 60 kD chaperonin [Rickettsia conorii str. Malish 7]
          Length = 548

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/531 (56%), Positives = 405/531 (76%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P  + A
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSSDKA 531


>gi|15604473|ref|NP_220991.1| chaperonin GroEL [Rickettsia prowazekii str. Madrid E]
 gi|6225135|sp|Q9ZCT7|CH60_RICPR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|3861167|emb|CAA15067.1| 60 KD CHAPERONIN (groEL) [Rickettsia prowazekii]
 gi|292572254|gb|ADE30169.1| 60 kDa chaperonin [Rickettsia prowazekii Rp22]
          Length = 550

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M  K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MTTKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIKNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKRSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   I +LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI+KNAG+   ++V K+ E    NYG+N
Sbjct: 421 HASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVKNAGENGGVVVGKLLEHNDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|163732278|ref|ZP_02139724.1| chaperonin GroEL [Roseobacter litoralis Och 149]
 gi|161394576|gb|EDQ18899.1| chaperonin GroEL [Roseobacter litoralis Och 149]
          Length = 547

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 302/532 (56%), Positives = 402/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATVKVVAAIKEASREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  +L+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELEDCIVLLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKK+ ++KD+TTIV G G    I+ R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKIQITKDETTIVDGAGEKAEIQARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKHLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF  G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVVRTALQDAASIAGLLITTEAMVADKPAKEGAA 532


>gi|51473806|ref|YP_067563.1| chaperonin GroEL [Rickettsia typhi str. Wilmington]
 gi|25453432|sp|O85754|CH60_RICTY RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|18266430|gb|AAL67576.1|AF462073_2 chaperonin GroEL [Rickettsia typhi]
 gi|51460118|gb|AAU04081.1| 60 kDa chaperonin [Rickettsia typhi str. Wilmington]
          Length = 550

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M  K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MTTKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKRSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   I +LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI+KNAG+   ++V K+ E    NYG+N
Sbjct: 421 HASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVKNAGENGGVVVGKLLEHNDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|67458801|ref|YP_246425.1| chaperonin GroEL [Rickettsia felis URRWXCal2]
 gi|75536750|sp|Q4UMF2|CH60_RICFE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|67004334|gb|AAY61260.1| 60 kDa chaperonin [Rickettsia felis URRWXCal2]
          Length = 547

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 303/534 (56%), Positives = 406/534 (76%), Gaps = 2/534 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK IK G+  R+ +  GV+ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI  
Sbjct: 2   AKLIKHGSEGREQVLKGVDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+DL
Sbjct: 62  KDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGMDL 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++AK 
Sbjct: 122 AVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEAKN 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
            + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+  Q
Sbjct: 182 FSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           S RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +I+
Sbjct: 242 SQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGELIT 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDYD+
Sbjct: 302 EDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+ A
Sbjct: 362 EKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHA 421

Query: 423 AQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           +Q L ++K DN+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+NAQ
Sbjct: 422 SQTLRNLKVDNKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQ 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQM 534
              + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D E + P M
Sbjct: 482 DMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEDSIPPM 535


>gi|27380737|ref|NP_772266.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|68566296|sp|Q89IK8|CH606_BRAJA RecName: Full=60 kDa chaperonin 6; AltName: Full=GroEL protein 6;
           AltName: Full=Protein Cpn60 6
 gi|27353902|dbj|BAC50891.1| 60 KDA chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 546

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSVDARDKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S +EI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDAEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVNGAGKKADIEARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  ++  N+DQ  G+EIVRKALS P RQI  NAG++  +IV KI E+KT  YG++
Sbjct: 421 RASEQLKGLRTKNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILENKTYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   + ++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQTGEYVNLVTKGIIDPTKVVRTAIQNAASVAALLITTEAMVAELPK 527


>gi|218531590|ref|YP_002422406.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|218523893|gb|ACK84478.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
          Length = 540

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 307/539 (56%), Positives = 405/539 (75%), Gaps = 3/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKNITARARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+++PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELDDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++T  P +P GG
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEKT--PPLPPGG 537


>gi|330993457|ref|ZP_08317392.1| 60 kDa chaperonin 1 [Gluconacetobacter sp. SXCC-1]
 gi|329759487|gb|EGG75996.1| 60 kDa chaperonin 1 [Gluconacetobacter sp. SXCC-1]
          Length = 549

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 311/536 (58%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGEARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG+ EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVGVVVEELKKNAKKITTPAETAQVGTISANGEAEIGEMISKAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MT ++++PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNAEKMTVDLDSPYILIHEKKLSSLQPILPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G SE I+GR ++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGTAKKVHIDKENTTIVEGAGNSEGIKGRCSQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L  +   N+DQ  G +I+RKAL  P RQI  NAG++  +I  K+ E+ T  +G++
Sbjct: 421 RASTKLGGLHFHNDDQRVGADIIRKALQAPLRQIAHNAGEDGAVIAGKVLENDTYTFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+   GIIDP+KVVR ALQ A S+AG+++ TEA+V + P  E  +P MP
Sbjct: 481 AQMGDYKDLVAAGIIDPMKVVRTALQDAASVAGLLITTEAMVAERP--EKKAPAMP 534


>gi|23096062|dbj|BAC16232.1| groEL [Acetobacter aceti]
          Length = 546

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 307/531 (57%), Positives = 402/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMRAGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRR  +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRNVMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAA 531


>gi|226943476|ref|YP_002798549.1| chaperonin GroEL [Azotobacter vinelandii DJ]
 gi|226718403|gb|ACO77574.1| chaperonin GroEL/Hsp60 [Azotobacter vinelandii DJ]
          Length = 546

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 402/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK+  K     + I QV TISAN D  IG  IA AM ++G  G+IT+++ 
Sbjct: 121 DKATIAIVAELKSLAKPCSDSKAIAQVGTISANSDESIGNIIAEAMNKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M AE++NP +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKSGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IE+T SDY
Sbjct: 301 ISEEVGLSLESATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNEDQ  GI ++R+A+  P RQI+ NAGDE  ++V K+++  + N+G+N
Sbjct: 421 RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKVKQG-SGNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D  +D+ A+P MP  
Sbjct: 480 AASGVYGDMIEMGILDPAKVTRSALQAASSIGGLMITTEAMVADIVEDK-AAPAMPDM 536


>gi|146339890|ref|YP_001204938.1| chaperonin GroEL [Bradyrhizobium sp. ORS278]
 gi|187470687|sp|A4YS25|CH602_BRASO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|146192696|emb|CAL76701.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. ORS278]
          Length = 546

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGVEARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S +EI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   ++ LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVNLSMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  V+  NEDQ  G+EIVRKALS P RQI  NAG++  +IV KI E +   YG++
Sbjct: 421 RASEQLKGVRTKNEDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   + +M   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQSGDYVNMVSKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPK 527


>gi|153010349|ref|YP_001371563.1| chaperonin GroEL [Ochrobactrum anthropi ATCC 49188]
 gi|166201736|sp|A6X3D0|CH60_OCHA4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|151562237|gb|ABS15734.1| chaperonin GroEL [Ochrobactrum anthropi ATCC 49188]
          Length = 546

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 311/526 (59%), Positives = 407/526 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVAELLGKAKKINTSEEVAQVGTISANGEAEIGKMIADAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+++I++ IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVSQIKQQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +S KG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV KI E+ +  YGYN 
Sbjct: 421 RASAKISAKGINADQEAGINIVRRALQAPARQITTNAGEEASVIVGKILENASETYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               FGD+ + G++DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEFGDLIKAGVVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|192359320|ref|YP_001983106.1| chaperonin GroEL [Cellvibrio japonicus Ueda107]
 gi|226704097|sp|B3PLM6|CH60_CELJU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|190685485|gb|ACE83163.1| chaperonin GroEL [Cellvibrio japonicus Ueda107]
          Length = 545

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 402/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARQRMLAGVNILADAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+M+++VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQMVKEVASKASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A+ E V+++++        + I QV TISAN D  IG  IA AME++G  G+IT+++ 
Sbjct: 121 DKAIAEAVKHVQSIAVPCADSKSISQVGTISANSDSSIGNLIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            +   E+ VV+GMQ DRGY+SPYF+ + + M+ E +NP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 TSLDNELDVVEGMQFDRGYLSPYFINNQDNMSVEHDNPFILLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKSGKPLVIVAEDVEGEALATLVVNNIRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+V M+KD+TTIV G G +E I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEEVGLDLESATLEHLGTAKRVTMNKDNTTIVDGAGKAEEIKTRVQQIRVQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGTALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ +KGDNEDQ AGI I R+A+  P RQI+ NAG+E  ++   +++  + N+GYN
Sbjct: 421 RAVAAIADLKGDNEDQNAGIGIARRAMESPLRQIVANAGEEPSVVADSVKKG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A   V+GDM EMGI+DP KV R ALQ+AGS+AG+M+ TEA+V D P+D+ A+
Sbjct: 480 AATGVYGDMIEMGILDPAKVTRTALQAAGSIAGLMITTEAMVADLPEDKPAA 531


>gi|239833538|ref|ZP_04681866.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
 gi|239821601|gb|EEQ93170.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
          Length = 546

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 311/526 (59%), Positives = 405/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVSEVVAELLGKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +S KG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV KI E+ +  YGYN 
Sbjct: 421 RASAKISAKGINADQEAGINIVRRALQAPARQITTNAGEEASVIVGKILENASETYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               FGD+ + G++DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ASGEFGDLIKAGVVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|187470863|sp|A8F2B5|CH60_RICM5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
          Length = 547

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ALKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD   D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDESSDK 529


>gi|157826029|ref|YP_001493749.1| chaperonin GroEL [Rickettsia akari str. Hartford]
 gi|166201746|sp|A8GPB6|CH60_RICAH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157799987|gb|ABV75241.1| chaperonin GroEL [Rickettsia akari str. Hartford]
          Length = 548

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 404/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDVLADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV G+G  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTVSKENTVIVDGSGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QII+NAG+   ++V K+ E    NYG+N
Sbjct: 421 HASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIIENAGENGGVVVGKLLEHNDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|183206460|gb|ACC54437.1| GroEL [Rickettsia endosymbiont of Bemisia tabaci]
          Length = 550

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  V+E +K   KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNTVLEEVKKASKKIDSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENPYIL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPYILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTNGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  ++  LG AK+V +SK++T IV G+G  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSLKSLGHAKRVTISKENTVIVDGSGDKKNIEERVLQIKSHIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+QAL ++K DN+DQ AGIE+V +AL  P +QI++NAG+   ++V K+ E K  N+G+N
Sbjct: 421 HASQALKNLKVDNKDQQAGIELVIEALKDPIKQIVENAGENGGVVVGKLLEHKDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P+D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPEDK 529


>gi|110680677|ref|YP_683684.1| chaperonin GroEL [Roseobacter denitrificans OCh 114]
 gi|118597100|sp|Q162U5|CH602_ROSDO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|109456793|gb|ABG32998.1| 60 kDa chaperonin 1, putative [Roseobacter denitrificans OCh 114]
          Length = 547

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 303/532 (56%), Positives = 401/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATVKVVAAIKDAAREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  +L+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELEDCIVLLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKIQITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKHLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF  G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPAKEGAA 532


>gi|91978588|ref|YP_571247.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
 gi|123721548|sp|Q130Z3|CH602_RHOPS RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|91685044|gb|ABE41346.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
          Length = 550

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 308/536 (57%), Positives = 401/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFAGDARDRMLRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD++RGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  V++ +    K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVIKDIGKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDVYILLHEKKVSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEELGVKLESVTLKMLGRAKKVVIDKENTTIVNGAGKKADIEARVQQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + P++  A+P MP
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDAASVAALLVTTEAMVAELPRE--AAPAMP 534


>gi|114764191|ref|ZP_01443429.1| chaperonin GroEL [Pelagibaca bermudensis HTCC2601]
 gi|114543343|gb|EAU46359.1| chaperonin GroEL [Roseovarius sp. HTCC2601]
          Length = 547

 Score =  608 bits (1568), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 305/538 (56%), Positives = 407/538 (75%), Gaps = 2/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR  +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFDTDARTRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARPVNDSGEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQPL+P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPLVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK V ++KD+TTIV G+G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKTVTITKDETTIVDGHGEKAEIEARVSQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL  ++G N DQ AG+ IVRKAL  P RQI +NAG +  ++  KI+ES+   +GYN
Sbjct: 421 QGAKALDGLEGANSDQNAGVTIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ + A   MP  
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQKD-APAAMPDM 537


>gi|148256591|ref|YP_001241176.1| chaperonin GroEL [Bradyrhizobium sp. BTAi1]
 gi|187470756|sp|A5EM76|CH604_BRASB RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|146408764|gb|ABQ37270.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 546

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 304/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGVEARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S +EI QV TISANGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   ++ LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVNLSMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  ++  NEDQ  G+EIVRKALS P RQI  NAG++  +IV KI E +   YG++
Sbjct: 421 RASEQLKGLRTKNEDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   + +M   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQTGDYVNMVSKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPK 527


>gi|91205405|ref|YP_537760.1| chaperonin GroEL [Rickettsia bellii RML369-C]
 gi|157827007|ref|YP_001496071.1| chaperonin GroEL [Rickettsia bellii OSU 85-389]
 gi|119366262|sp|Q1RIZ3|CH60_RICBR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166201747|sp|A8GW07|CH60_RICB8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|91068949|gb|ABE04671.1| 60 kD chaperonin [Rickettsia bellii RML369-C]
 gi|157802311|gb|ABV79034.1| chaperonin GroEL [Rickettsia bellii OSU 85-389]
          Length = 550

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  V+E +K   KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNTVLEEVKKASKKIDSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENPYIL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPYILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTNGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  ++  LG AK+V +SK++T IV G+G  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSLKSLGHAKRVTISKENTVIVDGSGDKKNIEERVLQIKSHIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+QAL ++K DN+DQ AGIE+V +AL  P +QI++NAG+   ++V K+ E K  N+G+N
Sbjct: 421 HASQALKNLKVDNKDQQAGIELVIEALKDPIKQIVENAGENGGVVVGKLLEHKDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P+D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPEDK 529


>gi|288957187|ref|YP_003447528.1| chaperonin GroEL [Azospirillum sp. B510]
 gi|288909495|dbj|BAI70984.1| chaperonin GroEL [Azospirillum sp. B510]
          Length = 547

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 303/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGPTAREKLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG   V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGVTKVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  ++A  KKV + +EI QV TISANG+ EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVATVVADIQARAKKVTTNDEIAQVGTISANGEAEIGKMIAQAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ ++M A++ENPYIL+++KK+S LQPLLP+LE+ 
Sbjct: 181 KSLDTELDVVEGMQFDRGYLSPYFVTNADKMVADLENPYILLHEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 VQSSRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDMAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKVV+SK+ TTIV G G    IE R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGTAKKVVISKETTTIVDGAGDKADIEARCGQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG+V GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGVVAGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++AL ++   N++Q  GI+I+R+AL  P RQI  NAG +  ++V K+ +    N+G++
Sbjct: 421 YASKALDALTPANDEQRVGIDIIRRALQAPVRQIAYNAGTDGSIVVGKLLDQTDTNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQK  F D+   GIIDPVKVVR ALQ A S+AG+++ TEA++ + P+
Sbjct: 481 AQKGEFTDLVAAGIIDPVKVVRTALQDAASIAGLLITTEAMIAEKPE 527


>gi|115522886|ref|YP_779797.1| chaperonin GroEL [Rhodopseudomonas palustris BisA53]
 gi|122297531|sp|Q07TB7|CH601_RHOP5 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|115516833|gb|ABJ04817.1| chaperonin GroEL [Rhodopseudomonas palustris BisA53]
          Length = 547

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 304/536 (56%), Positives = 402/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSQDARDRMLRGVDILANAVKVTLGPKGRNVLIERSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  QLEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQSIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  VV+ ++   K V S  EI QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVVKDIEKRAKPVASSAEIAQVGTISSNGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+ TTEV +V+GM+ DRGY+SPYFVT+ E+M  E ++ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLTTEVDIVEGMKFDRGYLSPYFVTNAEKMAVEFDDAYVLLHEKKVSGLQSMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA + G  +
Sbjct: 241 VQAGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKVV+ K++TTIVGG G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLKMLGRAKKVVIDKENTTIVGGAGKKADIESRVGQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S++ +++ TEA+V + P+D  A+P MP
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDAASVSALLVTTEAMVAELPRD--AAPAMP 534


>gi|163852749|ref|YP_001640792.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|163664354|gb|ABY31721.1| chaperonin GroEL [Methylobacterium extorquens PA1]
          Length = 540

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 306/539 (56%), Positives = 404/539 (74%), Gaps = 3/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ +    +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITGRARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+E+PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELEDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA A  L++K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVLALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++  +P +P GG
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEK--APPLPPGG 537


>gi|157964774|ref|YP_001499598.1| chaperonin GroEL [Rickettsia massiliae MTU5]
 gi|157844550|gb|ABV85051.1| 60 kDa chaperonin [Rickettsia massiliae MTU5]
          Length = 556

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVTVAKSI
Sbjct: 10  MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI 69

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 70  ALKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 129

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 130 DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 189

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 190 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 249

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 250 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 309

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 310 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 369

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 370 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 429

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 430 HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 489

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD   D+
Sbjct: 490 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDESSDK 538


>gi|254562511|ref|YP_003069606.1| 60 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|254269789|emb|CAX25762.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens DM4]
          Length = 540

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 306/539 (56%), Positives = 405/539 (75%), Gaps = 3/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITARARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+++PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELDDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++  +P +P GG
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEK--APPLPPGG 537


>gi|146342934|ref|YP_001207982.1| chaperonin GroEL [Bradyrhizobium sp. ORS278]
 gi|187470726|sp|A4Z0U1|CH603_BRASO RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|146195740|emb|CAL79767.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. ORS278]
          Length = 547

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/528 (58%), Positives = 396/528 (75%), Gaps = 1/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ ++   K V S  E+ QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DTAVAAVIKDIEKRAKPVASSAEVAQVGTISANGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+++ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTAELDDVYVLLHEKKLSGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  TI  LG AKKVV+ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTIKMLGRAKKVVIDKENTTIVNGAGKKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +   N D  AGI IV KAL  P RQI +NAG E  ++V KI E K+  +G++
Sbjct: 421 RAKKAVGRITNPNSDVQAGINIVLKALEAPMRQIAENAGVEGSIVVGKILEEKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PKD
Sbjct: 481 AQTEDYVDMVAKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAELPKD 528


>gi|39934215|ref|NP_946491.1| chaperonin GroEL [Rhodopseudomonas palustris CGA009]
 gi|42558893|sp|P60364|CH601_RHOPA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|39648063|emb|CAE26583.1| chaperonin GroEL1, cpn60 [Rhodopseudomonas palustris CGA009]
          Length = 547

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 397/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAAKDVKFSGDARDRMLRGVDVLANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  VV+ ++   K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVVKDIQKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDAYILLHEKKLSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLKMLGRAKKVVIDKENTTIVNGAGKKPEIEARVSQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDASSVASLLVTTEAMVAELPK 527


>gi|148253202|ref|YP_001237787.1| chaperonin GroEL [Bradyrhizobium sp. BTAi1]
 gi|187470735|sp|A5ECI7|CH601_BRASB RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|146405375|gb|ABQ33881.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 547

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/528 (58%), Positives = 396/528 (75%), Gaps = 1/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFAGDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ ++   K V S  E+ QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DTAVAAVIKDIEKRAKPVASSAEVAQVGTISANGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+++ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTAELDDVYVLLHEKKLSGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  TI  LG AKKVV+ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTIKMLGRAKKVVIDKENTTIVNGAGKKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +   N D  AGI IV KAL  P RQI +NAG E  L+V KI E K+  +G++
Sbjct: 421 RAKKAVGRITNPNSDVQAGINIVLKALEAPVRQIAENAGVEGSLVVGKILEEKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PK+
Sbjct: 481 AQSEDYVDMVAKGIIDPAKVVRTALQDASSVAGLLVTTEAMVAELPKE 528


>gi|294625357|ref|ZP_06703992.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292600337|gb|EFF44439.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 543

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/543 (56%), Positives = 405/543 (74%), Gaps = 4/543 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  + NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    FGDM + GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P +PAGGG
Sbjct: 480 AANGEFGDMVQFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPALPAGGG 537

Query: 540 MGG 542
           MGG
Sbjct: 538 MGG 540


>gi|192289741|ref|YP_001990346.1| chaperonin GroEL [Rhodopseudomonas palustris TIE-1]
 gi|192283490|gb|ACE99870.1| chaperonin GroEL [Rhodopseudomonas palustris TIE-1]
          Length = 547

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 397/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAAKDVKFAGDARDRMLRGVDVLANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  VV+ ++   K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVVKDIQKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDAYILLHEKKLSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLKMLGRAKKVVIDKENTTIVNGAGKKPEIEARVSQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDASSVASLLVTTEAMVAELPK 527


>gi|254477792|ref|ZP_05091178.1| chaperonin GroL [Ruegeria sp. R11]
 gi|214032035|gb|EEB72870.1| chaperonin GroL [Ruegeria sp. R11]
          Length = 549

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 302/532 (56%), Positives = 404/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKASARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETTVVEGMQFDRGYLSPYFVTNPDKMIAELDDCMILLHEKKLSSLQAMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIEITKDETTIVDGAGEKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  V+G N DQ AGI IVRKA+  P RQI +NAG +  ++  KI+ES   ++GYN
Sbjct: 421 QAGKALDGVEGANSDQNAGIAIVRKAIEAPLRQIAENAGVDGAVVAGKIRESADTSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTDEYGDMFSFGVIDPAKVTRTALEDAASVAGLLITTEAMVADKPAKEGAA 532


>gi|114777816|ref|ZP_01452747.1| chaperonin, 60 kDa subunit [Mariprofundus ferrooxydans PV-1]
 gi|114551807|gb|EAU54347.1| chaperonin, 60 kDa subunit [Mariprofundus ferrooxydans PV-1]
          Length = 546

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 307/534 (57%), Positives = 407/534 (76%), Gaps = 2/534 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKDI+ G  AR  +  GVN LA+AVK TLGPKGR V+I  S+GAP +TKDGV+VAK I  
Sbjct: 2   AKDIQFGEDARAKMMVGVNKLADAVKVTLGPKGRNVVIEKSWGAPTITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++V++ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGID 
Sbjct: 62  EDKFENMGAQMVKEVSSKTADIAGDGTTTATVLAQSIAKEGVKAVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV  VV  L    K+V +++EI QV TISANGD EIG+ IA AM+++G  G+IT+++AK 
Sbjct: 122 AVTAVVAELANLSKEVQNQDEIAQVGTISANGDAEIGKIIADAMDKVGKEGVITVEEAKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE+ VV+GMQIDRGY+SPYFVT TERM A +++PYIL+++KKIS ++ LLP+LE+  +
Sbjct: 182 LETELDVVEGMQIDRGYLSPYFVTDTERMEANLDHPYILLFEKKISNMRELLPVLEAVAR 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           +G+PL IIAED+EG+ALATLVVN+VR  + V AVKAP FGDRRK +L D+A + GA VIS
Sbjct: 242 TGKPLLIIAEDIEGEALATLVVNKVRGVVNVAAVKAPGFGDRRKAMLEDMAILTGAKVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E++GLKLE  T+ DLG+A  V ++KD TT+V G G    IEGR+  I+K IEDT SDYD+
Sbjct: 302 EDLGLKLENVTLEDLGTAAAVKIAKDTTTVVDGAGEKAAIEGRVALIRKQIEDTTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIV GGG+AL+RA
Sbjct: 362 EKLQERLAKLAGGVAVIKVGAATETAMKEKKDRVDDALHATRAAVEEGIVAGGGVALLRA 421

Query: 423 AQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
            +AL SVKG N D+  G+ I+R+AL  P RQI+ N G E+ ++V+++  +K  +YGYNAQ
Sbjct: 422 RKALDSVKGINHDEDTGVNIIRRALEEPLRQIVANGGGEASVVVNEVSNNK-GHYGYNAQ 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              +GD+ +MG+IDP KV R+ALQ A S+AG+++ TEA++ D PK E A+   P
Sbjct: 481 TEEYGDLVKMGVIDPTKVTRSALQYAASIAGLLITTEAMIADIPKPEAAAGGAP 534


>gi|157803505|ref|YP_001492054.1| chaperonin GroEL [Rickettsia canadensis str. McKiel]
 gi|166201748|sp|A8EY36|CH60_RICCK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157784768|gb|ABV73269.1| chaperonin GroEL [Rickettsia canadensis str. McKiel]
          Length = 547

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G+ AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MATKLIKHGSEAREEMLKGVDILANAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K      GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKEKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNTVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG+AK+V +SK++T IV G+G  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGSGDKKSIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             +Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  N+G+N
Sbjct: 421 HTSQILTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P  E
Sbjct: 481 AQDMQYVDMIQAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSKE 529


>gi|332995638|gb|AEF05693.1| chaperonin GroEL [Alteromonas sp. SN2]
          Length = 546

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/538 (56%), Positives = 399/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++ G  AR  +  GVNTLA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVRFGNDARTKMLKGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIITEGHKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D E+G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKALSTDCADSKSIAQVGTISANSDAEVGDIIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E+++P+IL+ DKKIS ++ LLP LE  
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVELDSPFILLVDKKISNIRELLPTLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LEK  + DLG+AK+VV++KD+TTIV GNG  E IEGR  +I+  IED+ SDY
Sbjct: 301 ISEEIGLDLEKVELEDLGTAKRVVINKDNTTIVDGNGDEEAIEGRCAQIKGQIEDSSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L S+ G+NEDQ  GI++  +A+  P RQI  NAG E+ ++V++++     NYGYN
Sbjct: 421 RAAAKLASLTGENEDQTVGIKLALRAMEAPLRQIASNAGAEASVVVNEVKNGD-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA++ D P+DE A+P MP  
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFAASIASLMITTEAMIADIPQDE-AAPAMPDM 536


>gi|240141638|ref|YP_002966118.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
 gi|240011615|gb|ACS42841.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
          Length = 531

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 303/512 (59%), Positives = 392/512 (76%), Gaps = 1/512 (0%)

Query: 19  GVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVA 78
           GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I   + F  +GA+M+R+VA
Sbjct: 4   GVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADRFENMGAQMVREVA 63

Query: 79  TNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV 138
           + T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGIDLA    V+ + A  KKV
Sbjct: 64  SKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGIDLATAAAVKDITARAKKV 123

Query: 139 GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRG 198
            S EE+ QV TISANGD+EIGE IA+AM+++G  G+IT+++AKTA TE+ VV+GMQ DRG
Sbjct: 124 ASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRG 183

Query: 199 YISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDA 258
           Y+SPYFVT+ E+M AE+E+PYILI++KK+S+LQP+LP+LE+  Q+G+PL IIAED+EG+A
Sbjct: 184 YLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAVVQTGKPLVIIAEDIEGEA 243

Query: 259 LATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLG 318
           LATLVVN++R GL V AVKAP FGDRRK +L DIA +     ISE++G+KLE   +  LG
Sbjct: 244 LATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQTISEDLGIKLENVALPMLG 303

Query: 319 SAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV 378
            AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDYDR+KL+ERLAKLAGGVAV
Sbjct: 304 RAKRVRIEKETTTIIDGLGEKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAV 363

Query: 379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALS-VKGDNEDQCA 437
           + VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+ A +A++ +K D  D  A
Sbjct: 364 IRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLLAKKAVAELKSDIPDVQA 423

Query: 438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPV 497
           GI+IV KAL  P RQI  NAG E  ++V KI ++    +G+NAQ   + DM + GI+DP 
Sbjct: 424 GIKIVLKALEAPIRQIASNAGVEGSIVVGKITDNGGETFGFNAQTEEYVDMIQAGIVDPA 483

Query: 498 KVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 484 KVVRTALQDAASVAGLLVTTEAMVADAPKKDS 515


>gi|163793752|ref|ZP_02187726.1| feruloyl-CoA synthase [alpha proteobacterium BAL199]
 gi|159180863|gb|EDP65380.1| feruloyl-CoA synthase [alpha proteobacterium BAL199]
          Length = 547

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 300/527 (56%), Positives = 402/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGIDARNKMLRGVDILADAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+   D++GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVREGGKAVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L+   KK+ + +++ QV TISANG+REIG  IA AME++G  G+IT+++A
Sbjct: 121 DAAVEAVVADLEKRSKKISTSDQVAQVGTISANGEREIGAMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYIL+++KK+S LQ +LP+LE  
Sbjct: 181 KSLHTELDVVEGMQFDRGYLSPYFVTNADKMVCELESPYILLHEKKVSNLQAMLPVLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G++LE  T+  LG+ K++ ++KD+TTIV G G  + IE R  +I+  +EDT SDY
Sbjct: 301 VSEDLGIQLENVTLDMLGTTKRISITKDETTIVDGAGKKKDIEARCAQIRAQVEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGILPGGGAALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A ++L  +K  N+DQ  G+ IVR+AL  P RQI  NAG +  +IV K+ ESK  N+G++
Sbjct: 421 YAIRSLEKLKAVNDDQRMGMNIVRRALEAPARQIATNAGHDGSVIVGKLLESKDPNWGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   F D+ + GIIDP KVVR+ALQ+A S+AG+++ TEA+V D P+
Sbjct: 481 AQNGEFVDLIKAGIIDPTKVVRSALQNAASIAGLLVTTEAMVADKPE 527


>gi|299135340|ref|ZP_07028531.1| chaperonin GroEL [Afipia sp. 1NLS2]
 gi|298590317|gb|EFI50521.1| chaperonin GroEL [Afipia sp. 1NLS2]
          Length = 546

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/527 (57%), Positives = 399/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKDI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKSADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L+ N KKV S EEI QV TISANGD EIG  +A AM ++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLQKNSKKVTSNEEIAQVGTISANGDTEIGSFLAKAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E ++ YILI +KK+S+L  +LP+LE+ 
Sbjct: 181 KSLDTELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSSLNEMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+K+E  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKMENVTLQMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV K+ E     YG++
Sbjct: 421 RASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   +G++   GIIDP KVVR A+Q+A S+A +++ TEA++ + PK
Sbjct: 481 SQTGEYGNLVSKGIIDPTKVVRAAIQNAASVASLLITTEAMIAELPK 527


>gi|75676758|ref|YP_319179.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255]
 gi|119366222|sp|Q3SPG4|CH603_NITWN RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|74421628|gb|ABA05827.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255]
          Length = 548

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/537 (57%), Positives = 402/537 (74%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARQRMLRGVDILADAVKVTLGPKGRNVVIERSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ +    K V S  E+ QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DIAVAAVVKDIGKRAKAVASSAEVAQVGTISSNGDASIGKMIAQAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T+V +V+GM+ DRGY+SPYFVT+ E+M AE+++ YIL+++KK++ LQ LLP+LE+ 
Sbjct: 181 KSLETDVDIVEGMKFDRGYLSPYFVTNAEKMAAELDDAYILLHEKKLTGLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AEDVEG+ALA LVVNR+R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VKSGKPLLIVAEDVEGEALAALVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+G+KLE  T+  LG AKKV++ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISDELGMKLENVTLNMLGRAKKVLIDKENTTIVNGAGKKKDIEARVGQIRARIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RARKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQK  + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PKDE   P MPA
Sbjct: 481 AQKEEYVDMVAKGIIDPAKVVRTALQDASSIAGLLVTTEAMVAELPKDE--PPAMPA 535


>gi|254473625|ref|ZP_05087021.1| chaperonin GroL [Pseudovibrio sp. JE062]
 gi|211957337|gb|EEA92541.1| chaperonin GroL [Pseudovibrio sp. JE062]
          Length = 550

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/528 (57%), Positives = 399/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR+ +  GV+ LA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGSDAREKMLKGVDILANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVKEGAKFVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A    V  L A  K + S +E+ QV TISANGD +IG  IA AM+++G  G+IT+++A
Sbjct: 121 DMATAAAVADLTARSKTISSSDEVAQVGTISANGDTQIGADIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E P IL+++KK+S LQP+LPILESA
Sbjct: 181 KSLETELEVVEGMQFDRGYLSPYFVTNAEKMIADLEKPLILLHEKKLSNLQPMLPILESA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+A KV +SK++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIDMLGTADKVNISKENTTIVDGAGDKADIEARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           RA  A+  V  +N D  AGI+IV +AL  P RQI +N+G E  ++V KIQ++     +G+
Sbjct: 421 RAKAAVEKVSSENVDIEAGIKIVLRALEAPLRQIAENSGVEGSIVVGKIQDNIADETFGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           NAQ   + +M E GIIDP KVVR ALQ A S++G+++ TEA+V + PK
Sbjct: 481 NAQSEEYVNMIEAGIIDPTKVVRTALQDAASVSGLLITTEAMVAELPK 528


>gi|170743664|ref|YP_001772319.1| chaperonin GroEL [Methylobacterium sp. 4-46]
 gi|168197938|gb|ACA19885.1| chaperonin GroEL [Methylobacterium sp. 4-46]
          Length = 546

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 402/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSSDAREKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ +    +KV S E I QV TISANGD+EIGE IA AM+++G  G+IT ++A
Sbjct: 121 DLATAATVKDITGRARKVVSSEGIAQVGTISANGDKEIGEMIAQAMQKVGNEGVITAEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M A++E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAVTELDVVEGMQFDRGYLSPYFITNAEKMIADLEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGEKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVA++ VG  TE  + EKKDR +D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAIIRVGGSTEVEVKEKKDRVEDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESK-TANYGY 478
           RA  A+ ++  DN D  AGI+IV +AL  P RQI +NAG E  ++V +I  +  +  YG+
Sbjct: 421 RAQAAVAALTSDNPDVQAGIKIVLRALEAPIRQIAENAGVEGSIVVGQISNNTGSETYGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NAQ   + D+ E G++DP KVVR A+Q A S+AG+++ TEA+V DAPK E++
Sbjct: 481 NAQTEEYVDLLEAGVVDPAKVVRTAMQGAASVAGLLVTTEAMVADAPKKESS 532


>gi|84499753|ref|ZP_00998041.1| chaperonin GroEL [Oceanicola batsensis HTCC2597]
 gi|84392897|gb|EAQ05108.1| chaperonin GroEL [Oceanicola batsensis HTCC2597]
          Length = 548

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/529 (56%), Positives = 402/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFG+PR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFNTDARNKMLKGVNVLADAVKVTLGPKGRNVVLEKSFGSPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V   +E+ QV TISANG+  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKSAARDVTDSDEVAQVGTISANGEASIGRMIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M  E+E+  IL+++KK+S+LQPL+P+LES 
Sbjct: 181 KGMETEVDVVEGMQFDRGYLSPYFVTNPDKMLTELEDCMILLHEKKLSSLQPLVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV GNG    IE R+++I   I++T SDY
Sbjct: 301 ISEDLGMKLENVTMDMLGTAKKVSITKDETTIVDGNGDKAEIEARVSQINTQIQETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTETEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    YG+N
Sbjct: 421 QGGKALEGLTGANPDQEAGIAIVRRALEAPLRQIAENAGVDGAVVAGKVRESDDVKYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR AL+ A S++G+++ TEA+V D P+ E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASISGLLITTEAMVADKPQKE 529


>gi|54288375|gb|AAV31663.1| predicted chaperonin GroEL [uncultured alpha proteobacterium
           EBAC2C11]
          Length = 559

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 303/527 (57%), Positives = 399/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR  +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGAEARTKMLEGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKDI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT +AQ+I  EG K V +G+NPMD+KRGI
Sbjct: 61  ELKDKFQNMGAQMVREVASKANDVAGDGTTTATVMAQSIAQEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ L+A  KK+ + +E+ QV TISANG+ EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DMAVDSVVKSLEAKSKKISTSDEVAQVGTISANGEEEIGKMIAEAMERVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT  E+M A +E PYIL+++KK+S LQ +LPILE  
Sbjct: 181 KSLDTELDVVEGMQFDRGYLSPYFVTDAEKMRATLEEPYILLHEKKLSNLQDMLPILEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTNGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+ L+  T+  LGSAK+V ++KD++TIV G+G  + IE R N+I+   E++ SDY
Sbjct: 301 VSEEVGISLDGLTLDMLGSAKRVEITKDESTIVDGSGAKKEIEARCNQIRAQAEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG++LV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVSLV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A   LS +K  N DQ  GIEIV +AL  P R I +NAG E  +IV K+ E K  N GY+
Sbjct: 421 KAIPNLSKLKPANRDQEVGIEIVTRALQAPARYIAQNAGAEGSVIVGKLIEGKDDNVGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           A  + F DM + G+IDP KVVR+ALQ+A S+AG+++ TEA+V + P+
Sbjct: 481 ATSNDFTDMIKAGVIDPTKVVRSALQNAASVAGLLVTTEAMVAEKPE 527


>gi|87198061|ref|YP_495318.1| chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444]
 gi|119366253|sp|Q2G2Z4|CH60_NOVAD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|87133742|gb|ABD24484.1| chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444]
          Length = 547

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 304/531 (57%), Positives = 395/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D++GDGTTTAT LAQAI  EG   V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV +VVE LKA    V    EI QV  ISANGD E+G+KIA AME++G  G+IT+++A
Sbjct: 121 DIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+MT E+ENPYILI++KK+S+LQ +LPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLGDIATLTAGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV + KD+TTIV G G +E I+ R+ +I+  IE T SDY
Sbjct: 301 ISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAEEIKARVEQIRAQIEVTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +KG N+DQ  GI+IVR+A+  P RQI  NAG +  ++   +      N G+N
Sbjct: 421 YATKALEGLKGANDDQTKGIDIVRRAIQAPIRQIAANAGHDGAVVSGNLLRENDENQGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    + ++   G+IDP KVVR ALQ A S++G+++ TEA + + P D+ A
Sbjct: 481 AATDTYENLKAAGVIDPTKVVRTALQDAASVSGLLITTEAAISEKPDDKPA 531


>gi|316932684|ref|YP_004107666.1| chaperonin GroEL [Rhodopseudomonas palustris DX-1]
 gi|315600398|gb|ADU42933.1| chaperonin GroEL [Rhodopseudomonas palustris DX-1]
          Length = 548

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/529 (57%), Positives = 395/529 (74%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGEARDRMLRGVDVLANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  V++ ++   K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVIKDIQKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+++ YIL+++KK+  LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTAELDDAYILLHEKKLPGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKVV+ K++TTIV G G    IE R+ +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLETVNLKMLGRAKKVVIDKENTTIVNGAGKKPEIEARVQQIKAQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK E
Sbjct: 481 AQSEEYVDMLAKGIVDPAKVVRTALQDASSVASLLVTTEAMVAELPKAE 529


>gi|148261486|ref|YP_001235613.1| chaperonin GroEL [Acidiphilium cryptum JF-5]
 gi|326404970|ref|YP_004285052.1| 60 kDa chaperonin [Acidiphilium multivorum AIU301]
 gi|166198428|sp|A5G1G2|CH60_ACICJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|146403167|gb|ABQ31694.1| chaperonin GroEL [Acidiphilium cryptum JF-5]
 gi|325051832|dbj|BAJ82170.1| 60 kDa chaperonin [Acidiphilium multivorum AIU301]
          Length = 549

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 302/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR+ +  GV+ LA AVK TLGPKGR V+I  SFG+PR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARERLIRGVDLLANAVKVTLGPKGRNVVIEKSFGSPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V+ LK   KK+ +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVNAIVDELKKRTKKITTPSETAQVGTISANGEAEIGKMISEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYF+T+ E+M A+++NPYILI++KK+S LQP+LP+LES 
Sbjct: 181 KGIQTELDVVEGMQFDRGYVSPYFITNPEKMVADLDNPYILIHEKKLSGLQPMLPLLESI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    I GR N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGRAKKVLIEKENTTIVEGAGKKADITGRCNQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGASETEVKERKDRVDDALHATRAAVEEGIVPGGGVALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ A++ +K DN+DQ  GI+I+RKA+  P RQI +NAG++  +I  K+ ++   ++G++
Sbjct: 421 RASLAINKLKADNDDQRFGIDIIRKAVLAPMRQIAENAGEDGAVISGKVLDNDDYSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   F DM + GIIDP KVVR ALQ A S+AG+++ TEA+V + P+
Sbjct: 481 AQSGEFKDMVKAGIIDPTKVVRTALQDAASVAGLLITTEAMVAERPE 527


>gi|4581468|emb|CAB40143.1| chaperonin hsp60, GroEL [Rickettsia prowazekii]
          Length = 550

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 400/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M  K IK    AR+ +  G++ LA+AVK TLGPKGR V+I  SFGAP++TKDGVTVAKSI
Sbjct: 1   MTTKLIKHVQKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIKNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+ S+EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKRSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M AE+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   I +LG+AK+V +SK++T IV GNG  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K  N+DQ AGIEIV +AL  P +QI+KNAG+   ++V K+ E    NYG+N
Sbjct: 421 HASQTLTKLKVQNKDQQAGIEIVIEALKDPLKQIVKNAGENGGVVVGKLLEHNDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDK 529


>gi|117923611|ref|YP_864228.1| chaperonin GroEL [Magnetococcus sp. MC-1]
 gi|167008695|sp|A0L4C9|CH60_MAGSM RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|117607367|gb|ABK42822.1| chaperonin GroEL [Magnetococcus sp. MC-1]
          Length = 551

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 302/534 (56%), Positives = 402/534 (75%), Gaps = 2/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G AAR  +  GVN LA AVK TLGPKGR V++  S+GAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGEAARAKMLNGVNILANAVKVTLGPKGRNVVLDKSWGAPRMTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+V++ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVSSKTADVAGDGTTTATVLAQAIIREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  LK   ++V + +EI QV  ISAN D+ +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVVGLKGISREVANSQEIAQVGAISANSDKVVGDMIAEAMDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT+ ++M  ++ENP IL+ +KKIS LQ +L ILE A
Sbjct: 181 KGLETTLDVVEGMQFDRGYLSPYFVTNADKMLVQMENPLILLVEKKISNLQQILQILEGA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK ++ DIA + G  +
Sbjct: 241 VQSSRPLMIIAEDVEGEALATLVVNKLRGGLKVCAVKAPGFGDRRKAMMEDIATLTGGVL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AK +V++K+DTTI+ G G  E I+ R+N+I+  IE+T SDY
Sbjct: 301 VSEDVGVKLENVTMDMLGMAKSIVVTKEDTTIIDGAGDHEAIKARVNQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQA--LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RA +A   +++G N DQ  GI IV +AL  P R I  NAG E  ++V+++ E+K  N+G+
Sbjct: 421 RAREASLTNLQGANHDQQVGINIVTRALEEPLRIIASNAGAEGSVVVNRVVETKETNFGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA   V+ D+   G+IDP KVVR+ALQ+A S+AG+M+ TEA+V + PKDE A P
Sbjct: 481 NAATGVYEDLVASGVIDPAKVVRHALQAAASVAGLMITTEAMVAELPKDEPAMP 534


>gi|23499956|ref|NP_699396.1| chaperonin GroEL [Brucella suis 1330]
 gi|161620274|ref|YP_001594160.1| chaperonin GroEL [Brucella canis ATCC 23365]
 gi|163844383|ref|YP_001622038.1| chaperonin GroEL [Brucella suis ATCC 23445]
 gi|254699488|ref|ZP_05161316.1| chaperonin GroEL [Brucella suis bv. 5 str. 513]
 gi|254702612|ref|ZP_05164440.1| chaperonin GroEL [Brucella suis bv. 3 str. 686]
 gi|254711449|ref|ZP_05173260.1| chaperonin GroEL [Brucella pinnipedialis B2/94]
 gi|254719932|ref|ZP_05181743.1| chaperonin GroEL [Brucella sp. 83/13]
 gi|256014981|ref|YP_003104990.1| chaperonin GroEL [Brucella microti CCM 4915]
 gi|256029920|ref|ZP_05443534.1| chaperonin GroEL [Brucella pinnipedialis M292/94/1]
 gi|260568480|ref|ZP_05838949.1| chaperonin protein [Brucella suis bv. 4 str. 40]
 gi|261319057|ref|ZP_05958254.1| chaperonin [Brucella pinnipedialis B2/94]
 gi|261749942|ref|ZP_05993651.1| hsp60-like protein [Brucella suis bv. 5 str. 513]
 gi|261753195|ref|ZP_05996904.1| chaperonin [Brucella suis bv. 3 str. 686]
 gi|265984939|ref|ZP_06097674.1| chaperonin [Brucella sp. 83/13]
 gi|265986939|ref|ZP_06099496.1| chaperonin [Brucella pinnipedialis M292/94/1]
 gi|306838520|ref|ZP_07471358.1| chaperonin GroEL [Brucella sp. NF 2653]
 gi|306840975|ref|ZP_07473716.1| chaperonin GroEL [Brucella sp. BO2]
 gi|306845512|ref|ZP_07478081.1| chaperonin GroEL [Brucella sp. BO1]
 gi|29839332|sp|Q8FX87|CH60_BRUSU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189044130|sp|A9MDV1|CH60_BRUC2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189044131|sp|A9WXQ0|CH60_BRUSI RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|23463536|gb|AAN33401.1| chaperonin, 60 kDa [Brucella suis 1330]
 gi|161337085|gb|ABX63389.1| chaperonin GroEL [Brucella canis ATCC 23365]
 gi|163675106|gb|ABY39216.1| chaperonin GroEL [Brucella suis ATCC 23445]
 gi|255997641|gb|ACU49328.1| chaperonin GroEL [Brucella microti CCM 4915]
 gi|260155145|gb|EEW90226.1| chaperonin protein [Brucella suis bv. 4 str. 40]
 gi|261298280|gb|EEY01777.1| chaperonin [Brucella pinnipedialis B2/94]
 gi|261739695|gb|EEY27621.1| hsp60-like protein [Brucella suis bv. 5 str. 513]
 gi|261742948|gb|EEY30874.1| chaperonin [Brucella suis bv. 3 str. 686]
 gi|264659136|gb|EEZ29397.1| chaperonin [Brucella pinnipedialis M292/94/1]
 gi|264663531|gb|EEZ33792.1| chaperonin [Brucella sp. 83/13]
 gi|306273833|gb|EFM55660.1| chaperonin GroEL [Brucella sp. BO1]
 gi|306289032|gb|EFM60297.1| chaperonin GroEL [Brucella sp. BO2]
 gi|306406387|gb|EFM62628.1| chaperonin GroEL [Brucella sp. NF 2653]
          Length = 546

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 405/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|294085464|ref|YP_003552224.1| chaperonin cpn60/TcP-1 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665039|gb|ADE40140.1| Chaperonin Cpn60/TCP-1 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 549

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/536 (56%), Positives = 400/536 (74%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGSEARTKMLEGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKDI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQ+I  EG K V +G+NPMD+KRGI
Sbjct: 61  ELKDRFQNMGAQMVREVASKANDVAGDGTTTATVLAQSIAQEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE + A  K + + +E+ QV TISANG+ EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DMAVEAVVEKIVAGSKTISTSDEVAQVGTISANGEEEIGKMIAEAMERVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT  E+M A +E PYIL+++KK+S LQ +LPILE  
Sbjct: 181 KSLDTELDVVEGMQFDRGYLSPYFVTDAEKMRAVLEEPYILLHEKKLSNLQDMLPILEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAED+EG+ALATLVVNR+R GL V AVKAP FGDRRK ++ D+A +   TV
Sbjct: 241 VQSSRPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDLAILTNGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+ L+  T+  LGSAK+V ++KD+TTIV G+G    I+ R N+I+   E++ SDY
Sbjct: 301 VSEEVGIALDSLTLEMLGSAKRVEITKDETTIVDGSGDKTEIDARCNQIRAQAEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAV++VG  TE  + E+KDR  D++ ATRAA  EGIVPGGG+ALV
Sbjct: 361 DREKMQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDAMHATRAAVQEGIVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L  +K  N DQ  GI IVR+AL  P R I +NAG E  +IV K+ ES   N GY+
Sbjct: 421 RASVVLDGLKPANRDQEVGINIVRRALQAPARNIAENAGAEGSVIVGKLMESNDPNMGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A+ + + DM + G+IDP KVVR+ALQ+A S+AG+++ TEA+V + P+ +   P  P
Sbjct: 481 AKNNEYTDMIKAGVIDPTKVVRSALQNAASVAGLLVTTEAMVAEKPEPKDPMPAAP 536


>gi|240140086|ref|YP_002964563.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
 gi|240010060|gb|ACS41286.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
          Length = 540

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 306/538 (56%), Positives = 402/538 (74%), Gaps = 2/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D++RGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ +    +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITGRARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+E+PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELEDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK E A P  P+G
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPK-EKAPPLPPSG 537


>gi|225628658|ref|ZP_03786692.1| chaperonin GroEL [Brucella ceti str. Cudo]
 gi|260166978|ref|ZP_05753789.1| chaperonin GroEL [Brucella sp. F5/99]
 gi|261756364|ref|ZP_06000073.1| chaperonin [Brucella sp. F5/99]
 gi|225616504|gb|EEH13552.1| chaperonin GroEL [Brucella ceti str. Cudo]
 gi|261736348|gb|EEY24344.1| chaperonin [Brucella sp. F5/99]
          Length = 546

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 405/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|84686153|ref|ZP_01014048.1| chaperonin GroEL [Maritimibacter alkaliphilus HTCC2654]
 gi|84665680|gb|EAQ12155.1| chaperonin GroEL [Rhodobacterales bacterium HTCC2654]
          Length = 544

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 297/527 (56%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K  T AR+A+  GVNTLA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I  
Sbjct: 2   AKDVKFDTDARNAMLRGVNTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGIDL
Sbjct: 62  EDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVTEGMKSVAAGMNPMDLKRGIDL 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           A  +VVE ++A  + V   +E+ QV TISANG+  IG  IA AM+++G  G+IT+++ K 
Sbjct: 122 ATTKVVEAIQAAARPVNDSDEVAQVGTISANGETAIGRFIADAMQKVGNEGVITVEENKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TEV VV+GMQ DRGY+SPYFVT+ ++M AE+++ +IL+++KK+S+LQP++P+LE   Q
Sbjct: 182 METEVDVVEGMQFDRGYLSPYFVTNADKMIAELDDCFILLHEKKLSSLQPMVPLLEQVIQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           S +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  VIS
Sbjct: 242 SQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAVLTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E++G+KLE  T+  LG+AK + +SK++TTIV G G    IE R+ +I+  IE+T SDYDR
Sbjct: 302 EDLGMKLENVTMDMLGTAKTINISKEETTIVDGAGDKAEIEARVAQIRTQIEETSSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKLAGGVAV++VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV+ 
Sbjct: 362 EKLQERVAKLAGGVAVIKVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALVQG 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A+AL  ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES    +G+NAQ
Sbjct: 422 AKALDGLEGANSDQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESDDVKFGFNAQ 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
              +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+++
Sbjct: 482 TEEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPEEK 528


>gi|262372001|ref|ZP_06065280.1| chaperonin GroL [Acinetobacter junii SH205]
 gi|262312026|gb|EEY93111.1| chaperonin GroL [Acinetobacter junii SH205]
          Length = 544

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 404/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE ++AN K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRANAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+A++ DLG+A K+ +SK++T IV G G +E+I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQASLQDLGTAHKITVSKENTVIVDGAGNAEQIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNVLEGLKGANEDQTAGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKAAAP 532


>gi|53803988|ref|YP_114145.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath]
 gi|68566273|sp|Q607Q3|CH602_METCA RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|53757749|gb|AAU92040.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath]
          Length = 542

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 399/541 (73%), Gaps = 4/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++    AR  +  GVN LA+AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVRFSDDARHRMLAGVNILADAVKQTLGPKGRNVVLEKSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMDIKRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGLKSVAAGANPMDIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK   K     + I QV TISAN D  IG+ IA AM+ +G  G+IT+++ 
Sbjct: 121 DQAVGVVVEELKKLSKPCTDSKAIAQVGTISANSDESIGQIIAQAMDTVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M  E+ENPY+L++DKKIS+++ LLP+LE  
Sbjct: 181 SGLQNELDVVEGMQFDRGYLSPYFINKQDTMGVELENPYVLLHDKKISSIRDLLPVLEKT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GR L IIAEDV+G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRSLLIIAEDVDGEALATLVVNNMRGILKVCAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEK  + DLG AKK+ ++K+ TTIV G G ++ I+ R+ +I+K IEDT SDY
Sbjct: 301 ISEELGLSLEKVELTDLGQAKKIQINKETTTIVDGAGSADAIKARVEQIRKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QAL +++G N DQ  GI I+R+A+  P RQI+ NAG+E  ++++K+QE  T  +GYN
Sbjct: 421 RAQQALKTLEGKNHDQTVGIAILRRAIEEPLRQIVANAGEEPSVVLAKVQEG-TGTFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A  + +GDM EMGI+DP KV R+ALQ+A S+AG+ML TEA+V + PK E     MPAGGG
Sbjct: 480 AGTAEYGDMIEMGILDPTKVTRSALQNAASVAGLMLTTEAMVAEMPKKEKGG--MPAGGG 537

Query: 540 M 540
           M
Sbjct: 538 M 538


>gi|62317142|ref|YP_222995.1| chaperonin GroEL [Brucella abortus bv. 1 str. 9-941]
 gi|83269127|ref|YP_418418.1| chaperonin GroEL [Brucella melitensis biovar Abortus 2308]
 gi|189022403|ref|YP_001932144.1| chaperonin GroEL [Brucella abortus S19]
 gi|225686050|ref|YP_002734022.1| chaperonin GroEL [Brucella melitensis ATCC 23457]
 gi|237816703|ref|ZP_04595695.1| chaperonin GroEL [Brucella abortus str. 2308 A]
 gi|254691372|ref|ZP_05154626.1| chaperonin GroEL [Brucella abortus bv. 6 str. 870]
 gi|254695328|ref|ZP_05157156.1| chaperonin GroEL [Brucella abortus bv. 3 str. Tulya]
 gi|254698424|ref|ZP_05160252.1| chaperonin GroEL [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731871|ref|ZP_05190449.1| chaperonin GroEL [Brucella abortus bv. 4 str. 292]
 gi|256043115|ref|ZP_05446058.1| chaperonin GroEL [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111901|ref|ZP_05452857.1| chaperonin GroEL [Brucella melitensis bv. 3 str. Ether]
 gi|256256557|ref|ZP_05462093.1| chaperonin GroEL [Brucella abortus bv. 9 str. C68]
 gi|256262827|ref|ZP_05465359.1| hsp60-like protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260544378|ref|ZP_05820199.1| hsp60-like protein [Brucella abortus NCTC 8038]
 gi|260564339|ref|ZP_05834824.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260756985|ref|ZP_05869333.1| chaperonin groEL protein [Brucella abortus bv. 6 str. 870]
 gi|260759641|ref|ZP_05871989.1| chaperonin groEL protein [Brucella abortus bv. 4 str. 292]
 gi|260762884|ref|ZP_05875216.1| groEL protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882796|ref|ZP_05894410.1| hsp60-like protein [Brucella abortus bv. 9 str. C68]
 gi|261215698|ref|ZP_05929979.1| groEL protein [Brucella abortus bv. 3 str. Tulya]
 gi|265989547|ref|ZP_06102104.1| hsp60-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993350|ref|ZP_06105907.1| hsp60-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|297249914|ref|ZP_06933615.1| chaperonin GroL [Brucella abortus bv. 5 str. B3196]
 gi|119366230|sp|Q2YIJ3|CH60_BRUA2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704094|sp|B2SCZ4|CH60_BRUA1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813876|sp|C0RKD5|CH60_BRUMB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|259585897|sp|P0CB35|CH60_BRUAB RecName: Full=60 kDa chaperonin; AltName: Full=BA60K; AltName:
           Full=GroEL protein; AltName: Full=Hsp60; AltName:
           Full=Protein Cpn60
 gi|144113|gb|AAA22998.1| heat shock protein [Brucella abortus]
 gi|62197335|gb|AAX75634.1| GroEL, 60 kDa chaperonin [Brucella abortus bv. 1 str. 9-941]
 gi|82939401|emb|CAJ12355.1| Chaperonin Cpn60:Chaperonin Cpn60/TCP-1 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020977|gb|ACD73698.1| Chaperonin Cpn60/TCP-1 [Brucella abortus S19]
 gi|225642155|gb|ACO02068.1| chaperonin GroEL [Brucella melitensis ATCC 23457]
 gi|237787516|gb|EEP61732.1| chaperonin GroEL [Brucella abortus str. 2308 A]
 gi|260097649|gb|EEW81523.1| hsp60-like protein [Brucella abortus NCTC 8038]
 gi|260151982|gb|EEW87075.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260669959|gb|EEX56899.1| chaperonin groEL protein [Brucella abortus bv. 4 str. 292]
 gi|260673305|gb|EEX60126.1| groEL protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677093|gb|EEX63914.1| chaperonin groEL protein [Brucella abortus bv. 6 str. 870]
 gi|260872324|gb|EEX79393.1| hsp60-like protein [Brucella abortus bv. 9 str. C68]
 gi|260917305|gb|EEX84166.1| groEL protein [Brucella abortus bv. 3 str. Tulya]
 gi|262764220|gb|EEZ10252.1| hsp60-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|263000216|gb|EEZ12906.1| hsp60-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092649|gb|EEZ16870.1| hsp60-like protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297173783|gb|EFH33147.1| chaperonin GroL [Brucella abortus bv. 5 str. B3196]
 gi|326410375|gb|ADZ67439.1| chaperonin GroEL [Brucella melitensis M28]
 gi|326553668|gb|ADZ88307.1| chaperonin GroEL [Brucella melitensis M5-90]
          Length = 546

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 405/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|118590677|ref|ZP_01548078.1| chaperonin GroEL [Stappia aggregata IAM 12614]
 gi|118436653|gb|EAV43293.1| chaperonin GroEL [Stappia aggregata IAM 12614]
          Length = 531

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/509 (58%), Positives = 393/509 (77%), Gaps = 1/509 (0%)

Query: 19  GVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVA 78
           GV+TLA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I  ++ F  +GA+M+R+VA
Sbjct: 4   GVDTLANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVA 63

Query: 79  TNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV 138
           + T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+DLA  E V+ L A  K +
Sbjct: 64  SKTNDIAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGVDLAAAEAVKALTAASKTI 123

Query: 139 GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRG 198
            +  E+ QV TISANGD ++G+ IA AM+++G  G+IT+++AK+  TE+ VV+GMQ DRG
Sbjct: 124 TTSAEVAQVGTISANGDEQVGKDIAEAMQKVGNEGVITVEEAKSLETELEVVEGMQFDRG 183

Query: 199 YISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDA 258
           Y+SPYFVT+ ++M A++E PYIL+++KK+S LQ +LPILE+  QS RPL IIAEDVEG+A
Sbjct: 184 YLSPYFVTNADKMMADLEKPYILLHEKKLSNLQAMLPILEAVVQSSRPLLIIAEDVEGEA 243

Query: 259 LATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLG 318
           LATLVVN++R GL + AVKAP FGDRRK +L DIA + G TVISE++G+KLE  T+  LG
Sbjct: 244 LATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEDLGIKLENVTLDMLG 303

Query: 319 SAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV 378
           +A+KV ++K++TTIV G G  + I GR+++I+  IE+T SDYDR+KL+ERLAKLAGGVAV
Sbjct: 304 TAEKVSITKENTTIVDGAGSKDDINGRVSQIKAQIEETTSDYDREKLQERLAKLAGGVAV 363

Query: 379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALS-VKGDNEDQCA 437
           + VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+RA +A+  +K DN D  A
Sbjct: 364 IRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALLRAKKAVEGLKSDNADIAA 423

Query: 438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPV 497
           GI+IV +AL  P RQI +NAG E  ++V KIQE+   ++G+NAQ   F +M E GIIDP 
Sbjct: 424 GIKIVLRALEAPIRQIAENAGVEGSIVVGKIQENDDPSFGFNAQTEQFVNMIEAGIIDPT 483

Query: 498 KVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           KVVR ALQ A S+AG+++ TEA+V + PK
Sbjct: 484 KVVRTALQDAASVAGLLITTEAMVAELPK 512


>gi|332143307|ref|YP_004429045.1| chaperonin GroEL [Alteromonas macleodii str. 'Deep ecotype']
 gi|226704079|sp|B4S112|CH60_ALTMD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|327553329|gb|AEB00048.1| chaperonin GroEL [Alteromonas macleodii str. 'Deep ecotype']
          Length = 546

 Score =  604 bits (1558), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 400/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++ G  AR  +  GVNTLA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVRFGDDARSKMLKGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D E+G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKALSTDCADSKSIAQVGTISANSDAEVGDIIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E++NP+IL+ DKKIS ++ LLP LE  
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVELDNPFILLVDKKISNIRELLPTLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL+LEK  + DLG+AK+VV++KD+TT+V GNG  E IEGR  +I+  IE++ SDY
Sbjct: 301 ISEEIGLELEKVQLEDLGTAKRVVINKDNTTVVDGNGDQEAIEGRCAQIKGQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  LS + GDNEDQ  G+++  +A+  P RQI  N+G E+ ++V++++     NYGYN
Sbjct: 421 RAAAKLSELTGDNEDQTVGVKLALRAMEAPLRQISINSGAEASVVVNEVKNGD-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA+V + PKDE A+P MP  
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFASSIASLMITTEAMVAELPKDE-AAPAMPDM 536


>gi|330813618|ref|YP_004357857.1| heat shock protein 60 family chaperone GroEL [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486713|gb|AEA81118.1| heat shock protein 60 family chaperone GroEL [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 555

 Score =  604 bits (1558), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 303/531 (57%), Positives = 399/531 (75%), Gaps = 5/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M  K +K  T AR+A+  GV+ LA AVK TLGPKGR V+I  S+GAPR+TKDGVTVAK I
Sbjct: 1   MVGKIVKFDTEARNAMLRGVDILANAVKVTLGPKGRNVVIDKSYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVKEVASKTNDEAGDGTTTATVLAQAIAKEGCKFVAAGMNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  V++ +K N KKV + EEI QV TISANG++EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTAVIQRIKDNSKKVKTTEEIAQVGTISANGEKEIGDMIAKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRG++SPYF+T+ ++MT E+ NP IL+ DKK+S LQ ++P+LES 
Sbjct: 181 KGLQTELDVVEGMQFDRGFLSPYFITNADKMTTELNNPLILLCDKKLSNLQSIVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL IIAE+VEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQASRPLLIIAEEVEGEALATLVVNKLRGGLKVCAVKAPGFGDRRKSMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI DLGS K + + KD+TTIV G+G    IE R   I+K I+++ SDY
Sbjct: 301 ISEDLGIKLENVTIKDLGSCKSIKVDKDNTTIVDGSGKKADIESRCASIKKQIDESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+AT+AA  EG+V GGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATKAAVQEGVVTGGGCALL 420

Query: 421 RAAQAL---SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYG 477
            A  AL    VKGD  DQ AG+E++RKAL  P RQII NAG ++ ++V K+ E K  NYG
Sbjct: 421 YALDALDTIKVKGD--DQKAGVELIRKALQAPIRQIINNAGVDASVVVGKLLEGKKGNYG 478

Query: 478 YNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           Y+AQ   + DM   GIIDP KVVR ALQ A S++G+++ TEA++ D P D+
Sbjct: 479 YDAQNEEYVDMIAKGIIDPTKVVRTALQDAASISGLLITTEAMIADKPDDK 529


>gi|91774720|ref|YP_544476.1| chaperonin GroEL [Methylobacillus flagellatus KT]
 gi|118597118|sp|Q1H4F2|CH60_METFK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|91708707|gb|ABE48635.1| chaperonin GroEL [Methylobacillus flagellatus KT]
          Length = 544

 Score =  604 bits (1558), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 305/543 (56%), Positives = 402/543 (74%), Gaps = 3/543 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  I  GVN LA AVK TLGPKGR V++  SFG+P VTKDGV+VAK I
Sbjct: 1   MAAKQVIFGDDARAKIVNGVNILANAVKVTLGPKGRNVVLERSFGSPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG NP D+KRGI
Sbjct: 61  ELSDKLENMGAQLVKEVASKTNDNAGDGTTTATVLAQAIVREGFKYVAAGFNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV E+V  +KA  K   + +EI QV +ISAN D +IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAEIVNEIKAIAKPTTTSKEIAQVGSISANSDADIGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + ER  A +ENP++L+YDKKIS ++ LLP LE  
Sbjct: 181 SGLQNELDVVEGMQFDRGYLSPYFINNPERQIALLENPFVLLYDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKAVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ +LG AK+V + K++TTI+ G G    I+ RI++I+K IED  SDY
Sbjct: 301 IAEEVGLSLEKVTLENLGQAKRVEIGKENTTIIDGAGSENNIKVRIDQIKKQIEDATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  ++  +KGDN DQ AGI+IV +A+  P RQI+ NAGDE  ++V+K+ E  T NYGYN
Sbjct: 421 RARSSIKELKGDNPDQDAGIKIVLRAIEEPLRQIVANAGDEPSVVVNKVLEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    +GD+ E+G++DP KV R+ALQ+A S+A ++L T+A+V + PK+E A+P MP  GG
Sbjct: 480 ASNGTYGDLVELGVLDPAKVTRSALQNAASVASLILTTDALVAELPKEE-AAPAMPDAGG 538

Query: 540 MGG 542
           MGG
Sbjct: 539 MGG 541


>gi|294853212|ref|ZP_06793884.1| chaperonin GroL [Brucella sp. NVSL 07-0026]
 gi|294818867|gb|EFG35867.1| chaperonin GroL [Brucella sp. NVSL 07-0026]
          Length = 546

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 405/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESITLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|256059570|ref|ZP_05449769.1| chaperonin GroEL [Brucella neotomae 5K33]
 gi|261323538|ref|ZP_05962735.1| chaperonin [Brucella neotomae 5K33]
 gi|261299518|gb|EEY03015.1| chaperonin [Brucella neotomae 5K33]
          Length = 546

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLTGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|71082868|ref|YP_265587.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
 gi|119366256|sp|Q4FPA5|CH60_PELUB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|71061981|gb|AAZ20984.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
          Length = 554

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 401/529 (75%), Gaps = 5/529 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK +K  + AR A+  GV+ LA  VK TLGPKGR V+I  S+GAPR+TKDGV+VAK I  
Sbjct: 2   AKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEIDL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T + +GDGTTTAT LAQAI  EG KYVTAG+NPMD+KRGID 
Sbjct: 62  EDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGIDA 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+ V   L A+ KKV   +EI QV TISANGD+EIG  IA AM+++G  G+IT+++AK 
Sbjct: 122 AVEHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE+ VV+GMQ DRGY+SPYF+T+ ++MT E+ENP+IL+++KK++ LQP++P+LE+  Q
Sbjct: 182 VETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           +GRPL II+EDVEG+ALATLVVN++R GL V+AVKAP FGDRRK +L DIA + G  VIS
Sbjct: 242 AGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E+IG+KLE   + DLGS K+V + KD++TI+ GNG    IE R  +I++ + +T SDYDR
Sbjct: 302 EDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV++VG  TE  + E+KDR +D+L+ATRAA++EGIV GGG AL+ A
Sbjct: 362 EKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALLYA 421

Query: 423 AQA---LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +Q+   L VKGD  DQ AG+ +V KAL  P RQI  NAG +  ++V K+ E    N GY+
Sbjct: 422 SQSLDTLKVKGD--DQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DMF  GIIDPVKVVR ALQ A S+AG+++ TEA++ D P D+
Sbjct: 480 AQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPDDK 528


>gi|319782425|ref|YP_004141901.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168313|gb|ADV11851.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 543

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 395/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+IK  T ARD +  GV  L  AVK TLGPKGR VII  ++GAPR+TKDGVTVAK I
Sbjct: 1   MSAKEIKFSTDARDRMLRGVEILTNAVKVTLGPKGRNVIIDKAYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA +I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGAKLVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ ++A  KKV S  EI QV TI+ANGD  +GE IA AM+++G  G+IT+++A
Sbjct: 121 DQAVSAVVKEIQARAKKVKSSAEIAQVGTIAANGDASVGEMIAKAMDKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PYILI++KK+  LQ +LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNADKMRVELEEPYILIHEKKLGNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTSGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AK+V++ KD TTI+ G G    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIEMLGRAKRVLIEKDTTTIIDGAGTKATIQARVAQIKGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG VTE+ + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGVTESEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  + G N D  AGI IV +AL  P RQI +N+G E  ++V K+ +SK  N G++
Sbjct: 421 RARSALGGLTGANADVTAGITIVLRALEAPIRQIAENSGVEGSIVVGKLTDSKDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ  V+ DM + GI+DP KVVR ALQ AGS+A +++  EA++ D P  + A
Sbjct: 481 AQNEVYVDMIKAGIVDPAKVVRTALQDAGSIAALLITAEAMITDVPAKDAA 531


>gi|254712052|ref|ZP_05173863.1| chaperonin GroEL [Brucella ceti M644/93/1]
 gi|254715121|ref|ZP_05176932.1| chaperonin GroEL [Brucella ceti M13/05/1]
 gi|261216829|ref|ZP_05931110.1| chaperonin [Brucella ceti M13/05/1]
 gi|261319696|ref|ZP_05958893.1| chaperonin [Brucella ceti M644/93/1]
 gi|260921918|gb|EEX88486.1| chaperonin [Brucella ceti M13/05/1]
 gi|261292386|gb|EEX95882.1| chaperonin [Brucella ceti M644/93/1]
          Length = 546

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DFAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|163737788|ref|ZP_02145205.1| chaperonin GroEL [Phaeobacter gallaeciensis BS107]
 gi|163742906|ref|ZP_02150290.1| chaperonin GroEL [Phaeobacter gallaeciensis 2.10]
 gi|161383870|gb|EDQ08255.1| chaperonin GroEL [Phaeobacter gallaeciensis 2.10]
 gi|161389314|gb|EDQ13666.1| 60 kDa chaperonin [Phaeobacter gallaeciensis BS107]
          Length = 550

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 299/531 (56%), Positives = 403/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLNGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKAMAREVKDSAEVAQVGTISANGESEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETTVVEGMQFDRGYLSPYFVTNADKMVADLEDCMILLHEKKLSSLQAMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIEITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  ++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES   N+G+N
Sbjct: 421 QAGKALEGLEGANADQNAGIVIVRKAIEAPLRQIAENAGVDGAVVAGKVRESSDNNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  + A
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVARTALEDAASVAGLLITTEAMVADKPSKDGA 531


>gi|294012111|ref|YP_003545571.1| chaperonin GroEL [Sphingobium japonicum UT26S]
 gi|292675441|dbj|BAI96959.1| chaperonin GroEL [Sphingobium japonicum UT26S]
          Length = 548

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 304/531 (57%), Positives = 394/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VVE +KA  K V   +E+ QV  ISANGDRE+GEKIA AM+++G  G+IT+++A
Sbjct: 121 DLAVAKVVEDVKARSKPVSGSQEVAQVGIISANGDREVGEKIAEAMDRVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLDFELDVVEGMQFDRGYLSPYFITNPEKMQVELADPYILIHEKKLSNLQSILPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTKGEV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V + KD+TTIV G G  E I+GR  +I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGTAKRVTIDKDNTTIVDGAGDGEAIKGRTEQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +KG N+DQ  GI+I+RKA+  P RQI +NAG +  ++   +        G+N
Sbjct: 421 YATKALKDLKGANDDQTRGIDIIRKAIEAPLRQIAQNAGVDGAVVAGNLLRENDETKGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    + ++   G+IDP KVVR ALQ A S+AG+++ TEA + + P D+ A
Sbjct: 481 AATDTYENLVAAGVIDPTKVVRAALQDAASVAGLLITTEATIAELPSDDKA 531


>gi|254706256|ref|ZP_05168084.1| chaperonin GroEL [Brucella pinnipedialis M163/99/10]
 gi|261313701|ref|ZP_05952898.1| chaperonin [Brucella pinnipedialis M163/99/10]
 gi|261302727|gb|EEY06224.1| chaperonin [Brucella pinnipedialis M163/99/10]
          Length = 546

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ LATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEVLATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|255318906|ref|ZP_05360132.1| chaperonin GroL [Acinetobacter radioresistens SK82]
 gi|262378839|ref|ZP_06071996.1| chaperonin GroL [Acinetobacter radioresistens SH164]
 gi|255304162|gb|EET83353.1| chaperonin GroL [Acinetobacter radioresistens SK82]
 gi|262300124|gb|EEY88036.1| chaperonin GroL [Acinetobacter radioresistens SH164]
          Length = 544

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 299/533 (56%), Positives = 403/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARTKMIAGVNTLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VVE ++A  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DLAVKTVVENIRATAKPADDFKAIEQVGSISANSDETVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDSLDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+A + DLG+A KV +SK++T IV G G ++ I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQANLEDLGTAHKVTVSKENTVIVDGAGNADAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL  + G+N+DQ  GI I+R+A+  P RQI+ NAGDE  ++++ ++ S   NYGYN
Sbjct: 421 RAAKALDGLTGNNDDQNVGINILRRAIEAPLRQIVSNAGDEPSVVINAVK-SGEGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A P
Sbjct: 480 AASGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAVP 532


>gi|91762709|ref|ZP_01264674.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718511|gb|EAS85161.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
          Length = 554

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 400/529 (75%), Gaps = 5/529 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK +K  + AR A+  GV+ LA  VK TLGPKGR V+I  S+GAPR+TKDGV+VAK I  
Sbjct: 2   AKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEIDL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T + +GDGTTTAT LAQAI  EG KYVTAG+NPMD+KRGID 
Sbjct: 62  EDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGIDS 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV  V   L A+ KKV   +EI QV TISANGD+EIG  IA AM+++G  G+IT+++AK 
Sbjct: 122 AVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE+ VV+GMQ DRGY+SPYF+T+ ++MT E+ENP+IL+++KK++ LQP++P+LE+  Q
Sbjct: 182 VETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           +GRPL II+EDVEG+ALATLVVN++R GL V+AVKAP FGDRRK +L DIA + G  VIS
Sbjct: 242 AGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E+IG+KLE   + DLGS K+V + KD++TI+ GNG    IE R  +I++ + +T SDYDR
Sbjct: 302 EDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV++VG  TE  + E+KDR +D+L+ATRAA++EGIV GGG AL+ A
Sbjct: 362 EKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALLYA 421

Query: 423 AQA---LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +Q+   L VKGD  DQ AG+ +V KAL  P RQI  NAG +  ++V K+ E    N GY+
Sbjct: 422 SQSLDTLKVKGD--DQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DMF  GIIDPVKVVR ALQ A S+AG+++ TEA++ D P D+
Sbjct: 480 AQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPDDK 528


>gi|206889461|ref|YP_002248448.1| chaperonin GroL [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226704186|sp|B5YJN3|CH60_THEYD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|206741399|gb|ACI20456.1| chaperonin GroL [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 540

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 397/537 (73%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G AAR +I  GV  L +AVK TLGP+GR V+I   FG+P VTKDGVTVAK I
Sbjct: 1   MAAKQLIFGDAARQSILKGVTLLTDAVKATLGPRGRNVVIERKFGSPNVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K  F  +GA+++R+VA+ T D +GDGTTTAT LA AIY EG KYV+AG N MD+KRGI
Sbjct: 61  DLKEPFENMGAQLVREVASKTSDVAGDGTTTATVLAYAIYKEGLKYVSAGANSMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VVE LK   K V  ++EI QV TISAN D  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVEAVVEELKKISKPVVDKKEIAQVGTISANNDVSIGELIAEAMDKVGKDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + +V+GMQ DRGYISPYF+T  ER+   +E+ ++LI+DKKIS ++ LLPILE  
Sbjct: 181 KGMATTLDIVEGMQFDRGYISPYFITDPERLECILEDAFVLIHDKKISTMKDLLPILEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            + GRPL IIAEDVEG+ALATLVVN++R  L V AVKAP FG+RRK +L DIA + G TV
Sbjct: 241 ARMGRPLLIIAEDVEGEALATLVVNKLRGVLQVCAVKAPGFGERRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IGLKLE   + DLG AKK+++ KD+TTIV G G  ++I+ RI +I+  I++T SDY
Sbjct: 301 ISEDIGLKLENVKVEDLGKAKKIIIDKDNTTIVEGAGDPQKIQARIKQIKVQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVA + VG  TEA + EKK R +D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVARINVGAATEAEMKEKKARVEDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  +AL  +K +N DQ  G EIV+KAL  P +QII NAG E+ LIV K++E+K  NYGY+
Sbjct: 421 RCQKALEKIKFENHDQQLGAEIVKKALEEPIKQIIANAGVEATLIVEKVKENKNINYGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    F DM E GIIDP KV R ALQ+A S+AG+ML TE +V + P++E   P MP+
Sbjct: 481 AYAEKFVDMMEAGIIDPTKVTRTALQNAASVAGLMLTTEVLVAEIPEEEK-KPPMPS 536


>gi|222082175|ref|YP_002541540.1| chaperonin GroEL [Agrobacterium radiobacter K84]
 gi|221726854|gb|ACM29943.1| chaperonin GroL [Agrobacterium radiobacter K84]
          Length = 544

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 308/546 (56%), Positives = 401/546 (73%), Gaps = 4/546 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AK I+    ARD +  GV  L  AVK TLGPKGR V+I +++GAPR+TKDGVTVAK I
Sbjct: 1   MTAKQIRFSADARDRMLRGVELLNNAVKVTLGPKGRNVVIASAYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LA +I  EG K V  G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGIKLVAVGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ ++A  KKV S  EI QV TI+ANGD  +GE IA AM+++G  G+IT+++A
Sbjct: 121 DIAVAAVVKEIQARAKKVQSSGEIAQVGTIAANGDASVGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYIL+++KK+  LQ +LPILE+ 
Sbjct: 181 RTADTELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILLHEKKLGNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGQPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AK+V++ KD TTI+ G+G    I+ R+ +I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENITIDMLGRAKRVLIEKDTTTIIDGSGEKVAIQARVQQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG VTE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGVTEIEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ + G+N D  AGI IV +AL  P RQI  NAG E  ++V K+  S   N G++
Sbjct: 421 RAKSALTGLTGENADMTAGISIVLRALEAPIRQIADNAGVEGSIVVGKLIGSTDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GI+DP KVVR ALQ AGS+A +++  EA++ D P  E+A     AG G
Sbjct: 481 AQTETYVDMVKAGIVDPAKVVRTALQDAGSIAALLITAEAMIADIPARESAQ---AAGNG 537

Query: 540 MGGGMG 545
             GGMG
Sbjct: 538 DMGGMG 543


>gi|149913713|ref|ZP_01902246.1| chaperonin GroEL [Roseobacter sp. AzwK-3b]
 gi|149812833|gb|EDM72662.1| chaperonin GroEL [Roseobacter sp. AzwK-3b]
          Length = 547

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/531 (56%), Positives = 402/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFNTDARNKLLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   + V + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVAAIKDAARPVENSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++M AE+E+  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMVAELEDCLILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVSITKDETTIVDGAGNKSEIEARVGQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL  + G N DQ  GIEIVR AL  P RQI +NAG +  ++  KI+ES    +GYN
Sbjct: 421 QGAKALDGMTGANADQMRGIEIVRLALEAPLRQIAENAGVDGSVVAGKIRESNDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ + A
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLVTTEAMVADKPQKDGA 531


>gi|27377170|ref|NP_768699.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|543997|sp|P35862|CH603_BRAJA RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|12620753|gb|AAG61029.1|AF322013_148 GroEL3 [Bradyrhizobium japonicum]
 gi|312976|emb|CAA80316.1| GroEL3 [Bradyrhizobium japonicum]
 gi|27350313|dbj|BAC47324.1| GroEL3 chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 546

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/543 (56%), Positives = 414/543 (76%), Gaps = 1/543 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV+ LA AV+ TLGPKGR V++  SFGAPR+TKDGV VAK I
Sbjct: 1   MSAKEVKFGVNARDRMLRGVDILANAVQVTLGPKGRNVVLDKSFGAPRITKDGVAVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+   D++GDGTTTAT LA AI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKAADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L+ N KKV S +EI QV  ISANGD+EIG+ +A A++++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLQKNSKKVTSNDEIAQVGAISANGDQEIGKFLADAVKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ YILI +KK+S+L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  ++ +N+DQ  G+EIVRKALS+P RQI  NAG++  ++V K+ +++  ++G++
Sbjct: 421 RASEQLKGLRTENDDQKTGVEIVRKALSWPARQIAINAGEDGSIVVGKVLDNEQYSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + ++   GIIDP KVVR A+Q+A S+AG+++ TEA+V + PK  TA P MPA  G
Sbjct: 481 AQTGEYSNLVSKGIIDPAKVVRIAVQNASSVAGLLITTEAMVAELPKKATAGPAMPAAPG 540

Query: 540 MGG 542
           MGG
Sbjct: 541 MGG 543


>gi|325274982|ref|ZP_08140982.1| chaperonin GroEL [Pseudomonas sp. TJI-51]
 gi|324099889|gb|EGB97735.1| chaperonin GroEL [Pseudomonas sp. TJI-51]
          Length = 546

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 395/532 (74%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   VV  LK   K     + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAVVAELKNLSKPCADSKAIAQVGTISANSDSSIGEIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E+P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELESPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQA-LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A + +KGDNEDQ  GI ++R+A+  P RQI  NAGDE  ++  K+++  + N+GYN
Sbjct: 421 RALAAIIDLKGDNEDQNVGIALLRRAVEAPLRQITANAGDEPSVVADKVKQG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D P+D+ A+
Sbjct: 480 AASGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDKPAA 531


>gi|148549568|ref|YP_001269670.1| chaperonin GroEL [Pseudomonas putida F1]
 gi|166201742|sp|A5W8M6|CH60_PSEP1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148513626|gb|ABQ80486.1| chaperonin GroEL [Pseudomonas putida F1]
 gi|313500413|gb|ADR61779.1| GroEL [Pseudomonas putida BIRD-1]
          Length = 546

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 394/532 (74%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   VV  LK   K     + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KGDNEDQ  GI ++R+A+  P RQI  NAGDE  ++  K+++  + N+GYN
Sbjct: 421 RALAAIVDLKGDNEDQNVGIALLRRAVESPLRQITANAGDEPSVVADKVKQG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D P+D+ A+
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDKPAA 531


>gi|307293651|ref|ZP_07573495.1| chaperonin GroEL [Sphingobium chlorophenolicum L-1]
 gi|306879802|gb|EFN11019.1| chaperonin GroEL [Sphingobium chlorophenolicum L-1]
          Length = 545

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 304/531 (57%), Positives = 394/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VVE +KA  K V   +E+ QV  ISANGD E+G+KIA AME++G  G+IT+++A
Sbjct: 121 DLAVAKVVEDVKARSKPVSGSQEVAQVGIISANGDVEVGQKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLDFELDVVEGMQFDRGYLSPYFITNPEKMAVELADPYILIHEKKLSNLQSILPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTKGEV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V + KD+TTIV G G SE I+GR  +I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGTAKRVTIDKDNTTIVDGAGDSEAIKGRTEQIRAQIESTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +KG N+DQ  GI+I+RKA+  P RQI +NAG +  ++   +        G+N
Sbjct: 421 YATKALEGLKGANDDQTRGIDIIRKAIEAPLRQIAQNAGVDGAVVAGNLLRENDETKGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    + ++   G+IDP KVVR ALQ A S+AG+++ TEA + + P D+ A
Sbjct: 481 AATDTYENLVAAGVIDPTKVVRAALQDAASVAGLLITTEATIAELPADDKA 531


>gi|144111|gb|AAA22997.1| GroEL [Brucella abortus]
          Length = 546

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISAN + EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANAEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|23015493|ref|ZP_00055267.1| COG0459: Chaperonin GroEL (HSP60 family) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 552

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 307/527 (58%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRG+
Sbjct: 61  ELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  +K+  +KV +  EI QV TISANG++EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVAAVVADVKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E++NPYIL+++KK+S LQPLLP+LE  
Sbjct: 181 KGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTVELDNPYILLHEKKLSGLQPLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG++K++ ++K+DTTIV G+G    I+ R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLESVNLEMLGTSKRITITKEDTTIVDGSGDKSAIDARCKQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGASEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +K  N DQ  GI IVR+AL  P RQI +NAG +  ++  KI ESK   +G++
Sbjct: 421 HAVKALEGLKSGNADQEVGISIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDLAFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ  V+ DM + GIIDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGVYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPK 527


>gi|26988095|ref|NP_743520.1| chaperonin GroEL [Pseudomonas putida KT2440]
 gi|38257490|sp|Q88N55|CH60_PSEPK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|24982821|gb|AAN66984.1|AE016326_10 chaperonin, 60 kDa [Pseudomonas putida KT2440]
          Length = 546

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 394/532 (74%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   VV  LK   K     + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQA-LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A + +KGDNEDQ  GI ++R+A+  P RQI  NAGDE  ++  K+++  + N+GYN
Sbjct: 421 RALAAIIDLKGDNEDQNVGIALLRRAVESPLRQITANAGDEPSVVADKVKQG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D P+D+ A+
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDKPAA 531


>gi|256158089|ref|ZP_05456007.1| chaperonin GroEL [Brucella ceti M490/95/1]
 gi|265996604|ref|ZP_06109161.1| chaperonin [Brucella ceti M490/95/1]
 gi|262550901|gb|EEZ07062.1| chaperonin [Brucella ceti M490/95/1]
          Length = 542

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVMLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|146308703|ref|YP_001189168.1| chaperonin GroEL [Pseudomonas mendocina ymp]
 gi|166201741|sp|A4XYM0|CH60_PSEMY RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|145576904|gb|ABP86436.1| chaperonin GroEL [Pseudomonas mendocina ymp]
          Length = 548

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 298/536 (55%), Positives = 399/536 (74%), Gaps = 4/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DKATSAIVAQLKDLAKPCADSKAIAQVGTISANSDNSIGDIIAEAMDKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++KD+TTI+ G G    IE R+ +I+K +E+T SDY
Sbjct: 301 ISEEVGLSLESATLEHLGNAKRVVLNKDNTTIIDGAGAQADIEARVAQIRKQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNEDQ  GI ++R+A+  P RQI+ NAG E  ++V K+++  + N+G+N
Sbjct: 421 RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANAGGEPSVVVDKVKQG-SGNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +A  D+  +P MP
Sbjct: 480 AATDTYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEAADDK--APAMP 533


>gi|256252956|ref|ZP_05458492.1| chaperonin GroEL [Brucella ceti B1/94]
 gi|261220048|ref|ZP_05934329.1| chaperonin [Brucella ceti B1/94]
 gi|260918632|gb|EEX85285.1| chaperonin [Brucella ceti B1/94]
          Length = 546

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVMLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|163795486|ref|ZP_02189452.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199]
 gi|159179085|gb|EDP63618.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199]
          Length = 552

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/531 (56%), Positives = 400/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFNVDARDRMLRGVDILANAVKVTLGPKGRNVVLQKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG + V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGVRAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  +K+  KK+ + +EI QV TISANG ++IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADVKSRTKKIKTSDEIAQVGTISANGAKDIGEMIAKAMDKVGREGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ +V+GMQ DRGY+SPYFVT+ ++M  E+E+P ILI++KK+S LQ +LP+LE  
Sbjct: 181 KSLGTELDIVEGMQFDRGYLSPYFVTNADKMVCELESPLILIHEKKLSGLQAMLPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 ARGQRPLLILAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G++LE  T+  LG+AKKV ++KD TTIV G G  + I+ R  +I+  IEDT SDY
Sbjct: 301 ISEDLGIQLENVTLDMLGTAKKVSLTKDTTTIVDGAGKKKDIQARCAQIRAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+A+  +   N DQ  G +I+R+AL  P RQI +NAG +  +IV K+ E K+ ++GYN
Sbjct: 421 YAAKAIDKLTPGNADQRTGFDIIRRALQAPARQIAENAGADGSIIVGKLLEQKSTSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ  VF D+ + G+IDP KVVR ALQ A S+AG+++ TEA+V D P+ + A
Sbjct: 481 AQTGVFEDLIKAGVIDPTKVVRTALQDAASIAGLLITTEAMVADKPEPKPA 531


>gi|254362013|ref|ZP_04978143.1| chaperone GroEL [Mannheimia haemolytica PHL213]
 gi|261493438|ref|ZP_05989963.1| chaperone GroEL [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496873|ref|ZP_05993241.1| chaperone GroEL [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153093562|gb|EDN74539.1| chaperone GroEL [Mannheimia haemolytica PHL213]
 gi|261307397|gb|EEY08732.1| chaperone GroEL [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310932|gb|EEY12110.1| chaperone GroEL [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 546

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/534 (56%), Positives = 401/534 (75%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNILADAVKVTLGPKGRNVVLDRAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVEELKAISKPCETSKEIEQVGTISANSDSTVGQLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYIL+ DKK+S ++ LLP+LE  
Sbjct: 181 TGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKVSNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ +LG AK+VV+SKD+TTI+ G G   +I+GR+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATLEELGQAKRVVISKDNTTIIDGIGDETQIKGRVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   ++E  + NYGY
Sbjct: 421 RAANKVADTLKGDNEEQNVGIKLALRAMEAPLRQIVANAGEEASVVARNVKEG-SGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PK+E   P
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKEEKLDP 533


>gi|296532320|ref|ZP_06895058.1| chaperonin GroL [Roseomonas cervicalis ATCC 49957]
 gi|296267344|gb|EFH13231.1| chaperonin GroL [Roseomonas cervicalis ATCC 49957]
          Length = 547

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 302/527 (57%), Positives = 397/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGASARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELADKFENMGAQMVREVASKQNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  +K+ +  E+ QV T+SANG+ EIG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVAVVVEELKARTRKITTSAEVAQVGTLSANGEAEIGSMIAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+ENPYILI++KK+S LQP+LP+LES 
Sbjct: 181 KGIQTELDVVEGMQFDRGYVSPYFITNAEKMIAELENPYILIHEKKLSQLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK + + K++TTIV G G  + I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLQMLGQAKTIRIEKENTTIVDGAGSKDDIQGRVEQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGI-AL 419
           DR+KL+ERLAKLAGGVAV+ VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+  L
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGGSEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 420 VRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             AA+   +KGDN DQ  GIEIVR+A+S P +QI +NAG +  +I  ++    T  YGY+
Sbjct: 421 RAAAKLADLKGDNNDQHVGIEIVRRAISVPLKQIAENAGKDGAVIAGEVLRDDTYEYGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + ++ + GIIDP KVVR ALQ A S+A +++ TEA++ + P+
Sbjct: 481 AQADEYKNLVQAGIIDPTKVVRTALQDAASVASLLITTEAMIAERPE 527


>gi|254505291|ref|ZP_05117442.1| chaperonin GroL [Labrenzia alexandrii DFL-11]
 gi|222441362|gb|EEE48041.1| chaperonin GroL [Labrenzia alexandrii DFL-11]
          Length = 532

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 295/513 (57%), Positives = 394/513 (76%), Gaps = 1/513 (0%)

Query: 19  GVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVA 78
           GV+TLA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I  ++ F  +GA+M+R+VA
Sbjct: 4   GVDTLANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVA 63

Query: 79  TNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV 138
           + T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+DLA    V+ L+A  K +
Sbjct: 64  SKTNDIAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGVDLAASAAVKALEAASKPI 123

Query: 139 GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRG 198
            + EE+ QV TISANGD ++G+ IA AM+++G  G+IT+++AK+  TE+ VV+GMQ DRG
Sbjct: 124 TTSEEVAQVGTISANGDEQVGKDIAEAMQKVGNEGVITVEEAKSLETELEVVEGMQFDRG 183

Query: 199 YISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDA 258
           Y+SPYFVT+ ++M A++E P+IL+++KK+S LQ +LPILE+  QS RPL IIAEDVEG+A
Sbjct: 184 YLSPYFVTNADKMLADLEKPFILLHEKKLSNLQAMLPILEAVVQSSRPLLIIAEDVEGEA 243

Query: 259 LATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLG 318
           LATLVVN++R GL + AVKAP FGDRRK +L D+A + G TVISE++G+KLE  T+  LG
Sbjct: 244 LATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDLAILTGGTVISEDLGIKLENVTLDMLG 303

Query: 319 SAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV 378
           +A+KV ++K+ TTIV G G  + I GR+ +I+  IE+T SDYDR+KL+ERLAKLAGGVAV
Sbjct: 304 TAEKVAITKETTTIVDGAGSKDDINGRVGQIKAQIEETTSDYDREKLQERLAKLAGGVAV 363

Query: 379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQAL-SVKGDNEDQCA 437
           + VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+RA +A+ ++  DN D  A
Sbjct: 364 IRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALLRAKKAVEALSSDNADIAA 423

Query: 438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPV 497
           G++IV +AL  P RQI++NAG E  ++V KIQE+    +G+NAQ   F +M E GIIDP 
Sbjct: 424 GMKIVLRALEAPIRQIVENAGVEGSIVVGKIQENSDDTFGFNAQTEEFVNMIEAGIIDPT 483

Query: 498 KVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           KVVR ALQ A S+AG+++ TEA+V + PK + A
Sbjct: 484 KVVRTALQDAASVAGLLITTEAMVAELPKKDAA 516


>gi|103485945|ref|YP_615506.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
 gi|118597093|sp|Q1GVZ9|CH601_SPHAL RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|98976022|gb|ABF52173.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
          Length = 547

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/531 (57%), Positives = 393/531 (74%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKANDKAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VVE LKA    V    EI QV  ISANGD E+GEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVTKVVEDLKARSTPVSGSSEIAQVGIISANGDVEVGEKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMIVELTDPYILIFEKKLSNLQSMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + KD+TTIV G G +E I+GR+ +I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGQAKRVTIDKDNTTIVDGAGDAEAIKGRVEQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +KG N+DQ  GI+I+RKA+  P RQI  NAG +  ++   +        G+N
Sbjct: 421 YATKALEGLKGANDDQTRGIDIIRKAIETPLRQIAANAGHDGAVVAGNLLRVGDVEQGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+ ++   G+IDP KVVR ALQ A S+AG+++ TEA V + P+D+ A
Sbjct: 481 AATDVYENLKAAGVIDPTKVVRTALQDAASVAGLLITTEAAVSELPEDKPA 531


>gi|90426197|ref|YP_534567.1| chaperonin GroEL [Rhodopseudomonas palustris BisB18]
 gi|119366210|sp|Q20X88|CH602_RHOPB RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|90108211|gb|ABD90248.1| chaperonin GroEL [Rhodopseudomonas palustris BisB18]
          Length = 551

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 304/536 (56%), Positives = 399/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGA R+TKDGVTVAK I
Sbjct: 1   MAAKDVKFAGDARDRMLRGVDILANAVKVTLGPKGRNVLIERSFGAARITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  V++ L    K V S  EI QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVIKDLVKRAKPVASSAEIAQVGTISSNGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+ TTEV +V+GM+ DRGY+SPYFVT+ E+M  E ++ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLTTEVDIVEGMKFDRGYLSPYFVTNAEKMAVEFDDAYVLLHEKKVSGLQSMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L D+A + G  +
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDLAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKK+V+ K++TTIVGG G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLKMLGRAKKLVIDKENTTIVGGAGKKADIETRVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TE +V + P+D  A+P MP
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDASSVAALLVTTECMVAEMPRD--AAPAMP 534


>gi|148558491|ref|YP_001257246.1| chaperonin GroEL [Brucella ovis ATCC 25840]
 gi|166198437|sp|A5VTU1|CH60_BRUO2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148369776|gb|ABQ62648.1| chaperonin GroL [Brucella ovis ATCC 25840]
          Length = 546

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T  DY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTLDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|330504904|ref|YP_004381773.1| chaperonin GroEL [Pseudomonas mendocina NK-01]
 gi|328919190|gb|AEB60021.1| chaperonin GroEL [Pseudomonas mendocina NK-01]
          Length = 548

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 298/536 (55%), Positives = 399/536 (74%), Gaps = 4/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DKATTAIVAQLKDLAKPCADSKAIAQVGTISANSDSSIGDIIAEAMDKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++KD+TTI+ G G    IE R+ +I+K +E+T SDY
Sbjct: 301 ISEEVGLSLESATLEHLGNAKRVVLNKDNTTIIDGAGAQIDIEARVAQIRKQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNEDQ  GI ++R+A+  P RQI+ NAG E  ++V K+++  + N+G+N
Sbjct: 421 RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVSNAGGEPSVVVDKVKQG-SGNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +A  D+  +P MP
Sbjct: 480 AATDTYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEAADDK--APAMP 533


>gi|254463684|ref|ZP_05077095.1| chaperonin GroL [Rhodobacterales bacterium Y4I]
 gi|206684592|gb|EDZ45074.1| chaperonin GroL [Rhodobacterales bacterium Y4I]
          Length = 548

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 298/529 (56%), Positives = 399/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV+ +K   + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVQGIKDMARPVNDSAEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGMETETDVVEGMQFDRGYLSPYFVTNPDKMVADLEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKISITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  ++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES   N+GYN
Sbjct: 421 QAGKGLDGLEGANADQNAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESSDKNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTDEYGDMFSFGVIDPAKVTRTALEDAASVAGLLITTEAMVADKPAKE 529


>gi|260432854|ref|ZP_05786825.1| chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416682|gb|EEX09941.1| chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157]
          Length = 546

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 307/532 (57%), Positives = 408/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATAKVVEAIKAAAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  TI  LGSAKKV +SKD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEELGMKLENVTIDMLGSAKKVTISKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L+ +KG N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKSLADLKGANADQDAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESDDPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMVADKPAKEGAA 532


>gi|293609960|ref|ZP_06692262.1| chaperonin [Acinetobacter sp. SH024]
 gi|292828412|gb|EFF86775.1| chaperonin [Acinetobacter sp. SH024]
 gi|325123168|gb|ADY82691.1| chaperonin GroEL [Acinetobacter calcoaceticus PHEA-2]
          Length = 544

 Score =  601 bits (1550), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 298/533 (55%), Positives = 402/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++N K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSNAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAGIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNALDGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKGGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAVP 532


>gi|134047129|ref|YP_001102020.1| chaperonin GroEL [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|157412103|ref|YP_001481444.1| chaperonin GroEL [Escherichia coli APEC O1]
 gi|237640305|ref|YP_002891160.1| chaperonin GroEL [Escherichia coli]
 gi|237810048|ref|YP_002894488.1| chaperonin GroEL [Escherichia coli]
 gi|300819970|ref|ZP_07100151.1| chaperonin GroL [Escherichia coli MS 107-1]
 gi|122975474|sp|Q19NJ4|CH602_ECOK1 RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|99867128|gb|ABF67773.1| GroEL [Escherichia coli APEC O1]
 gi|133905048|gb|ABO41063.1| 60 kDa chaperonin GroL [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|229561524|gb|ACQ77727.1| GroL [Escherichia coli]
 gi|229561904|gb|ACQ78105.1| GroL [Escherichia coli]
 gi|300527470|gb|EFK48532.1| chaperonin GroL [Escherichia coli MS 107-1]
          Length = 545

 Score =  601 bits (1550), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 304/534 (56%), Positives = 400/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV +ISAN D +IGE IA AM+++G  G+IT+++ 
Sbjct: 121 DKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + + M AE+E+P+IL++DKKIS ++ LLPILE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDPFILLHDKKISNVRDLLPILEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDMAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE RI +I+  IE+T SDY
Sbjct: 301 ISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTADIEARIKQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ +KG NEDQ  GI I  +A+  P R+I+ NAGDE  ++++++ E  T  +GYN
Sbjct: 421 RAKAAIAELKGANEDQNHGIAIALRAMEAPLREIVTNAGDEPSVVLNRVAEG-TGAFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP-KDETASP 532
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V +AP K+E A+P
Sbjct: 480 AANGEFGDMIEFGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKEEPAAP 533


>gi|308048207|ref|YP_003911773.1| chaperonin GroEL [Ferrimonas balearica DSM 9799]
 gi|307630397|gb|ADN74699.1| chaperonin GroEL [Ferrimonas balearica DSM 9799]
          Length = 546

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 304/531 (57%), Positives = 401/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKAVVAAVEELKALAVPCTDSKAIAQVGTISANSDTSIGEIIATAMEKVGQEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E+++P+IL+ DKKIS ++ LLPILE  
Sbjct: 181 QALENELDVVEGMQFDRGYLSPYFINNAENGTVELDSPFILLVDKKISNIRELLPILEGL 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           T++G+PL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 TKAGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL+LEKAT+ DLG+AK+VV++KD+TTI+ G G  ++I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGLELEKATLEDLGNAKRVVITKDNTTIIDGVGEEDQIKGRVAQIKQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+V GGG ALV
Sbjct: 361 DKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGTALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R A  +S + GDNE+Q  GI++  +A+  P RQI  NAG ES +I ++++E  + NYGYN
Sbjct: 421 RVAAKISDLTGDNEEQNVGIKLALRAMEAPLRQIAFNAGVESSVIANQVREG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   VFGDM EMGI+DP KV R+ALQ A S+AG+M+ TEA+V + PK+E A
Sbjct: 480 AGTGVFGDMLEMGILDPTKVTRSALQFAASVAGLMITTEAMVTELPKEEAA 530


>gi|298292874|ref|YP_003694813.1| chaperonin GroEL [Starkeya novella DSM 506]
 gi|296929385|gb|ADH90194.1| chaperonin GroEL [Starkeya novella DSM 506]
          Length = 541

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 307/542 (56%), Positives = 401/542 (73%), Gaps = 3/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I+  T ARD +  GV  L  AVK TLGPKGR VII  ++GAPR+TKDGV VAK I
Sbjct: 1   MSAKEIRFSTDARDRMLRGVELLNNAVKVTLGPKGRNVIIDKAYGAPRITKDGVAVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA +I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGAKLVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  VV+ ++A  +KV S  EI QV TI+ANGD  +GE IA AME++G  G+IT+++A
Sbjct: 121 DLGVAAVVKEIQARARKVESSAEIAQVGTIAANGDAAVGEMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYF+T+TE+M AE+E+PY+LI++KK+  LQ LLPILE+ 
Sbjct: 181 RTAETELDVVEGMQFDRGYLSPYFITNTEKMRAELEDPYVLIHEKKLGNLQGLLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGRPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  TI  LG AK+V++ ++ TTI+ G G  + I  RI +++  IE+T SDY
Sbjct: 301 ISDDLGIKLENVTIDMLGRAKRVLIEQETTTIIDGAGKKKTIGARIAQLKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL ++ G N D  AGI IV +AL  P RQI +NAG E  L+V ++ +SK  N G++
Sbjct: 421 RARSALRALPGGNADVTAGILIVLRALEAPIRQIAENAGVEGSLVVGRLTDSKDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GI+DP KVVR ALQ A S+A +++  EA++ D P  ETASP     GG
Sbjct: 481 AQTETYVDMIKAGIVDPAKVVRTALQDACSIAALLITAEAMIADIPFKETASP--AGNGG 538

Query: 540 MG 541
           MG
Sbjct: 539 MG 540


>gi|170720154|ref|YP_001747842.1| chaperonin GroEL [Pseudomonas putida W619]
 gi|226704161|sp|B1J3K5|CH60_PSEPW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|169758157|gb|ACA71473.1| chaperonin GroEL [Pseudomonas putida W619]
          Length = 546

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/531 (56%), Positives = 393/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   VV  LK   K     + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E+P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELESPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE  T+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLTLETTTLEHLGNAKRVILSKENTTIIDGAGVDADIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KGDNEDQ  GI ++R+A+  P RQI  NAGDE  ++  K+++  + NYGYN
Sbjct: 421 RALAAIVDLKGDNEDQNVGIALLRRAVEAPLRQITANAGDEPSVVADKVKQG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D P+D+ A
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDKPA 530


>gi|288959865|ref|YP_003450205.1| chaperonin GroEL [Azospirillum sp. B510]
 gi|288912173|dbj|BAI73661.1| chaperonin GroEL [Azospirillum sp. B510]
          Length = 543

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/527 (57%), Positives = 399/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD I  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSADARDRILRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNP+D+KRGI
Sbjct: 61  ELADKFENLGAQLVREVASKTADLAGDGTTTATVLAQAIVREGAKAVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+  +KA  K + + +E+ QV TISANG+R IG  IA A+ ++G  G+IT+++A
Sbjct: 121 DRAVAAVIADVKARAKTISTNDEVAQVGTISANGERAIGAIIAEAVAKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+G+Q DRGY+SPYFVT+ E++  + + PYILI+DKK+S+LQPLLP+LE+ 
Sbjct: 181 KSLETELNVVEGLQFDRGYLSPYFVTNAEKLVVDFDTPYILIHDKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAILEDIAILTNGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IG+KLE  ++ADLG+AK+VV++K++TT++ G G  E I+ RIN+I+  IE+T SDY
Sbjct: 301 ISEDIGIKLETVSLADLGTAKRVVIAKEETTVIDGAGGREAIDARINQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ VG  TE  + E+KDR  D++ ATRAA  EGIVPGGG+ L+
Sbjct: 361 DREKLQERLAKLSGGVAVIRVGGSTEVEVKERKDRVDDAVHATRAAIAEGIVPGGGVTLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +A+ +V   N+D+  GI+IVR+AL  P RQI +NAG +  +IV K+ E     +GY+
Sbjct: 421 YATRAIDAVVPVNDDERVGIDIVRRALQAPVRQIAENAGADGSVIVGKLLEGNDTAFGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   F D+ + GIIDP KVVR ALQ A S+AG+++ TEA++V+ P+
Sbjct: 481 AQTGEFTDLLKAGIIDPAKVVRIALQDAASVAGLLITTEALIVERPE 527


>gi|89055849|ref|YP_511300.1| chaperonin GroEL [Jannaschia sp. CCS1]
 gi|119366245|sp|Q28LY7|CH60_JANSC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|88865398|gb|ABD56275.1| chaperonin GroEL [Jannaschia sp. CCS1]
          Length = 546

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/529 (55%), Positives = 409/529 (77%), Gaps = 1/529 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD++  T AR+ +  GVNTLA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I  
Sbjct: 2   AKDVRFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGIDL
Sbjct: 62  EDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKSVAAGMNPMDLKRGIDL 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV +V+  ++ + ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ K 
Sbjct: 122 AVTKVIAEIQGSAREVADSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEENKG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQP++P+LE+  Q
Sbjct: 182 LETETDVVEGMQFDRGYLSPYFVTNPDKMIAELDDCLILLHEKKLSSLQPMVPLLETVIQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           SG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  VI+
Sbjct: 242 SGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQVIA 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E++G+KLE  T+  LG+AK++ +SKD+TTIV G G    IE R+ +I++ IE++ SDYDR
Sbjct: 302 EDLGMKLESVTMDMLGTAKRLTISKDETTIVDGAGNKPEIEARVAQIRQQIEESTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKLAGGVAV++VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+ALV+ 
Sbjct: 362 EKLQERVAKLAGGVAVIKVGGMSEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALVQG 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
            ++L+ ++G+N DQ AGI IVR+AL  P RQI +N+G +  ++  KI+ES    +G+NAQ
Sbjct: 422 GKSLAGLEGENADQNAGIAIVRRALEAPLRQIAENSGVDGSVVAGKIRESDDNAFGFNAQ 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
              +GD+F+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A
Sbjct: 482 TEEYGDLFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPAKEGA 530


>gi|84516671|ref|ZP_01004030.1| chaperonin GroEL [Loktanella vestfoldensis SKA53]
 gi|84509707|gb|EAQ06165.1| chaperonin GroEL [Loktanella vestfoldensis SKA53]
          Length = 551

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/530 (56%), Positives = 405/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K GT AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 3   MAAKEVKFGTDARNRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 62

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA  T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 63  ELEDKFENMGAQMVKEVANRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 122

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 123 DLATSKVVEAIKAAARPVNDSDEVAQVGTISANGESEIGRQIADAMQKVGNEGVITVEEN 182

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ E+MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 183 KGLETETVVVEGMQFDRGYLSPYFVTNPEKMTVELEDAIILLHEKKLSSLQPMVPLLESV 242

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 243 IQSGKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 302

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK++ ++KD+TTIV G G    IE R+ +I+  IEDT SDY
Sbjct: 303 ISEDLGMKLENVTIDMLGSAKRISITKDETTIVDGAGNKAEIEARVAQIRGQIEDTSSDY 362

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EG+V GGG+AL+
Sbjct: 363 DREKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALI 422

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  +KG N DQ  GI I+RKA+  P RQI +N+G +  ++  KI+ES   ++G+N
Sbjct: 423 QAGKVLEGLKGANSDQDVGIAIIRKAIEAPLRQIAENSGVDGSVVAGKIRESNDKSFGFN 482

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA++ D P  ++
Sbjct: 483 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMIADKPSKDS 532


>gi|90437019|gb|ABD93984.1| 60 kDa heat shock protein [Rickettsia helvetica]
          Length = 545

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/550 (54%), Positives = 405/550 (73%), Gaps = 6/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K IK G  AR+ +  G++ LA+AVK TLGPKGR V+I  SFG+P++TKDGVT AKSI
Sbjct: 1   MATKLIKHGLKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTGAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+     GA++++  AT   + +GDGTTTAT LA+A+  EG K V AG NPMD+KRG+
Sbjct: 61  ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K + KK+  +EEI QV TIS+NGD+EIGEKIA AME++G  G+IT+++A
Sbjct: 121 DLAVNAVVEEIKKSSKKINGQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  + +V VV+GM  DRGY+SPYFVT++E+M  E+ENP+IL+++KK+S LQP+LPILE+ 
Sbjct: 181 KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVVELENPFILLFEKKLSNLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVNR+R GL V AVKAP F DRRK ++ DIA +    +
Sbjct: 241 VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFVDRRKAMMEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  +I  LG AK+V +SK++  IV G+G  + IE R+ +I+  I +T SDY
Sbjct: 301 ITEDLGMKLENVSIKSLGDAKRVTISKENPVIVDGSGDKKNIEDRVLQIKSQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAVL+VG  TE  + E+KDR +D+L ATRAA +EG+V GGG+ L+
Sbjct: 361 DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A+Q L+ +K +N+DQ AGIEIV +AL  P +QI++NAG+   ++V K+ E K  NYG+N
Sbjct: 421 HASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GIIDP KVVR ALQ A S+A +++ TE ++VD P D+     M     
Sbjct: 481 AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEEPKPM----- 535

Query: 540 MGGGMGGMDM 549
            G  MGGMD 
Sbjct: 536 RGASMGGMDF 545


>gi|239994309|ref|ZP_04714833.1| chaperonin GroEL [Alteromonas macleodii ATCC 27126]
          Length = 545

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/538 (55%), Positives = 399/538 (74%), Gaps = 4/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++ G  AR  +  GVNTLA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVRFGDDARSKMLKGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D E+G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVAAAVEELKALSTDCADSKSIAQVGTISANSDSEVGDIIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E++NP+IL+ DKKIS ++ LLP LE  
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVELDNPFILLVDKKISNIRELLPTLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LEK  + DLG+AK+VV++KD+TT+V GNG  E IEGR  +I+  IED+ SDY
Sbjct: 301 ISEEIGLDLEKVQLEDLGTAKRVVINKDNTTVVDGNGDQEAIEGRCAQIKGQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L+ + GDN+DQ  GI++  +A+  P RQI  N+G E+ ++V++++  +  NYGYN
Sbjct: 421 RAAAKLADLTGDNDDQTVGIKLALRAMEAPLRQISINSGAEASVVVNEVKNGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA+V + PK++  +P MP  
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFASSIASLMITTEAMVAELPKED--APAMPDM 535


>gi|254786970|ref|YP_003074399.1| chaperonin GroL [Teredinibacter turnerae T7901]
 gi|259585916|sp|C5BP08|CH60_TERTT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|237683484|gb|ACR10748.1| chaperonin GroL [Teredinibacter turnerae T7901]
          Length = 546

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/538 (55%), Positives = 404/538 (75%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  +FGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVKFGDDARQKMLVGVNVLADAVKTTLGPKGRNVVLDKAFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE++K++ +     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVAAAVEFVKSSAQPCEDSKSIAQVGTISANSDSHIGDIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+T+ + M+ E E+P+IL+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFITNQDNMSVEHESPFILLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AEDVEG+ALATLVVN +R  + V A KAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLVIVAEDVEGEALATLVVNNMRGIVKVAACKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG AK+  MSK+++ IV G G ++ I+ R+N+I+K IE+T S+Y
Sbjct: 301 ISEEVGLDLESATLEHLGQAKRFTMSKENSVIVDGAGSADDIKARVNQIRKQIEETSSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D +KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG++L+
Sbjct: 361 DAEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVSLM 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ ++G+NEDQ AG+ I R+A+  P RQI+ NAG+E+ ++  K++  +  N+GYN
Sbjct: 421 RAVAAIADLQGENEDQTAGVAIARRAMEAPLRQIVTNAGEEASVVAEKVRGGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A   V+GDM EMGI+DP KV R ALQ+AGS+AG+M+ TEA+V D P+D+ A P +P  
Sbjct: 480 AGSGVYGDMLEMGILDPAKVTRTALQAAGSIAGLMITTEAMVADKPEDK-AGPAVPDM 536


>gi|17989393|ref|NP_542026.1| chaperonin GroEL [Brucella melitensis bv. 1 str. 16M]
 gi|25452857|sp|Q8YB53|CH60_BRUME RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|17985267|gb|AAL54290.1| 60 kDa chaperonin groel [Brucella melitensis bv. 1 str. 16M]
          Length = 546

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 404/526 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGD RK +L DIA + G  V
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDCRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    I+ R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  ++ KG N DQ AGI IVR+A+  P RQI  NAG+E+ +IV KI E+ +  +GYN 
Sbjct: 421 RASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +GD+  +GI+DPVKVVR ALQ+A S+AG+++ TEA++ + PK
Sbjct: 481 ANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPK 526


>gi|146283472|ref|YP_001173625.1| chaperonin GroEL [Pseudomonas stutzeri A1501]
 gi|166201743|sp|A4VP82|CH60_PSEU5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|145571677|gb|ABP80783.1| GroEL protein [Pseudomonas stutzeri A1501]
 gi|327481869|gb|AEA85179.1| chaperonin GroEL [Pseudomonas stutzeri DSM 4166]
          Length = 546

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 399/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATIAIVAELKQLAKPCTDSKAIAQVGTISANSDESIGQIIAEAMERVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M AE++NP +L+ DKKIS ++ LLP+LE  
Sbjct: 181 SGFENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IEDT SDY
Sbjct: 301 ISEEVGLSLETATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+S +KGDNEDQ  GI ++R+A+  P RQI+ NAG E  ++V K+++  + NYG+N
Sbjct: 421 RALQAISELKGDNEDQNVGIALLRRAVEAPLRQIVANAGGEPSVVVDKVKQG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +  +D+ A P MP  
Sbjct: 480 AASDTYGDMIEMGILDPAKVTRSALQAAASIGGLMVTTEAMVAEVVEDKPA-PAMPDM 536


>gi|254509859|ref|ZP_05121926.1| chaperonin GroL [Rhodobacteraceae bacterium KLH11]
 gi|221533570|gb|EEE36558.1| chaperonin GroL [Rhodobacteraceae bacterium KLH11]
          Length = 547

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 304/533 (57%), Positives = 408/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKAASREVKDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TT+V G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTVVDGAGEKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL S++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES  A +G+N
Sbjct: 421 QAGKALESLEGGNADQNAGINIVRKAIESPLRQIAENAGVDGAVVAGKVRESSDAAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KVVR AL+ A S+AG+++ TEA+V D P  E A+P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVVRTALEDAASVAGLLVTTEAMVADKPAKEGAAP 533


>gi|104783429|ref|YP_609927.1| chaperonin GroEL [Pseudomonas entomophila L48]
 gi|123380799|sp|Q1I5E2|CH60_PSEE4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|95112416|emb|CAK17143.1| chaperone Hsp60, peptide-dependent ATPase, heat shock protein
           [Pseudomonas entomophila L48]
          Length = 546

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 395/532 (74%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IGE IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAIVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADGDIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ +KGDNE+Q  GI ++R+A+  P RQI  NAGDE  ++  K+++  + N+GYN
Sbjct: 421 RALAAIADLKGDNEEQNVGIALLRRAVEAPLRQITANAGDEPSVVADKVKQG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V D P+D+ A+
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDKPAA 531


>gi|56461380|ref|YP_156661.1| chaperonin GroEL [Idiomarina loihiensis L2TR]
 gi|68566265|sp|Q5QVT4|CH60_IDILO RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|56180390|gb|AAV83112.1| Chaperonin GroEL (HSP60 family) [Idiomarina loihiensis L2TR]
          Length = 548

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/531 (55%), Positives = 398/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR  +  GVN LA++VK TLGPKGR V++  S+G+P +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGNTARQKMLKGVNILADSVKVTLGPKGRNVVLDKSYGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   +     + I QVATISAN D  IGE IA AM+++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKKISQPCADSKAIAQVATISANADHTIGEIIAQAMDKVGQEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +  T E+ VV+GMQ DRGY+SPYF+ + E  + E++NP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 QALTDELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLIDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 SKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEEIG++LEK  + DLG+AK+VV++KD+TT+V GNG    I+GR+N+I++ +EDT SDY
Sbjct: 301 VSEEIGMELEKTQLEDLGTAKRVVITKDNTTVVDGNGDDTAIDGRVNQIKQQMEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEMEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L+ ++GDNE+Q  GI +  +A+  P RQI  NAG E  ++ + ++  +  NYGYN
Sbjct: 421 RAASKLAELRGDNEEQNVGIRLALRAMEAPLRQIAMNAGAEGSVVANNVRAGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGI+DP KV R+ALQ A S+  +M+ TEA++ D P+D+ A
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFAASVGALMITTEAMIADIPQDDNA 530


>gi|197103235|ref|YP_002128613.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
 gi|196480511|gb|ACG80038.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
          Length = 539

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 398/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I   T ARD +  GVN LA AV+ TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKEIHFSTDARDRMLRGVNILANAVRVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENLGAQLLREVASKTNDQAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE ++A  KKV S EEI Q+ TISANG+REIG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVAAVVEEIRATSKKVSSNEEIAQIGTISANGEREIGAMIAQAMERVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYFVT+ +RM   +E+  +LI++KK++ LQPL+P+LE  
Sbjct: 181 RGLEMELEVVEGMQFDRGYVSPYFVTNPDRMETVLEDALVLIFEKKLTTLQPLIPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL +IAED+EG+ LATLV+N++R GL V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 VQSGKPLLVIAEDIEGEVLATLVLNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQF 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV+++KDDTTIV G G    I+GRI +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIDQLGRAKKVIITKDDTTIVEGAGDKADIQGRIGQIRRQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  + G N+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+ +  +G+N
Sbjct: 421 RASKVLEGLNGANDDQNAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENASPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + D+ + G+IDP KVVR ALQ A S+AG+++ TEA V +APK
Sbjct: 481 AQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAVAEAPK 527


>gi|114328844|ref|YP_746001.1| chaperonin GroEL [Granulibacter bethesdensis CGDNIH1]
 gi|122326206|sp|Q0BQ24|CH60_GRABC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|114317018|gb|ABI63078.1| 60 kDa chaperonin GROEL [Granulibacter bethesdensis CGDNIH1]
          Length = 544

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 315/550 (57%), Positives = 410/550 (74%), Gaps = 7/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDKAGDGTTTATVLTQAIVREGAKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LKAN +K+ +  E  QV TISANG+ EIG  I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEDLKANSRKITNPSETAQVGTISANGESEIGRMISEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYF+T+ E+M AE++NPYILI++KK++ LQPLLP+LES 
Sbjct: 181 KGIQTELDVVEGMQFDRGYVSPYFITNPEKMIAELDNPYILIHEKKLAQLQPLLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V++ K++TTIV G G  + I+GR ++I+   E+T SDY
Sbjct: 301 ISEDLGIKLETVTLQQLGTAKRVLIEKENTTIVEGAGSPDDIKGRCSQIRAQAEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG+AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALA 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L+  G DN DQ  GIEI+R+AL  P RQI +NAG++  +I  K+ E+ T N+G++
Sbjct: 421 RASLKLADLGYDNGDQKVGIEIIRRALQSPLRQISENAGEDGAVIAGKVLENGTYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   F D+   GIIDP KVVR ALQ A S+A +++ TEA++ + P+ +  +   P    
Sbjct: 481 AQTGEFKDLVSAGIIDPAKVVRTALQDAASVAALLITTEAMIAEKPEKKAPAGAPP---- 536

Query: 540 MGGGMGGMDM 549
             GGMG MD 
Sbjct: 537 --GGMGDMDF 544


>gi|326315731|ref|YP_004233403.1| chaperonin GroEL [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372567|gb|ADX44836.1| chaperonin GroEL [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 545

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 300/536 (55%), Positives = 396/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVAELKKASKATTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA   +KGDN DQ AGI+++ KA+  P R+I+ NAG E  ++V+ +   K  NYG+N
Sbjct: 421 RAKQAAGEIKGDNPDQDAGIKLILKAIEAPLREIVANAGGEPSVVVNAVLHGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APKDE A+P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKDEAAAPAMP 535


>gi|34499469|ref|NP_903684.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472]
 gi|68566281|sp|Q7NQX1|CH602_CHRVO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|34105321|gb|AAQ61676.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472]
          Length = 546

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/532 (55%), Positives = 400/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARSKMVAGVNILADAVKVTLGPKGRNVVLDRSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVQEGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  +    K   + +EI QV +ISAN D +IGE IA AME++G  G+IT++  
Sbjct: 121 DKAVVSLVGEIAKIAKPCATSKEIAQVGSISANSDSDIGEIIANAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A ++NP+IL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNQDKQIAALDNPFILLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLTDIAVLTGGEV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+  LG AK+V + K++TTI+ G G +  I+ R+ EI+K IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLDQLGQAKRVEVGKENTTIIDGAGEAATIQARVGEIRKQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L ++K DN +Q AG++IV +A+  P RQI+KNAGDE  ++V+K+ E K  N+GYN
Sbjct: 421 RARATLENLKTDNAEQEAGVKIVLRAIEAPLRQIVKNAGDEPSVVVNKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ + P+D+ A+
Sbjct: 480 AASGEYGDMLEMGVLDPAKVTRSALQHAASVAGLMLTTDCMIAELPEDKPAA 531


>gi|223041953|ref|ZP_03612137.1| 60 kDa chaperonin [Actinobacillus minor 202]
 gi|207298804|gb|ACI23554.1| 60 kDa chaperonin [Actinobacillus minor 202]
          Length = 547

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 399/532 (75%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  +FGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK+  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVEELKSLSKPCETSKEIEQVGTISANSDSTVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYIL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKATI +LG AK+VV+SKD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATIEELGQAKRVVISKDNTTIIDGVGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++KGDNE+Q  GI +  +A+  P RQI+ NAG+E+ ++   +++ K  NYGY
Sbjct: 421 RAASKVAETLKGDNEEQNVGIRLALRAMEAPLRQIVTNAGEEASVVARNVKDGK-GNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PK+E A
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMVTDLPKEEKA 531


>gi|124265621|ref|YP_001019625.1| chaperonin GroEL [Methylibium petroleiphilum PM1]
 gi|166201733|sp|A2SCV1|CH60_METPP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|124258396|gb|ABM93390.1| putative chaperonin [Methylibium petroleiphilum PM1]
          Length = 548

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 396/529 (74%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV TISAN D ++G+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVVSLVEQLKKQSKPTTTSKEIAQVGTISANSDDDVGQIIASAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+ +A ++NP++L+YDKKIS ++ LLP LE  
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNPEKQSAVLDNPFVLLYDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRVEVGKENTTIIDGAGAAGDIEARVKQVRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA  ++KGDN DQ AGI+++ +A+  P R I+ NAGDE+ ++V+ +   K  NYGYN
Sbjct: 421 RAKQAAGAIKGDNADQDAGIKLILRAIEEPLRIIVTNAGDEASVVVNAVLAGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A    +GDM EMGI+DP KV R ALQ+A S+A +ML TEA+V ++PKD+
Sbjct: 480 AANGTYGDMIEMGILDPTKVTRTALQNAASVAALMLTTEAMVAESPKDD 528


>gi|172062483|ref|YP_001810134.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
 gi|171995000|gb|ACB65918.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
          Length = 546

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/530 (56%), Positives = 398/530 (75%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDVARTKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVDALKTISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++EE GL LEKAT+A+LG AK++ + K+ TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 VAEETGLTLEKATLAELGQAKRIEVGKESTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  + N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD T
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFEAPKDAT 529


>gi|166710457|ref|ZP_02241664.1| chaperonin GroEL [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 546

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 303/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|332530397|ref|ZP_08406342.1| chaperonin GroEL [Hylemonella gracilis ATCC 19624]
 gi|332040208|gb|EGI76589.1| chaperonin GroEL [Hylemonella gracilis ATCC 19624]
          Length = 548

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/529 (56%), Positives = 397/529 (75%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGDARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKIQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVEQLKKASKPTTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINQPEKQVALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ GNG +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLSLEKVTLADLGQAKRIEVGKENTTIIDGNGAAADIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+ ++KGDN DQ AGI++V KA+  P R+I+ NAG E+ ++V+K+ E K  N+G+N
Sbjct: 421 RAKQAIGTIKGDNPDQDAGIKLVLKAIEAPLREIVFNAGGEASVVVNKVLEGK-GNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APK++
Sbjct: 480 AANDTYGDMIEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKED 528


>gi|85711845|ref|ZP_01042900.1| Chaperonin GroEL (HSP60 family protein) [Idiomarina baltica OS145]
 gi|85694242|gb|EAQ32185.1| Chaperonin GroEL (HSP60 family protein) [Idiomarina baltica OS145]
          Length = 547

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/532 (55%), Positives = 400/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR  +  GVNTLA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGNNARQRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   +     + I QV TISAN D  IGE IA AM+++G  G+IT+++ 
Sbjct: 121 DKAVTAAVEELKKISQPCADSKAIAQVGTISANSDSTIGEIIAKAMDKVGQEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  + E++NP+IL+ DKK+S ++ LLP+LE  
Sbjct: 181 QALQDELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLVDKKVSNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 SKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEEIG++LEK  + DLG+AK+VV++KD+TT+V GNG    IEGR+ +I++ +E+T SDY
Sbjct: 301 VSEEIGMELEKTQLEDLGTAKRVVITKDNTTVVDGNGDDAAIEGRVTQIKQQMEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L+ + GDNE+Q  GI ++ +A+  P RQI  NAG E+ ++ ++++E +  N+GYN
Sbjct: 421 RAASKLAELTGDNEEQNVGIRMMLRAMEAPLRQIAYNAGAEASVVANRVREGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMGI+DP KV R+ALQ A S+  +M+ TEA+V + PKD+ ++
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFAASVGSLMITTEAMVAEIPKDDESA 531


>gi|294678000|ref|YP_003578615.1| chaperonin GroL [Rhodobacter capsulatus SB 1003]
 gi|294476820|gb|ADE86208.1| chaperonin GroL [Rhodobacter capsulatus SB 1003]
          Length = 545

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 401/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA   VVE +KA  + V   +E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKV +SK++TTIV G+G    I  R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L+ + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAAKKLNDLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TE ++ + P+ + A
Sbjct: 481 AQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPKAA 531


>gi|126733621|ref|ZP_01749368.1| 60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
 gi|126716487|gb|EBA13351.1| 60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
          Length = 549

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/529 (56%), Positives = 404/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 3   MAAKDVKFDTDARNRMLTGVNTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 62

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 63  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 122

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 123 DLATLKVVEAIKSASRPVSDSDEVAQVGTISANGEEEIGRQIADAMQKVGNEGVITVEEN 182

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+P IL+++KK+S+LQP++P+LES 
Sbjct: 183 KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDPIILLHEKKLSSLQPMVPLLESV 242

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 243 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 302

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  TI  LG+AK+V ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 303 ISDDLGMKLESVTIDMLGTAKRVAITKDETTIVDGAGDKAEIEARVGQIRGQIEETTSDY 362

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EG+V GGG+AL+
Sbjct: 363 DREKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALI 422

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  ++G N DQ  GI IVRKA+  P RQI +N+G +  ++  KI+ES    +G+N
Sbjct: 423 QGGKALDGLEGANSDQNVGISIVRKAIEAPLRQIAENSGVDGSVVAGKIRESDDKAFGFN 482

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 483 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPAKE 531


>gi|15599581|ref|NP_253075.1| chaperonin GroEL [Pseudomonas aeruginosa PAO1]
 gi|116052420|ref|YP_792731.1| chaperonin GroEL [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893476|ref|YP_002442345.1| chaperonin GroEL [Pseudomonas aeruginosa LESB58]
 gi|296391093|ref|ZP_06880568.1| chaperonin GroEL [Pseudomonas aeruginosa PAb1]
 gi|313106916|ref|ZP_07793119.1| GroEL protein [Pseudomonas aeruginosa 39016]
 gi|12230880|sp|P30718|CH60_PSEAE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|122257575|sp|Q02H55|CH60_PSEAB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704160|sp|B7UZG3|CH60_PSEA8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|9950615|gb|AAG07773.1|AE004854_9 GroEL protein [Pseudomonas aeruginosa PAO1]
 gi|115587641|gb|ABJ13656.1| GroEL protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218773704|emb|CAW29518.1| GroEL protein [Pseudomonas aeruginosa LESB58]
 gi|310879621|gb|EFQ38215.1| GroEL protein [Pseudomonas aeruginosa 39016]
          Length = 547

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/531 (56%), Positives = 399/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATVAIVAQLKELAKPCADTKAIAQVGTISANSDESIGQIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+++P +L+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IE+T SDY
Sbjct: 301 ISEEVGLSLEGATLEHLGNAKRVVINKENTTIIDGAGVQADIEARVLQIRKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNE+Q  GI ++R+A+  P RQI+ NAGDE  ++V K+++  + NYG+N
Sbjct: 421 RALQAIEGLKGDNEEQNVGIALLRRAVESPLRQIVANAGDEPSVVVDKVKQG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +  +D+ A
Sbjct: 480 AATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEIVEDKPA 530


>gi|152986611|ref|YP_001350292.1| chaperonin GroEL [Pseudomonas aeruginosa PA7]
 gi|166201740|sp|A6VB57|CH60_PSEA7 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|150961769|gb|ABR83794.1| chaperonin GroL [Pseudomonas aeruginosa PA7]
          Length = 547

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/531 (56%), Positives = 399/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATVAIVAQLKELAKPCADTKAIAQVGTISANSDESIGQIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+++P +L+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IE+T SDY
Sbjct: 301 ISEEVGLSLEGATLEHLGNAKRVVINKENTTIIDGAGVQADIEARVLQIRKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNE+Q  GI ++R+A+  P RQI+ NAGDE  ++V K+++  + NYG+N
Sbjct: 421 RALQAIEGLKGDNEEQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKVKQG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +  +D+ A
Sbjct: 480 AATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEIVEDKPA 530


>gi|254440823|ref|ZP_05054316.1| chaperonin GroL [Octadecabacter antarcticus 307]
 gi|198250901|gb|EDY75216.1| chaperonin GroL [Octadecabacter antarcticus 307]
          Length = 547

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K GT AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LA AI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAAAIIREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARDVSDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTVELEDAVILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSGKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD+TTI+ G+G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGSAKRVAITKDETTIIDGSGAKAEIEARVVQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIRVGGMSEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  ++G N DQ  GI IVRKAL  P RQI +N+G +  ++  KI+ES   ++G+N
Sbjct: 421 QAGKSLDGLEGANPDQTIGINIVRKALEAPLRQIAENSGVDGSVVAGKIRESSDKSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPAKE 529


>gi|241203782|ref|YP_002974878.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857672|gb|ACS55339.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 544

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 302/548 (55%), Positives = 402/548 (73%), Gaps = 7/548 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I+  T ARD +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGV+VAK I
Sbjct: 1   MSAKEIRFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA +I+ EG K V AG+NPMD++RGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  VV+ +KA   KV S  EI QV TI+ANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLGVTAVVKEIKARAMKVKSSGEIAQVGTIAANGDAAIGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYIL+++KK+ +LQ +LPILE+ 
Sbjct: 181 RTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILVHEKKLGSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +I+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTSGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KL+  T+  LG AK+V++ K+ TTI+ G+G    I+ RI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLDNVTLDMLGRAKRVLIDKESTTIIDGSGEKAAIQARIQQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ + G+N D  AGI IV +AL  P RQI  NAG E  ++V K+  S   N G++
Sbjct: 421 RAKSALTGLTGENADVTAGISIVLRALEAPIRQIADNAGFEGSIVVGKLAGSNNHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM E GI+DP KVVR ALQ AGS+A +++  E ++ D P  ++A    PA G 
Sbjct: 481 AQTETYVDMIEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIPARDSA----PAAG- 535

Query: 540 MGGGMGGM 547
             GGMG M
Sbjct: 536 -NGGMGDM 542


>gi|83647304|ref|YP_435739.1| chaperonin GroEL [Hahella chejuensis KCTC 2396]
 gi|119366244|sp|Q2SDG0|CH60_HAHCH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|83635347|gb|ABC31314.1| Chaperonin GroEL (HSP60 family) [Hahella chejuensis KCTC 2396]
          Length = 549

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/529 (56%), Positives = 399/529 (75%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVNTLA+AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKRMVAGVNTLADAVKVTLGPKGRNVVLDKSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDEAGDGTTTATVLAQAILNEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ +K   +     + I QV TISAN D  IG  IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVKEIKNISRPCEDSKSIAQVGTISANSDERIGNIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+S YFV + + M+AE+E+P+IL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLEDELDVVEGMQFDRGYLSAYFVNNQDSMSAELEDPFILLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S +PL +I+ED+EG+ALATLVVN +R  + V AVKAP FGDRRKE+L+DIA + G TV
Sbjct: 241 AKSSKPLLVISEDLEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKEMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+ DLG+AK+VV++K++TTI+ G G    IE R+ +I++ IE+T SDY
Sbjct: 301 ISEEVGLNLEGATLDDLGTAKRVVVTKENTTIIDGAGAKSDIEARVAQIRRQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L +TRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHSTRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+S + GDN DQ  GI ++R+A+  P RQI+ NAG E  ++V K+++ + A +GYN
Sbjct: 421 RALQAVSDLAGDNADQDVGINLLRRAMEAPLRQIVANAGGEPSVVVDKVRQGEGA-FGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A    +GDM EMGI+DP KV R ALQSA S+AG+M+ TE +V D P+D+
Sbjct: 480 AGTEAYGDMLEMGILDPAKVTRTALQSAASIAGLMITTECMVSDLPEDD 528


>gi|254249098|ref|ZP_04942418.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184]
 gi|124875599|gb|EAY65589.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184]
          Length = 546

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/528 (56%), Positives = 398/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVTSAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-TGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|86136484|ref|ZP_01055063.1| chaperonin GroEL [Roseobacter sp. MED193]
 gi|85827358|gb|EAQ47554.1| chaperonin GroEL [Roseobacter sp. MED193]
          Length = 550

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/526 (56%), Positives = 400/526 (76%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V    E+ QV TISANG+  IG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKASARDVKDSAEVAQVGTISANGEEAIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIADLDDCMILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTIVDGAGAKAEIEARVGQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL+ ++G N DQ AGI IV+KA+  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKALAGLEGANADQNAGIVIVKKAIEAPLRQIAENAGVDGAVVAGKVRESDDTTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKP 526


>gi|254450231|ref|ZP_05063668.1| chaperonin GroL [Octadecabacter antarcticus 238]
 gi|198264637|gb|EDY88907.1| chaperonin GroL [Octadecabacter antarcticus 238]
          Length = 547

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 303/529 (57%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K GT AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LA AI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAAAIIREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARDVSDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLDTETDVVEGMQFDRGYLSPYFVTNPDKMTVELEDAVILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSGKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD+TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGSAKRVAITKDETTIIDGAGAKAEIEARVVQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  +KG N DQ  GI IVRK+L  P RQI +N+G +  ++  KI+ES    +G+N
Sbjct: 421 QAGKALDGLKGANSDQDVGITIVRKSLEAPLRQIAENSGVDGSVVAGKIRESNDKTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR +LQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTSLQYAASVAGLLITTEAMVADKPAKE 529


>gi|189008660|gb|ACD68572.1| GroEL [Psychrobacter frigidicola]
          Length = 549

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/527 (55%), Positives = 392/527 (74%), Gaps = 2/527 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K G+ AR  +  GVN LA AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I  
Sbjct: 2   AKDVKFGSDARKQMMDGVNILANAVKVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           +N F  +GA+++R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGID 
Sbjct: 62  ENKFENMGAQLVREVASRTNDVAGDGTTTATVLAQSILQEGMKSVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+  VE +          + I QV +ISAN D +IGE I+ AM+++G  G+IT+++  +
Sbjct: 122 AVRAAVEQIHLLSTPADDEKAIAQVGSISANSDTKIGELISQAMQKVGKQGVITVEEGSS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
               + VV+GMQ DRGYISPYF    + +TAE ENPYIL+ DKKIS ++ ++P+LE   Q
Sbjct: 182 FEDSLEVVEGMQFDRGYISPYFANKQDSLTAEFENPYILLVDKKISNIREIVPLLEQVMQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
             +PL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G TVIS
Sbjct: 242 QSKPLLIIAEDVENEALATLVVNNMRGGLKTCAVKAPGFGDRRKAMLQDIATLTGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EEIGL LE AT+  LG+AKKV + K++T IV G G    I+ R++ I++ +E++ SDYD+
Sbjct: 302 EEIGLSLETATLEQLGTAKKVTVGKENTVIVDGAGDKAAIDERVDSIRRQVEESTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVRA
Sbjct: 362 EKLQERMAKLAGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             ALS +KGDN+DQ AGI I+R+A+  P RQI+ N+G+E+ ++V++++   T NYGYNA 
Sbjct: 422 MNALSELKGDNDDQDAGINILRRAMESPLRQIVTNSGEEASVVVNEVKNG-TGNYGYNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
             V+GDM EMGI+DP KV R+AL++A S+AG+ML TEA++ D P+++
Sbjct: 481 TGVYGDMLEMGILDPAKVARSALENAASIAGLMLTTEAMITDLPEND 527


>gi|171319825|ref|ZP_02908908.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
 gi|171094920|gb|EDT39949.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
          Length = 546

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/528 (56%), Positives = 398/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDVARTKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  + N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|170736378|ref|YP_001777638.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3]
 gi|169818566|gb|ACA93148.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3]
          Length = 546

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/528 (56%), Positives = 398/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-TGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|25452889|sp|Q9L690|CH603_RHILE RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|7578869|gb|AAF64162.1|AF239164_2 GroEL [Rhizobium leguminosarum]
          Length = 544

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 301/548 (54%), Positives = 401/548 (73%), Gaps = 7/548 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I+    ARD +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGV+VAK I
Sbjct: 1   MSAKEIRFSNDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA +I+ EG K V AG+NPMD++RGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  VV+ +KA   KV S  EI QV TI+ANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLGVTAVVKEIKARAMKVKSSSEIAQVGTIAANGDAAIGEMIAKAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYIL+++KK+ +LQ +LPILE+ 
Sbjct: 181 RTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILVHEKKLGSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +I+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTSGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KL+  T+  LG AK+V++ K+ TTI+ G+G    I+ RI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLDNVTLDMLGHAKRVLIDKESTTIIDGSGEKAAIQARIQQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ + G+N D  AGI IV +AL  P RQI  NAG E  ++V K+  S   N G++
Sbjct: 421 RAKSALTGLTGENADVTAGISIVLRALEAPIRQIADNAGFEGSIVVGKLAGSNNHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM E GI+DP KVVR ALQ AGS+A +++  E ++ D P  ++A    PA G 
Sbjct: 481 AQTETYVDMIEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIPARDSA----PAAG- 535

Query: 540 MGGGMGGM 547
             GGMG M
Sbjct: 536 -NGGMGDM 542


>gi|126739873|ref|ZP_01755564.1| chaperonin GroEL [Roseobacter sp. SK209-2-6]
 gi|126719105|gb|EBA15816.1| chaperonin GroEL [Roseobacter sp. SK209-2-6]
          Length = 550

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/526 (56%), Positives = 400/526 (76%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V    E+ QV TISANG+  IG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKASARDVKDSAEVAQVGTISANGEEAIGSQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIADLDDCMILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTIVDGAGAKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL+ ++G N DQ AGI IV+KA+  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QAGKALAGLEGANADQNAGIVIVKKAIEAPLRQIAENAGVDGAVVAGKVRESDDTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKP 526


>gi|83309302|ref|YP_419566.1| chaperonin GroEL [Magnetospirillum magneticum AMB-1]
 gi|119366248|sp|Q2WAW8|CH60_MAGSA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|82944143|dbj|BAE49007.1| Chaperonin GroEL [Magnetospirillum magneticum AMB-1]
          Length = 552

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 400/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRG+
Sbjct: 61  ELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  +K+  +KV +  EI QV TISANG++EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVAAVVADVKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E++NPYIL+++KK+S LQPLLP+LE  
Sbjct: 181 KGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTVELDNPYILLHEKKLSGLQPLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG++K++ ++K+DTTIV G+G    I+ R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLESVNLEMLGTSKRITITKEDTTIVDGSGDKGAIDARCKQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGGSEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +   N DQ  GI IVR+AL  P RQI +NAG +  ++  KI ESK  ++G++
Sbjct: 421 HAVKALEGLASGNADQEVGISIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDLSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ  ++ DM + GIIDP KVVR ALQ A S+AG+++ TEA++ + PK
Sbjct: 481 AQTGIYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPK 527


>gi|21229998|ref|NP_635915.1| chaperonin GroEL [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66766874|ref|YP_241636.1| chaperonin GroEL [Xanthomonas campestris pv. campestris str. 8004]
 gi|25452849|sp|Q8PD23|CH60_XANCP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|81307137|sp|Q4UZA7|CH60_XANC8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|21111514|gb|AAM39839.1| 60kDa chaperonin [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572206|gb|AAY47616.1| 60 kDa chaperonin [Xanthomonas campestris pv. campestris str. 8004]
          Length = 546

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVIELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSATIEARVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++ G NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGNLTGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|330811325|ref|YP_004355787.1| 60 kDa chaperonin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379433|gb|AEA70783.1| 60 kDa chaperonin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 547

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 398/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR VII  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D +GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V+ LKA  K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATIAIVKELKALSKPCADTKAIAQVGTISANSDNSIGDIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   E MTAE++ P IL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPETMTAELDGPLILLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE  T+  LG+AK+V++SK++TT++ G G    I+ R+ +I++ + DT SDY
Sbjct: 301 ISEEIGLSLESTTLEHLGNAKRVILSKENTTVIDGAGVETDIQARVLQIRQQVADTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV++VG  +E  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+S +KGDN+DQ  GI+++R+A+  P RQI+ N+GDE  ++V K+++  T NYGYN
Sbjct: 421 RALQAISELKGDNDDQNVGIQLLRRAVEAPLRQIVANSGDEPSVVVDKVKQG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGI+DP KV R+ALQ+A S+A +M+ TEA++ +  +D  A
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAASSIASLMITTEAMIAEIKEDAPA 530


>gi|188989949|ref|YP_001901959.1| chaperonin GroEL [Xanthomonas campestris pv. campestris str. B100]
 gi|226704191|sp|B0RN52|CH60_XANCB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|167731709|emb|CAP49887.1| 60 kDa chaperonin [Xanthomonas campestris pv. campestris]
          Length = 546

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVIELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSATIEARVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++ G NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGNLTGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|194288826|ref|YP_002004733.1| chaperonin groel [Cupriavidus taiwanensis LMG 19424]
 gi|226704112|sp|B3R2Y3|CH60_CUPTR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|193222661|emb|CAQ68664.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Cupriavidus
           taiwanensis LMG 19424]
          Length = 547

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVGAAVEELKKISKPTTTSKEIAQVGAISANSDASIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+    ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAAGIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S ++GDN DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALQGDNADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PK+E+A
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAETPKEESA 530


>gi|270208569|ref|YP_003329340.1| GroEL3 chaperonin [Sinorhizobium meliloti]
 gi|76880843|gb|ABA56013.1| GroEL3 chaperonin [Sinorhizobium meliloti]
          Length = 544

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 304/546 (55%), Positives = 397/546 (72%), Gaps = 4/546 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+IK  T ARD +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGV VAK I
Sbjct: 1   MSAKEIKFSTDARDRMLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVAVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA ++  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASRTNDLAGDGTTTATVLAASLLREGAKLVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  VV+ ++A  KKV S  EI QV TI+ANGD  +GE IA AM+++G  G IT+++A
Sbjct: 121 DLGVAAVVKEIQARAKKVESSGEIAQVGTIAANGDATVGEMIAKAMDKVGNEGAITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYILI++KK+  LQ +LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILIHEKKLGNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG PL I++EDVEG+ LATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGNPLLILSEDVEGEVLATLVVNKLRGGLKVAAVKAPGFGDRRKAILEDIAVLTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V++ KD TTI+ G+G    I+ RI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKRVLIEKDTTTIIAGSGDKATIQARIRQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA++EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDALNATRAAAEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  + G N D  AGI IV +AL  P RQI +NAG E  ++V K+ + +  N G++
Sbjct: 421 RARSVLVGLAGANADVTAGISIVLRALETPIRQIAENAGVEGSIVVGKLTDGRDYNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GI+DP KVVR ALQ AGS+A +++  EA++ D P  E+A     AG G
Sbjct: 481 AQTETYVDMIKAGIVDPAKVVRTALQDAGSIAALLITAEAMIADIPSRESAR---SAGNG 537

Query: 540 MGGGMG 545
             GGMG
Sbjct: 538 DMGGMG 543


>gi|241762556|ref|ZP_04760631.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753449|ref|YP_003226342.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|241372884|gb|EER62571.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552812|gb|ACV75758.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 549

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 305/536 (56%), Positives = 394/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE L++  K V    E+ QV  ISANGD E+G +IA AME++G  G+IT+++A
Sbjct: 121 DLAATKVVESLRSRSKPVSDFNEVAQVGIISANGDEEVGRRIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M AE+ +PYILIY+KK+S LQ +LPILES 
Sbjct: 181 KGFDFELDVVEGMQFDRGYLSPYFITNPEKMVAELADPYILIYEKKLSNLQSILPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAK+V ++K++TTIV G G    I+ R+  I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGSAKRVSITKENTTIVDGAGDQSTIKDRVEAIRSQIEATTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A + L  + G NEDQ  GI+IVR+AL  P RQI +NAG +  ++  K+ +      G+N
Sbjct: 421 YATKTLEGLNGVNEDQQRGIDIVRRALQAPVRQIAQNAGFDGAVVAGKLIDGNDDKIGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA V D P+D+ A P MP
Sbjct: 481 AQTEKYEDLAATGVIDPTKVVRTALQDAASVAGLLITTEAAVGDLPEDKPA-PAMP 535


>gi|21241313|ref|NP_640895.1| chaperonin GroEL [Xanthomonas axonopodis pv. citri str. 306]
 gi|25452850|sp|Q8PPZ1|CH60_XANAC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|21106636|gb|AAM35431.1| 60 kDa chaperonin [Xanthomonas axonopodis pv. citri str. 306]
          Length = 546

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGDLKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P +PA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPALPA 534


>gi|301632219|ref|XP_002945187.1| PREDICTED: 60 kDa chaperonin-like [Xenopus (Silurana) tropicalis]
          Length = 754

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/536 (55%), Positives = 399/536 (74%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAALVEELKKASKPTTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE+ 
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNPEKQVALLDNPFVLLFDKKISNIRDLLPTLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLSLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +K DN DQ AGI+++ KA+  P R+I+ NAG E+ ++V+++   K  N+G+N
Sbjct: 421 RARQAVGQIKSDNADQDAGIKLILKAIEAPLREIVNNAGGEASVVVNEVLNRK-GNHGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TE +V +APKDE A+P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTECMVAEAPKDEAAAPAMP 535


>gi|289663907|ref|ZP_06485488.1| chaperonin GroEL [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289669498|ref|ZP_06490573.1| chaperonin GroEL [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 546

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++ G NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGNLTGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGQFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|58583911|ref|YP_202927.1| chaperonin GroEL [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625700|ref|YP_453072.1| chaperonin GroEL [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188574765|ref|YP_001911694.1| chaperonin GroEL [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|68566254|sp|Q5GUT1|CH60_XANOR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|119366278|sp|Q2NY29|CH60_XANOM RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704192|sp|B2SJG4|CH60_XANOP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|58428505|gb|AAW77542.1| 60 kDa chaperonin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369640|dbj|BAE70798.1| 60 kDa chaperonin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519217|gb|ACD57162.1| chaperonin GroL [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 546

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G S  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++ G NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  T NYGYN
Sbjct: 421 RALVAVGNLTGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|116251179|ref|YP_767017.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841]
 gi|118597122|sp|Q1MJF2|CH60_RHIL3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|115255827|emb|CAK06908.1| putative 60 kda chaperonin 5 (GroEL protein 5) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 544

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/526 (56%), Positives = 392/526 (74%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I+  T ARD +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGV+VAK I
Sbjct: 1   MSAKEIRFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LA +I+ EG K V AG+NPMD++RGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  VV+ +KA   KV S  EI QV TI+ANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLGVIAVVKEIKARAMKVKSSGEIAQVGTIAANGDATIGEMIARAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E PYIL+++KK+ +LQ LLPILE+ 
Sbjct: 181 RTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEEPYILVHEKKLGSLQALLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +I+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V++ K+ TTI+ G+G    I+ RI +I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGHAKRVLIDKESTTIIDGSGEKAAIQARIQQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ + G+N D  AGI IV +AL  P RQI+ NAG E  ++V K+  S   N G++
Sbjct: 421 RAKSALTGLTGENADVTAGISIVLRALEAPIRQIVDNAGFEGSIVVGKLAGSNDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   + DM E GI+DP KVVR ALQ AGS+A +++  E ++ D P
Sbjct: 481 AQTETYVDMIEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIP 526


>gi|254254937|ref|ZP_04948254.1| Chaperonin GroEL [Burkholderia dolosa AUO158]
 gi|124899582|gb|EAY71425.1| Chaperonin GroEL [Burkholderia dolosa AUO158]
          Length = 546

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/528 (55%), Positives = 397/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEITFSDVARAKLTEGVNVLANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  GLADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVAAAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL I+AEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIVAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  I++  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R   A+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  + N+GYN
Sbjct: 421 RVRHAIRDLKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFDAPKD 527


>gi|93005371|ref|YP_579808.1| chaperonin GroEL [Psychrobacter cryohalolentis K5]
 gi|119366261|sp|Q1QDC9|CH60_PSYCK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|92393049|gb|ABE74324.1| chaperonin GroEL [Psychrobacter cryohalolentis K5]
          Length = 549

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/525 (56%), Positives = 387/525 (73%), Gaps = 2/525 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K G  AR  +  GVN LA AV+ TLGPKGR V+I  SFGAP +TKDGV+VAK I  
Sbjct: 2   AKDVKFGIDARKQMMDGVNVLANAVRVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           +N F  +GA+++R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGID 
Sbjct: 62  ENKFENMGAQLVREVASRTNDVAGDGTTTATVLAQSILQEGMKSVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+  VE +          + I QV +ISAN D +IGE IA AME++G  G+IT+++  +
Sbjct: 122 AVRAAVEQIHLLSTPADDSKAIAQVGSISANSDTKIGELIAQAMEKVGKQGVITVEEGSS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
               + VV+GMQ DRGYISPYF    + +TAE ENPYIL+ DKKIS ++ ++P+LE   Q
Sbjct: 182 FEDTLEVVEGMQFDRGYISPYFANKQDSLTAEFENPYILLVDKKISNIREIVPLLEQVMQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
             +PL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L DIA + G TVIS
Sbjct: 242 QSKPLLIIAEDVENEALATLVVNNMRGGLKTCAVKAPGFGDRRKAMLEDIATLTGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EEIGL LE AT+  LG+AKKV + K++T IV G G S  IE R+  I++ +E++ SDYD+
Sbjct: 302 EEIGLSLETATLEQLGTAKKVTVGKENTVIVDGAGNSADIENRVESIKRQVEESTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVRA
Sbjct: 362 EKLQERMAKLAGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             ALS ++GDN+DQ AGI I+R+A+  P RQI+ N+G+E+ ++V++++ S T NYGYNA 
Sbjct: 422 MNALSELRGDNDDQNAGINILRRAMEAPLRQIVTNSGEEASVVVNEVK-SGTGNYGYNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
              +GDM EMGI+DP KV R+AL++A S+AG+ML TE ++ D P+
Sbjct: 481 SGEYGDMLEMGILDPAKVARSALENAASVAGLMLTTEVMITDLPQ 525


>gi|238025261|ref|YP_002909493.1| chaperonin GroEL [Burkholderia glumae BGR1]
 gi|237879926|gb|ACR32258.1| Chaperonin GroEL2 [Burkholderia glumae BGR1]
          Length = 540

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 304/539 (56%), Positives = 403/539 (74%), Gaps = 6/539 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTMTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + + +EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVGAVLDQLRTLSKPISTNKEIAQVGSISANSDEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKISA++ LLPILE A
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINDPEKQAAYLDDALILLHDKKISAVRDLLPILEVA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNAMRGILKVVAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE G +LEKAT+ DLG AK+V + K+DT I+ G G ++RIE R+ +I+  I++  SDY
Sbjct: 301 IAEETGKQLEKATLEDLGQAKRVEVRKEDTIIIDGAGEAKRIEARVKQIRAQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  ALS +KG N DQ AGI+IV +AL  P R I+ NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARAALSGLKGANADQDAGIQIVLRALEAPLRVIVSNAGDEPAVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE----TASPQM 534
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKDE     A+P+M
Sbjct: 480 AASGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKDEKPVPAAAPEM 538


>gi|116691621|ref|YP_837154.1| chaperonin GroEL [Burkholderia cenocepacia HI2424]
 gi|123464467|sp|A0AXY5|CH602_BURCH RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|116649621|gb|ABK10261.1| chaperonin GroEL [Burkholderia cenocepacia HI2424]
          Length = 546

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/528 (56%), Positives = 397/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEK T+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKTTLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-TGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|114800428|ref|YP_760663.1| chaperonin GroEL [Hyphomonas neptunium ATCC 15444]
 gi|123323194|sp|Q0C0T0|CH60_HYPNA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|114740602|gb|ABI78727.1| chaperonin GroEL [Hyphomonas neptunium ATCC 15444]
          Length = 547

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 308/530 (58%), Positives = 408/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR+ +  GV+TLA AVK TLGPKGR V+I  SFGAPR TKDGVTVAK I
Sbjct: 1   MAAKHVVFGAEARERMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+   D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKANDTAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
             AV EVV  L  + KKV + EEI QV TISANG+ EIG+ IA AM ++G  G+IT+++A
Sbjct: 121 SKAVAEVVSDLAHHSKKVKTNEEIAQVGTISANGETEIGQMIAEAMAKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYF+T+ ++M  E+E+  IL+++ K+S+LQPLLPILES 
Sbjct: 181 KALETELDVVEGMQFDRGYISPYFITNPDKMIVELEDVLILLHESKLSSLQPLLPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 VQSQKPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AK+V + KD+TTIV G G  + IE R+++I+K I+DT SDY
Sbjct: 301 ISEDLGIKLENVGMEMLGKAKRVSIDKDNTTIVDGGGKKKEIEARVSQIRKQIDDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R+++ + V G N+D+ AGI+IVRKAL  P RQI +NAG E  ++V+ I  +K+ +YG+NA
Sbjct: 421 RSSKNIDVVGLNDDEKAGIDIVRKALEAPIRQIAENAGVEGSVVVNTILNNKSRSYGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  MG+IDPVKVVR+ALQ+A S+A +++ TEA + +APK E+A
Sbjct: 481 QTEEYGDLVAMGVIDPVKVVRSALQNAASIASLLITTEAGIAEAPKKESA 530


>gi|78046127|ref|YP_362302.1| chaperonin GroEL [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|119366277|sp|Q3BY61|CH60_XANC5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|78034557|emb|CAJ22202.1| 60 kDa chaperonin [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 546

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 301/537 (56%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  + NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM E GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPAMPA 534


>gi|170697256|ref|ZP_02888350.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10]
 gi|170137876|gb|EDT06110.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10]
          Length = 546

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/528 (55%), Positives = 398/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDVARTKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVDSLKTISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 VAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ +  + N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVADG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFEAPKD 527


>gi|167035479|ref|YP_001670710.1| chaperonin GroEL [Pseudomonas putida GB-1]
 gi|189082362|sp|B0KFQ2|CH60_PSEPG RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166861967|gb|ABZ00375.1| chaperonin GroEL [Pseudomonas putida GB-1]
          Length = 547

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/531 (56%), Positives = 391/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   VV  LK   K     + I QV TISAN D  IG  IA AME++G  G+IT+++ 
Sbjct: 121 DKATAAVVAELKNLSKPCADSKAIAQVGTISANSDDSIGNIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+E P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+  LG+AK+V++SK++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG+NEDQ  GI ++R+A+  P RQI  NAGDE  ++  K+++  + N+GYN
Sbjct: 421 RALAAIVDLKGENEDQNVGIALLRRAVEAPLRQITANAGDEPSVVADKVKQG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA++ DAP +  A
Sbjct: 480 AATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMIADAPSEAPA 530


>gi|576779|gb|AAA53369.1| GroEL [Pseudomonas aeruginosa]
          Length = 547

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 398/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATVAIVAQLKELAKPCADTKAIAQVGTISANSDESIGQIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+++P +L+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IE+T SDY
Sbjct: 301 ISEEVGLSLEGATLEHLGNAKRVVINKENTTIIDGAGVQADIEARVLQIRKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERL KLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLGKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNE+Q  GI ++R+A+  P RQI+ NAGDE  ++V K+++  + NYG+N
Sbjct: 421 RALQAIEGLKGDNEEQNVGIALLRRAVESPLRQIVANAGDEPSVVVDKVKQG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +  +D+ A
Sbjct: 480 AATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEIVEDKPA 530


>gi|50085881|ref|YP_047391.1| chaperonin GroEL [Acinetobacter sp. ADP1]
 gi|59797745|sp|Q6F8P6|CH60_ACIAD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|49531857|emb|CAG69569.1| chaperone Hsp60, peptide-dependent ATPase, heat shock protein
           [Acinetobacter sp. ADP1]
          Length = 544

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 400/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  TLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE ++A  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVRAVVENIRATAKPADDFKAIEQVGSISANSDETVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+  LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELITTLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+A++ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQASLQDLGTAHKITVSKENTVIVDGAGDANAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  +L  + G N+DQ  GI I+R+A+  P RQI+ NAGDE  ++++ ++  +  NYGYN
Sbjct: 421 RAVNSLDGLTGANDDQTVGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A   V+GDM EMGI+DP KV R+AL+ A S+AG+ML TEA++ D P+D+ A P
Sbjct: 480 AATGVYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTEAMITDIPEDKPAMP 532


>gi|152978341|ref|YP_001343970.1| chaperonin GroEL [Actinobacillus succinogenes 130Z]
 gi|171704271|sp|A6VM38|CH60_ACTSZ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|150840064|gb|ABR74035.1| chaperonin GroEL [Actinobacillus succinogenes 130Z]
          Length = 547

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 299/534 (55%), Positives = 400/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVSELKALSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPYIL+ DKKIS ++ LLP+LE+ 
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVEMDNPYILLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKA + DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKAALEDLGQAKRVVINKDNTTIIDGVGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVAGGGVALI 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A +++GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  NYGY
Sbjct: 421 RAASKAAANLQGDNEEQNVGIKLALRAMEAPLRQIVANAGEEASVVASAVKNGE-GNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM  MGI+DP KV R+ALQ A S+AG+M+ TEA+V + PKD+   P
Sbjct: 480 NAGTEEYGDMIAMGILDPTKVTRSALQFAASIAGLMITTEAMVTELPKDDKLDP 533


>gi|113866733|ref|YP_725222.1| chaperonin GroEL [Ralstonia eutropha H16]
 gi|123134358|sp|Q0KDR7|CH60_RALEH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|113525509|emb|CAJ91854.1| Chaperonin GroEL (HSP60 family) [Ralstonia eutropha H16]
          Length = 547

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKA + DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKAGLNDLGQAKRIEIGKENTIIIDGAGDAAAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PK+E+A
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKEESA 530


>gi|332288903|ref|YP_004419755.1| chaperonin GroEL [Gallibacterium anatis UMN179]
 gi|330431799|gb|AEC16858.1| chaperonin GroEL [Gallibacterium anatis UMN179]
          Length = 553

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 399/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLNGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  LK   K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAEVVAELKNLSKPCETSKEIEQVGTISANSDSVVGQIIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E +NPY+L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 TGLEDELAVVEGMQFDRGYLSPYFINKPETATVEFDNPYVLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV+SKD+TTI+ G G   +I+ R+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVISKDNTTIIDGVGDEAQIQARVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  ++ + G+NEDQ  GI++  +A+  P RQI+ NAG+E+ ++ SK++ S   N+GYN
Sbjct: 421 RAANKVAGLVGENEDQNVGIKLALRAMEAPLRQIVTNAGEEASVVASKVK-SGEGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V + PKDE A
Sbjct: 480 AGAEVYGDMLEMGILDPTKVTRSALQFASSIAGLMITTECMVTELPKDEKA 530


>gi|86356911|ref|YP_468803.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|119366223|sp|Q2KAR0|CH603_RHIEC RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|86281013|gb|ABC90076.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 544

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 302/548 (55%), Positives = 400/548 (72%), Gaps = 7/548 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+IK  T AR  +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGVTVA+ I
Sbjct: 1   MSAKEIKFSTDARAHLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVTVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              N F  +GA+M+R+VA+ T D +GDGTTTAT LA +I+ EG K V AG+NPMD++RGI
Sbjct: 61  ELGNKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  +V+ ++A  +KV S  EI QV  I+ANGD  +GE IA AME++G  G+IT+++A
Sbjct: 121 DLGVSAIVKEIQARARKVKSSGEIAQVGAIAANGDATVGEMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYIL+++KK+ +LQ LLPILE+ 
Sbjct: 181 RTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILLHEKKLGSLQALLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +I+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIAA+    +
Sbjct: 241 VQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAALTSGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V++ KD TTI+ G G    I+ RI +++  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLYMLGRAKRVLIEKDTTTIIDGTGEKAAIQARIQQMKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIEDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ + G+N D  AGI IV +AL  P RQI +NAG E  +IV ++      N G++
Sbjct: 421 RAKSALTGMVGENADVTAGISIVLRALEAPIRQIAENAGFEGSIIVGRLTGRNDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM E GI+DP KVVR ALQ AGS+A +++  E ++ D P    A    PA G 
Sbjct: 481 AQTETYVDMVEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIPARNPA----PAVG- 535

Query: 540 MGGGMGGM 547
             GGMG M
Sbjct: 536 -NGGMGDM 542


>gi|73542341|ref|YP_296861.1| chaperonin GroEL [Ralstonia eutropha JMP134]
 gi|118597120|sp|Q46XW6|CH60_RALEJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|72119754|gb|AAZ62017.1| Chaperonin Cpn60/TCP-1 [Ralstonia eutropha JMP134]
          Length = 547

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAAAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENPDQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PK+E+A
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAETPKEESA 530


>gi|268317470|ref|YP_003291189.1| chaperonin GroEL [Rhodothermus marinus DSM 4252]
 gi|25452896|sp|Q9XCA9|CH60_RHOMR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|5020010|gb|AAD37976.1|AF145252_2 heat shock protein GroEL [Rhodothermus marinus]
 gi|262335004|gb|ACY48801.1| chaperonin GroEL [Rhodothermus marinus DSM 4252]
          Length = 540

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 307/536 (57%), Positives = 398/536 (74%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR A+  GV+ LA+AVK TLGPKGR VII   FGAP VTKDGVTVAK I
Sbjct: 1   MAAKQITFNADARMALKRGVDKLADAVKVTLGPKGRNVIIEKKFGAPTVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++    VGA+M+++VA+ T D +GDGTTTAT LAQAI   G K VTAG NPMD+KRGI
Sbjct: 61  ELEDKLENVGAQMVKEVASKTSDVAGDGTTTATVLAQAILTAGLKSVTAGANPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L+   ++V  +  I QVATISANGD+ IG+ IA A E++G  G+IT+++A
Sbjct: 121 DKAVEVVVAELRKMSQEVQDKNRIAQVATISANGDKAIGQLIADAFEKVGKDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT+ + M A +E+ YILI+DKKISA++ LLPILE  
Sbjct: 181 KGTETTLEVVEGMQFDRGYLSPYFVTNPDTMEAVLEDAYILIHDKKISAMKDLLPILEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGRPLLIIAEDVEGEALATLVVNKLRGVLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LE AT+  LG A+++++ KD+TTIVGG G   +I+ R N+I++ IE+T SDY
Sbjct: 301 ISEEKGYRLENATLDYLGQAERIIVDKDNTTIVGGKGDPAQIKARANQIRQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAVL++G  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLAGGVAVLKIGAATEPEMKEKKARVEDALHATRAAVEEGIVPGGGVAYI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  V+ +NEDQ  G++IV++AL  P RQI  NAG E  ++V +++E +  ++G+N
Sbjct: 421 RAIAALDKVEVENEDQKIGVQIVQRALEEPLRQIAANAGWEGSIVVQRVKEGQ-GDFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   FG++ E G+IDP KV R AL++A S+AG++L TEAVV + P+ E A+   P
Sbjct: 480 AQTEEFGNLLEQGVIDPTKVARTALENAASVAGLLLTTEAVVAEKPEKEKAAAPSP 535


>gi|296135134|ref|YP_003642376.1| chaperonin GroEL [Thiomonas intermedia K12]
 gi|295795256|gb|ADG30046.1| chaperonin GroEL [Thiomonas intermedia K12]
          Length = 546

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 394/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVIFGADARARMVEGVNILANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  +G+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTTLVEQLKKASKPCSTSKEIAQVGSISANSDANVGQIIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + ++  A +ENPY+L++DKKIS ++ LLP LE  
Sbjct: 181 KSLENELDIVEGMQFDRGYLSPYFINNQDKQVAVLENPYVLLHDKKISNIRDLLPALEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNSIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++T I+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTIIIDGAGVAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDN DQ AGI+IV +A+  P R+I+ N+G E  ++++K+ E K  N+G+N
Sbjct: 421 RARQAVGEIKGDNHDQEAGIKIVLRAIEQPLREIVANSGGEPSVVINKVLEGK-GNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGIIDP KV R ALQ+A S+AG+ML TE +V +APKDE+A
Sbjct: 480 AANDTYGDMLEMGIIDPTKVTRTALQNAASVAGLMLTTECMVAEAPKDESA 530


>gi|56695789|ref|YP_166140.1| chaperonin GroEL [Ruegeria pomeroyi DSS-3]
 gi|68566259|sp|Q5LV15|CH60_SILPO RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|56677526|gb|AAV94192.1| chaperonin, 60 kDa [Ruegeria pomeroyi DSS-3]
          Length = 546

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/527 (56%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFNTEARNKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAASRPVNDSAEVAQVGTISANGESEIGRQIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKISITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L+ ++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES  A++G+N
Sbjct: 421 QAGKVLADLEGANADQTAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESGDASFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPQ 527


>gi|300692352|ref|YP_003753347.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
 gi|299079412|emb|CBJ52083.2| chaperone Hsp60 (GroEL), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
          Length = 547

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 392/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLQDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+K+ E    NYGYN
Sbjct: 421 RARAAVSSLKGANADQDAGIKIVLRAMEEPLRQIVANAGDEASVVVAKVIEG-NGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAA 530


>gi|85703818|ref|ZP_01034921.1| chaperonin GroEL [Roseovarius sp. 217]
 gi|85671138|gb|EAQ25996.1| chaperonin GroEL [Roseovarius sp. 217]
          Length = 530

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 292/513 (56%), Positives = 396/513 (77%), Gaps = 1/513 (0%)

Query: 19  GVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVA 78
           GVN LA+AVK TLGPKGR V++  SFG+PR+TKDGV+VAK I  ++ F  +GA+M+++VA
Sbjct: 4   GVNILADAVKVTLGPKGRNVVLDKSFGSPRITKDGVSVAKEIELEDKFENMGAQMVKEVA 63

Query: 79  TNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV 138
           + T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID A  +VVE +KA  + V
Sbjct: 64  SRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGIDQATSKVVEAIKAASRPV 123

Query: 139 GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRG 198
               E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ K   TE  VV+GMQ DRG
Sbjct: 124 NDSAEVAQVGTISANGESEIGRQIAEAMQKVGNEGVITVEENKGLETETDVVEGMQFDRG 183

Query: 199 YISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDA 258
           Y+SPYFVT++++M A++++  IL+++KK+S+LQP++P+LE   QS +PL IIAEDVEG+A
Sbjct: 184 YLSPYFVTNSDKMIADLDDCLILLHEKKLSSLQPMVPLLEQVIQSQKPLLIIAEDVEGEA 243

Query: 259 LATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLG 318
           LATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  VISE++G+KLE   +  LG
Sbjct: 244 LATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQVISEDLGMKLENVGMDMLG 303

Query: 319 SAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAV 378
           SAKK+ ++KD TTIV G G    IE R+++I++ IEDT SDYDR+KL+ER+AKLAGGVAV
Sbjct: 304 SAKKISITKDATTIVDGAGEKAEIEARVSQIRQQIEDTTSDYDREKLQERVAKLAGGVAV 363

Query: 379 LEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALS-VKGDNEDQCA 437
           + VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV+AA+ L+ ++G+N DQ A
Sbjct: 364 IRVGGMTETEVKERKDRVDDALNATRAAVQEGIVVGGGVALVQAAKKLAGLEGENSDQNA 423

Query: 438 GIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPV 497
           GI IVR+AL  P RQI +NAG +  ++  KI+ES+   +GYNAQ   +GDMF+ G+IDP 
Sbjct: 424 GIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESEDPKFGYNAQTDEYGDMFKFGVIDPA 483

Query: 498 KVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           KVVR AL+ A S+AG+++ TEA+V D P+ E++
Sbjct: 484 KVVRTALEDASSIAGLLITTEAMVADKPQKESS 516


>gi|120609639|ref|YP_969317.1| chaperonin GroEL [Acidovorax citrulli AAC00-1]
 gi|166198427|sp|A1TKQ5|CH60_ACIAC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|120588103|gb|ABM31543.1| chaperonin GroEL [Acidovorax citrulli AAC00-1]
          Length = 545

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/536 (55%), Positives = 395/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVAELKKASKATTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA   +KGDN DQ AGI+++ KA+  P R+I+ NAG E  ++V+ +   K  NYG+N
Sbjct: 421 RAKQAAGDIKGDNPDQDAGIKLILKAIEAPLREIVANAGGEPSVVVNAVLNGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APKD+  +P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKDDAPAPAMP 535


>gi|85714226|ref|ZP_01045214.1| chaperonin [Nitrobacter sp. Nb-311A]
 gi|85698673|gb|EAQ36542.1| chaperonin [Nitrobacter sp. Nb-311A]
          Length = 547

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 301/529 (56%), Positives = 397/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARRRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVCEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ +    K V S  E+ QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DIAVAAVVKDIGKRAKAVASSAEVAQVGTISSNGDASIGKMIAQAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T V +V+GM+ DRGY+SPYFVT+ E+MTAE+++ YIL+++KK++ LQ LLP+LE+ 
Sbjct: 181 KSLETGVDIVEGMRFDRGYLSPYFVTNAEKMTAELDDVYILLHEKKLTGLQTLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AEDVEG+ALA LVVNR+R GL V AVKAP FGDRRK +L DI+ +    +
Sbjct: 241 VKSGKPLLIVAEDVEGEALAALVVNRLRGGLKVAAVKAPGFGDRRKAMLEDISILTNGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+G+KLE  T+  LG AKKV++ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISDELGMKLENVTLNMLGRAKKVLIDKENTTIVNGAGKKKDIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V K+ E+K   +G++
Sbjct: 421 RARKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKVLENKAETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQK  + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PK+E
Sbjct: 481 AQKEEYVDMVAKGIIDPAKVVRTALQDASSIAGLLVTTEAMVAELPKEE 529


>gi|262375896|ref|ZP_06069127.1| chaperonin GroL [Acinetobacter lwoffii SH145]
 gi|262308990|gb|EEY90122.1| chaperonin GroL [Acinetobacter lwoffii SH145]
          Length = 544

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 401/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNTLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  TLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +KA  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVRSVVENIKATAKPASDSKAIEQVGSISANSDTTVGQLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDSLDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL II+EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKTGKPLLIISEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++L++ T+  LG+A KV +SK++T IV G G + +I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEIGMQLDQTTLDHLGTAHKVTVSKENTVIVDGAGNAGQIADRVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE A+ EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVAMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA AL  V G N+DQ  GI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAASALEGVTGANDDQNVGINILRRAIEAPLRQIVSNAGDEPSVVINAVKNGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ + P+D+ A P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITEIPEDKPAMP 532


>gi|53805103|ref|YP_113217.1| chaperonin GroEL [Methylococcus capsulatus str. Bath]
 gi|68566274|sp|Q60AY0|CH601_METCA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|53758864|gb|AAU93155.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath]
          Length = 545

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 391/529 (73%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVKFSDDARTRMLRGVNILAHAVKVTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASQTSDVAGDGTTTATVLAQSILTEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ + A          I QV TISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVDEIHAMSVPCTDSNAIAQVGTISANADESIGKIIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                ++ +V+GMQ DRGY+SPYF+ + + M+AE+ENP+ILI +KKIS ++ LLP+LE  
Sbjct: 181 SGLENQLDIVEGMQFDRGYLSPYFINNQQSMSAELENPFILINEKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLVIVAEDVEGEALATLVVNNMRGILKVAAVKAPGFGDRRKAMLEDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IGL LEKAT+ADLG+AKKV ++K++TTI+ G G SE I+GR+ +I+K IEDT SDY
Sbjct: 301 ISEDIGLSLEKATLADLGTAKKVQITKENTTIIDGAGSSEAIQGRVAQIRKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA A+   +KG N DQ  GI I R+A+  P RQI+ NAGDE  ++++K+ E    N+GYN
Sbjct: 421 RALAKLRDLKGANHDQDVGISIARRAMEEPLRQIVANAGDEPSVVLNKVAEG-AGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A    +GDM  MGI+DP KV R+ALQ+A S+A +M+ TEA+V + PK+E
Sbjct: 480 AATGEYGDMVAMGILDPAKVTRSALQNAASVASLMITTEAMVAEEPKEE 528


>gi|148652450|ref|YP_001279543.1| chaperonin GroEL [Psychrobacter sp. PRwf-1]
 gi|172048507|sp|A5WD52|CH60_PSYWF RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148571534|gb|ABQ93593.1| chaperonin GroEL [Psychrobacter sp. PRwf-1]
          Length = 548

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/527 (56%), Positives = 386/527 (73%), Gaps = 2/527 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K G  AR  +  GVN LA AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I  
Sbjct: 2   AKDVKFGIDARKQMMDGVNVLANAVKVTLGPKGRNVVIDKSFGAPAITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           +N F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID 
Sbjct: 62  ENKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILVEGMKSVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV   VE +          + I QV +ISAN D +IGE IA AM+++G  G+IT+++   
Sbjct: 122 AVAAAVEEIHNISTPADDSKAIAQVGSISANSDTKIGELIAEAMDKVGKKGVITVEEGSG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
               + VV+GMQ DRGYISPYF    + +TAE ENPYIL+ DKKIS ++ ++P+LE   Q
Sbjct: 182 FEDSLEVVEGMQFDRGYISPYFANKQDSLTAEFENPYILLVDKKISNIREIVPLLEQVMQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
             +PL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G TVIS
Sbjct: 242 QSKPLLIIAEDVENEALATLVVNNMRGGLKTCAVKAPGFGDRRKAMLQDIAILTGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EE+G+ LE ATI  LG+AKKV + K++T IV G G    IE R+  I + IE++ SDYD+
Sbjct: 302 EEVGMSLETATIEQLGTAKKVTVGKENTVIVDGAGNKADIEARVESINRQIEESTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKL+GGVAV++VG  TE A+ EKKDR  D+L ATRAA +EG+VPGGG+ALVRA
Sbjct: 362 EKLQERVAKLSGGVAVIKVGAATETAMKEKKDRVDDALHATRAAVEEGVVPGGGVALVRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             AL+ +KGDNEDQ AGI I+R+A+  P RQI+ NAGDE+ ++V++++   + NYGYNA 
Sbjct: 422 LNALADLKGDNEDQNAGINILRRAMEAPLRQIVTNAGDEASVVVNEVKNG-SGNYGYNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
             V+GDM EMGI+DP KV R+AL+ A S+AG+ML TEA++ D P+ +
Sbjct: 481 TGVYGDMLEMGILDPAKVSRSALEHAASVAGLMLTTEAMITDKPQSD 527


>gi|260582753|ref|ZP_05850540.1| chaperonin GroL [Haemophilus influenzae NT127]
 gi|260094203|gb|EEW78104.1| chaperonin GroL [Haemophilus influenzae NT127]
          Length = 548

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|82703461|ref|YP_413027.1| chaperonin GroEL [Nitrosospira multiformis ATCC 25196]
 gi|119366251|sp|Q2Y6I6|CH60_NITMU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|82411526|gb|ABB75635.1| Chaperonin Cpn60/TCP-1 [Nitrosospira multiformis ATCC 25196]
          Length = 552

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 399/531 (75%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K   +AR  +  GVN LA+AVK TLGPKGR V++  S+G+P +TKDGV+VAK I
Sbjct: 1   MAAKEVKFSDSARHKMVNGVNILADAVKVTLGPKGRNVVLERSYGSPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVKEGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV +ISAN D EIG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVATVEELKKLSKPCTTGKEIAQVGSISANSDPEIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +R  A +E+P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLQNELEVVEGMQFDRGYLSPYFINNADRQIALLESPFILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDV+G+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+A+LG AK+V + K++TTI+ G G ++ IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLSLEKATLAELGQAKRVEVGKEETTIIDGAGDTQNIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R   A+S +KGDN DQ AGI+IV +AL  P RQI+ N GDE  ++++K+ E  T N+GYN
Sbjct: 421 RTRSAVSNLKGDNHDQDAGIKIVLRALEEPLRQIVANCGDEPSVVINKVLEG-TENFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A  S +GDM +MG++DP KV R ALQ A S+AG+ML T+A+V + PK+E A
Sbjct: 480 AASSEYGDMVQMGVLDPTKVTRYALQHAASIAGLMLTTDALVAEVPKEEGA 530


>gi|310815425|ref|YP_003963389.1| chaperonin GroEL [Ketogulonicigenium vulgare Y25]
 gi|308754160|gb|ADO42089.1| chaperonin GroEL [Ketogulonicigenium vulgare Y25]
          Length = 547

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/527 (55%), Positives = 398/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFNTEARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++++VA  T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQLVKEVAARTNDEAGDGTTTATVLAQAIIKEGLKSVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE LKA  + V   +E+ QV TISANG+  IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLATTKVVEALKAAARPVADSDEVAQVGTISANGEALIGKLIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GMQ DRG++SPYFVT+ ++M A++++  IL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGTETSVEVVEGMQFDRGFLSPYFVTNPDKMVADLDDVLILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLEGVTIDMLGSAKRVSITKDATTIVDGAGERTEIEARVGQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + G N DQ  GI I+R+AL  P RQI +N+G +  ++  KI+ES + ++G+N
Sbjct: 421 QATKVLDGLVGANSDQNVGIAIIRRALEAPIRQISENSGVDGAVVAGKIRESTSTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   +GDMF  G+IDP KV R AL++A S+A +++ TEA++ D P+
Sbjct: 481 AQTEEYGDMFTFGVIDPAKVTRTALENAASVASLLITTEAMIADKPE 527


>gi|206562409|ref|YP_002233172.1| chaperonin GroEL [Burkholderia cenocepacia J2315]
 gi|198038449|emb|CAR54407.1| 60 kDa chaperonin 2 [Burkholderia cenocepacia J2315]
          Length = 546

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/528 (56%), Positives = 398/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  I++  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-TGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFEAPKD 527


>gi|253795682|ref|YP_003038778.1| chaperonin GroEL [Candidatus Hodgkinia cicadicola Dsem]
 gi|253739990|gb|ACT34325.1| chaperonin GroEL [Candidatus Hodgkinia cicadicola Dsem]
          Length = 536

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/534 (55%), Positives = 401/534 (75%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK +  G  AR+ +  GVN LA+AVK TLGPKGR V+I  +FG PRVTKDGVTVAK I  
Sbjct: 2   AKQLLFGVDARNKLVAGVNALADAVKVTLGPKGRNVVIERAFGPPRVTKDGVTVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
            + F  VGA+M+R+VA  T D +GDGTTTAT LAQAI  EG K V  G NP+D+KRGIDL
Sbjct: 62  GDKFENVGAQMVREVAAKTNDVAGDGTTTATVLAQAIIKEGVKAVATGANPVDLKRGIDL 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV EV + L +N K++ S EEI QVATISANG+R+IG  IA AM+++G  G+IT+++A+ 
Sbjct: 122 AVDEVAKILHSNSKRISSLEEIAQVATISANGERQIGLDIAEAMQRVGGDGVITVEEARA 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
           A TE+ VV+G+Q DRGY+SPYFVT+ E+M  E++NPY+L+YD++IS+LQ L+P+LE+  Q
Sbjct: 182 AATELEVVEGVQFDRGYLSPYFVTNQEKMVCELDNPYVLLYDRRISSLQALVPLLETVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           + R L ++A+DVEG+ALATLVVN++R GL V  VKAP FGDR+K++L D+A + GA V+S
Sbjct: 242 TNRCLLVVADDVEGEALATLVVNKLRAGLRVAGVKAPGFGDRKKQMLEDVAVLTGAQVVS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E+IG KLE  T+  LG A+KVV++KD TTIV G G    +  RI++I+   +D+ SDY+R
Sbjct: 302 EDIGAKLENVTLDKLGRARKVVITKDTTTIVDGGGSKVELRNRISQIKAQWQDSASDYER 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           ++L ERLA+L+GGVAV++VG VTEA + EKKDR +D+L+ATRAA  EGIV GGG+AL+ A
Sbjct: 362 ERLHERLARLSGGVAVIKVGGVTEAEVKEKKDRVEDALNATRAAVQEGIVAGGGVALLWA 421

Query: 423 AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQK 482
           ++A++      D+  G +I+ +AL  P +QI  NAG +S L+V K+ ES ++++GY+AQ 
Sbjct: 422 SKAMAPPAVVGDERVGFDILNRALCAPAKQIAVNAGYDSSLVVGKVLESGSSSFGYDAQA 481

Query: 483 SVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
             +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA+V +A K +  + Q  A
Sbjct: 482 GRYGDMLAMGIVDPVKVVRTALQDAASVAGLLITTEAIVAEAAKKDKPTLQSDA 535


>gi|148827734|ref|YP_001292487.1| chaperonin GroEL [Haemophilus influenzae PittGG]
 gi|166198465|sp|A5UH48|CH60_HAEIG RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148718976|gb|ABR00104.1| chaperonin GroEL [Haemophilus influenzae PittGG]
          Length = 548

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|313673978|ref|YP_004052089.1| chaperonin groel [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940734|gb|ADR19926.1| chaperonin GroEL [Calditerrivibrio nitroreducens DSM 19672]
          Length = 541

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 313/548 (57%), Positives = 396/548 (72%), Gaps = 9/548 (1%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK I     AR AI  GV+ LA AVK TLGPKGR V+I   FG+P VTKDGVTVAK I  
Sbjct: 2   AKAITFSEEARQAILRGVDKLANAVKVTLGPKGRNVVIEKKFGSPLVTKDGVTVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           K+    +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGID 
Sbjct: 62  KDALENLGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGIKNVVAGSNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+ VV  LK   K +  ++EI QV TISAN D EIG  IA AME++G  G+ITI++ K+
Sbjct: 122 AVEAVVAELKKMSKPIQGKKEIAQVGTISANNDPEIGNIIADAMERVGKDGVITIEENKS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             T + VV+GMQ DRGY+SPYFVT  E M A +ENPY+LI DKKIS ++ LLPILE   +
Sbjct: 182 TDTVLDVVEGMQFDRGYLSPYFVTDPENMEAILENPYLLICDKKISNMKELLPILEQLAK 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
              P  IIAED+EG+ALATLVVN++R  L   AVKAP FGDRRKE+L+DIA + G  VIS
Sbjct: 242 QNAPFLIIAEDIEGEALATLVVNKLRGTLNCCAVKAPGFGDRRKEMLKDIAILTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EE+GLKLE A ++DLG AKKVV+ K++TTIV G G +E I+ R+N I+K IE+T SDYDR
Sbjct: 302 EELGLKLENAKLSDLGRAKKVVVEKENTTIVEGAGKTEDIQARVNVIKKQIEETTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L AT+AA +EGIVPGGG+AL+RA
Sbjct: 362 EKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATKAAVEEGIVPGGGVALLRA 421

Query: 423 AQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           ++A+ ++K    DQ  G +IVR+AL YP RQI  NAG E  ++V+KI E++   +G++A 
Sbjct: 422 SRAIANLKDLTPDQKVGADIVRRALEYPVRQIASNAGFEGSIVVNKILEAEKDTFGFDAH 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
             ++ DM E GIIDP KV R+ALQ+A S+AG+ML TEA++ + P  E   P MP  G   
Sbjct: 482 AEIYTDMIEAGIIDPTKVTRSALQNAASVAGLMLTTEAMITEIP--EKKEPAMPNPG--- 536

Query: 542 GGMGGMDM 549
               GMDM
Sbjct: 537 ---MGMDM 541


>gi|322514893|ref|ZP_08067909.1| chaperone GroEL [Actinobacillus ureae ATCC 25976]
 gi|322119125|gb|EFX91277.1| chaperone GroEL [Actinobacillus ureae ATCC 25976]
          Length = 547

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/534 (55%), Positives = 399/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNILADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYI++ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKATI +LG AK+VV++KD+TTI+ G G   +I+ R+ +I + IED+ SDY
Sbjct: 301 ISEEIGMELEKATIEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQILQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A+++ GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVAVTLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PKDE   P
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKDEKLDP 533


>gi|255036493|ref|YP_003087114.1| chaperonin GroEL [Dyadobacter fermentans DSM 18053]
 gi|254949249|gb|ACT93949.1| chaperonin GroEL [Dyadobacter fermentans DSM 18053]
          Length = 543

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 399/530 (75%), Gaps = 2/530 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           +K I   T ARD +  GV+TLA+AVK TLGP+GR V+I   FG+P +TKDGVTVAK I  
Sbjct: 2   SKKIFFDTEARDKVKRGVDTLADAVKVTLGPRGRNVVIDKKFGSPSITKDGVTVAKEIDL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           K+    +GA+++++VA+ T DS+GDGTTTAT LAQAIY+ G K V AG NPMD+KRGID 
Sbjct: 62  KDPIENMGAQLVKEVASKTADSAGDGTTTATVLAQAIYSIGVKNVAAGANPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV  + + L+A  K + + +EI QVATISAN D EIG  IA AME++G  G+IT+++A+ 
Sbjct: 122 AVSVITKDLEAQKKNISTSKEIAQVATISANHDEEIGNMIAEAMEKVGKEGVITVEEARG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TEV+ V+GMQ DRGY+SPYFVT+TE+M AE+E P+ILI +KK+S+++ LLP+LE+  Q
Sbjct: 182 TETEVKTVEGMQFDRGYLSPYFVTNTEKMEAELERPFILISEKKVSSMKELLPVLEAVAQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           +GRPL I+AEDV+G+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TVIS
Sbjct: 242 TGRPLLILAEDVDGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAIITGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EE G KLE AT+  LG+ +K ++ KD+TT+V G+G SE I+ R+N+I+  IE+T SDYDR
Sbjct: 302 EERGFKLENATLDYLGTCEKAIIDKDNTTLVNGSGASEDIQARVNQIKAQIENTTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKL+GGVA+L +G  TE  + EKKDR  D+L ATRAA +EGIV GGG+A +RA
Sbjct: 362 EKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVAFIRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +L  +KG+N+D+  GI I+R AL  P R I+ NAG E  ++++K+++   A +GYNA+
Sbjct: 422 TASLDDLKGNNDDETTGINIIRAALEAPLRTIVSNAGGEPSVVINKVKDGSGA-FGYNAK 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
            + + D+ E GIIDP KV R AL++A S+AG++L TE V+ D P++  A+
Sbjct: 481 DNTYQDLLEAGIIDPKKVSRLALENAASIAGLLLTTECVIADEPEEAPAA 530


>gi|2493641|sp|P95678|CH60_RHOCA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|1699436|gb|AAB37532.1| Cpn60 [Rhodobacter capsulatus]
          Length = 545

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/531 (55%), Positives = 399/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA   VVE +KA  + V   +E+ QV TISANG+ +IG  IA A +++G  G+IT+++ 
Sbjct: 121 DLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADASQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKV +SK++TTIV G+G    I  R+  I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAHIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L+ + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAAKKLNDLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TE ++ + P+ + A
Sbjct: 481 AQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPKAA 531


>gi|240950363|ref|ZP_04754632.1| chaperonin GroEL (HSP60 family) protein [Actinobacillus minor
           NM305]
 gi|240295120|gb|EER45942.1| chaperonin GroEL (HSP60 family) protein [Actinobacillus minor
           NM305]
          Length = 547

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 397/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  +FGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK+  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVEELKSLSKPCETSKEIEQVGTISANSDSTVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYIL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKATI +LG AK+VV+SKD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATIEELGQAKRVVISKDNTTIIDGVGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA  ++  VKGDNE+Q  GI +  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVADVVKGDNEEQNVGIRLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PK+E A
Sbjct: 480 NAATEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMVTDLPKEEKA 531


>gi|319761534|ref|YP_004125471.1| chaperonin groel [Alicycliphilus denitrificans BC]
 gi|330823403|ref|YP_004386706.1| chaperonin GroEL [Alicycliphilus denitrificans K601]
 gi|317116095|gb|ADU98583.1| chaperonin GroEL [Alicycliphilus denitrificans BC]
 gi|329308775|gb|AEB83190.1| chaperonin GroEL [Alicycliphilus denitrificans K601]
          Length = 548

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/529 (56%), Positives = 395/529 (74%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKIQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IGE IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVEELKKASKATTTSKEIAQVGSISANSDSSIGEIIANAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE+ 
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNPEKQVALLDNPFVLLFDKKISNIRDLLPTLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK + + K++TTI+ G G ++ I+ R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLSLEKVTLADLGQAKTIEVGKENTTIIDGAGNADDIQARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDN DQ AGI+++ KA+  P R+I+ NAG E  ++V+++   K  NYG+N
Sbjct: 421 RARQAVGQLKGDNPDQDAGIKLILKAIEAPLREIVANAGGEPSVVVNEVLNGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APKD+
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKDD 528


>gi|40714533|dbj|BAD06928.1| molecular chaperone GroEL [Ralstonia pickettii]
          Length = 547

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKA + DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKAGLNDLGQAKRIEIGKENTIIIDGAGDAGAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PKDE+A
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKDESA 530


>gi|71065121|ref|YP_263848.1| chaperonin GroEL [Psychrobacter arcticus 273-4]
 gi|119366260|sp|Q4FU94|CH60_PSYA2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|71038106|gb|AAZ18414.1| putative Chaperonin HSP60 family [Psychrobacter arcticus 273-4]
          Length = 546

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/525 (56%), Positives = 387/525 (73%), Gaps = 2/525 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K G  AR  +  GVN LA AV+ TLGPKGR V+I  SFGAP +TKDGV+VAK I  
Sbjct: 2   AKDVKFGIDARKQMMDGVNILANAVRVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           +N F  +GA+++R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGID 
Sbjct: 62  ENKFENMGAQLVREVASRTNDVAGDGTTTATVLAQSILQEGMKSVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+  VE +          + I QV +ISAN D +IGE IA AME++G  G+IT+++  +
Sbjct: 122 AVRAAVEQIHLLSTPADDSKAIAQVGSISANSDTKIGELIAQAMEKVGKQGVITVEEGSS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
               + VV+GMQ DRGYISPYF    + +TAE ENPYIL+ DKKIS ++ ++P+LE   Q
Sbjct: 182 FEDTLEVVEGMQFDRGYISPYFANKQDSLTAEFENPYILLVDKKISNIREIVPLLEQVMQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
             +PL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L DIA + G TVIS
Sbjct: 242 QSKPLLIIAEDVENEALATLVVNNMRGGLKTCAVKAPGFGDRRKAMLEDIATLTGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EEIGL LE AT+  LG+AKKV + K++T IV G G S  IE R+  I++ +E++ SDYD+
Sbjct: 302 EEIGLSLETATLEQLGTAKKVTVGKENTVIVDGAGHSADIENRVESIRRQVEESTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVRA
Sbjct: 362 EKLQERMAKLAGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             ALS ++GDN+DQ AGI I+R+A+  P RQI+ N+G+E+ ++V++++ S + NYGYNA 
Sbjct: 422 MNALSELRGDNDDQNAGINILRRAMEAPLRQIVTNSGEEASVVVNEVK-SGSGNYGYNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
              +GDM EMGI+DP KV R+AL++A S+AG+ML TE ++ D P+
Sbjct: 481 SGEYGDMLEMGILDPAKVARSALENAASVAGLMLTTEVMITDLPQ 525


>gi|25452853|sp|Q8RIT7|CH60_XANCH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|18496610|gb|AAL74150.1|AF426387_2 heat shock protein GroEL [Xanthomonas campestris pv. phaseoli]
          Length = 546

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/537 (55%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  + NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM + GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P MPA
Sbjct: 480 AANGEFGDMVQFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPVMPA 534


>gi|241662152|ref|YP_002980512.1| chaperonin GroEL [Ralstonia pickettii 12D]
 gi|240864179|gb|ACS61840.1| chaperonin GroEL [Ralstonia pickettii 12D]
          Length = 547

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 392/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +S +KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++VSK+ E K  NYGYN
Sbjct: 421 RARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVSKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PKD+TA
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAELPKDDTA 530


>gi|325579111|ref|ZP_08149067.1| chaperone GroEL [Haemophilus parainfluenzae ATCC 33392]
 gi|301155665|emb|CBW15133.1| Cpn60 chaperonin GroEL, large subunit of GroESL [Haemophilus
           parainfluenzae T3T1]
 gi|325159346|gb|EGC71480.1| chaperone GroEL [Haemophilus parainfluenzae ATCC 33392]
          Length = 548

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPYIL+ DKK+S ++ LLP+LE  
Sbjct: 181 TGLDDELAVVEGMQFDRGYLSPYFINKPETATVELDNPYILLVDKKVSNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGVGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAATKVAATLKGDNEEQDVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|163797980|ref|ZP_02191922.1| putative dimethyl sulfoniopropionate demethylase [alpha
           proteobacterium BAL199]
 gi|159176774|gb|EDP61345.1| putative dimethyl sulfoniopropionate demethylase [alpha
           proteobacterium BAL199]
          Length = 539

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/524 (56%), Positives = 392/524 (74%), Gaps = 1/524 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD + +G++ LA AVK TLGPKGR VI+  S+GAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSTDARDRMLHGIDILANAVKVTLGPKGRNVILAKSYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ + D +GDGTTTAT LA AI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRSSDMAGDGTTTATVLAHAIVREGAKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VV  ++   KKV +  EI QV TISAN DREIGE IA AM ++G  G+ITI+++
Sbjct: 121 DMAVEAVVADIQRVAKKVSTNAEIAQVGTISANDDREIGEMIAKAMAKVGNEGVITIEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ +V GMQ +RGY+SPYFVT+ E+M  E++ PYIL++DKK+  +Q LLP+LE+ 
Sbjct: 181 KSLQTELDIVDGMQFERGYLSPYFVTNAEKMICELDEPYILLHDKKLPGVQALLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VKSGRPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G K E  T+  LG+AKKV + KD+TT++ G G  + IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGTKFESVTLDMLGTAKKVRIEKDNTTVIDGGGKKKAIEARCTQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVA++ VG  TE  L E+KDR  D++ ATRAA +EGIV GGG+ L+
Sbjct: 361 DKEKLQERVAKLAGGVAIIRVGGATEVELKERKDRVDDAVHATRAAVEEGIVAGGGVTLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++ L S+K +N+DQ AGI IVR+AL  P RQI  NAG +  +IV K+ E   AN+G++
Sbjct: 421 YASKQLGSLKSENDDQKAGINIVRRALQAPARQIFVNAGADGSIIVGKLLEQSDANHGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
           AQ   + DM + GIIDP KVVR ALQ A S+AG+++ TEA+V +
Sbjct: 481 AQSGSYVDMVKAGIIDPAKVVRLALQGAASIAGLLITTEAMVAE 524


>gi|312962829|ref|ZP_07777316.1| chaperonin [Pseudomonas fluorescens WH6]
 gi|311282856|gb|EFQ61450.1| chaperonin [Pseudomonas fluorescens WH6]
          Length = 548

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 393/529 (74%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR VII  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLTGVNILADAVKATLGPKGRNVIIEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA++++DVA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGYKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATIAIVAELKNLSKPCADTKAIAQVGTISANSDSSIGDIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   E M AE+++P IL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPETMVAELDSPLILLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL II+EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIISEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+ +LGSAK+V +SK++T IV G G    I+ RIN+I+  + +T SDY
Sbjct: 301 ISEEIGLSLESATLENLGSAKRVTISKENTIIVDGAGVEGDIQSRINQIRAQVAETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV++VG  +E  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL+ + GDN DQ  GI ++R+A+  P RQI  N+GDE  ++V++++  K  NYGYN
Sbjct: 421 RALEALTGLTGDNADQNVGIAVLRRAVEAPLRQIAANSGDEPSVVVNEVKNGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G++L TEA + DAPK E
Sbjct: 480 AATGVYGDMIEMGILDPTKVTRSALQAASSIGGLILTTEAAIADAPKKE 528


>gi|226952456|ref|ZP_03822920.1| chaperonin GroEL [Acinetobacter sp. ATCC 27244]
 gi|294649742|ref|ZP_06727148.1| chaperone GroEL [Acinetobacter haemolyticus ATCC 19194]
 gi|226836778|gb|EEH69161.1| chaperonin GroEL [Acinetobacter sp. ATCC 27244]
 gi|292824373|gb|EFF83170.1| chaperone GroEL [Acinetobacter haemolyticus ATCC 19194]
          Length = 544

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 399/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE ++AN K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRANAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKI  ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKIGNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG+ L++ T+  LG+A KV +SK++T IV G G + +I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEIGMALDQTTLEHLGTAHKVTVSKENTVIVDGAGNAAQIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNVLDGLKGANEDQTAGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|319897940|ref|YP_004136137.1| 60 kda chaperonin [Haemophilus influenzae F3031]
 gi|317433446|emb|CBY81829.1| 60 kDa chaperonin [Haemophilus influenzae F3031]
          Length = 548

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKTMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|16262517|ref|NP_435310.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|307300739|ref|ZP_07580514.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|307319150|ref|ZP_07598580.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|20143872|sp|Q930Y0|CH603_RHIME RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|14523124|gb|AAK64722.1| 60 kDa chaperonin [Sinorhizobium meliloti 1021]
 gi|306895257|gb|EFN26013.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|306904273|gb|EFN34858.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 544

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/541 (55%), Positives = 395/541 (73%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK I   T ARD +  GV  L  AVK TLGPKGR V+I  S+GAPR+TKDGV+VAK I
Sbjct: 1   MSAKQIVFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R VA+ T D +GDGTTTAT LA +I+ EG K V+ G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVRAVASKTNDLAGDGTTTATVLAASIFREGAKLVSVGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DL V  V+  +KA   KV S  EI QV TI+ANGD  +GE IA AME++G  G+IT+++A
Sbjct: 121 DLGVAAVLAEIKARATKVISSSEIAQVGTIAANGDAGVGEMIARAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +TA TE+ VV+GMQ DRGY+SPYFVT+ E+M  E+E+PYILI++KK+ +LQ +LPILE+A
Sbjct: 181 RTADTELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILIHEKKLGSLQAMLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ LATLVVNR+R GL + AVK P FGDRRK +L DIA +    +
Sbjct: 241 VQSGKPLLIISEDVEGEVLATLVVNRLRGGLKIAAVKTPGFGDRRKAMLEDIAVLTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG A++V++ KD TTI+ G+G    I+ R+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRARRVLIEKDTTTIIDGSGDKASIQARVSQIKAQIEETASDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATELEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +  DN D  AGI IVR+AL  P RQI  NAG E  ++V K+ + +  N G++
Sbjct: 421 RAKSALVGLTDDNADVTAGISIVRRALEAPIRQIADNAGVEGSIVVGKLVDGRDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GI+DP KVVR AL+ AGS+A +++  EA++ D P  E  SPQ    G 
Sbjct: 481 AQTETYVDMIKAGIVDPAKVVRTALRDAGSIASLLITAEAMIADIP--ERGSPQSTGNGA 538

Query: 540 M 540
           +
Sbjct: 539 V 539


>gi|118595283|ref|ZP_01552630.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium
           HTCC2181]
 gi|118441061|gb|EAV47688.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium
           HTCC2181]
          Length = 553

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 397/536 (74%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVNTLA AVK T+GPKG+ V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVRFGDDVRQKMVKGVNTLANAVKVTMGPKGKNVVLERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T DS+GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELQDRFENMGAQMVKEVASKTSDSAGDGTTTATVLAQAIIREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  L    K   + +EI QV +ISAN D  +G+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVESAVAELHKLSKPCNTSKEIAQVGSISANSDTSVGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
              + E+ VV+GMQ DRGY+SPYF+ + +R  A +E+P+IL++DKKIS+++ LLP+LE  
Sbjct: 181 SGLSNELDVVEGMQFDRGYLSPYFINNQDRQIALLEDPFILLHDKKISSIKELLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ +PL IIAED+EG+ALATLVVN +R  +  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKASKPLLIIAEDIEGEALATLVVNNIRGIIKAVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+GL LE   I DLG AKK+ + K++T ++ G G  E I+ RI +I+  IE++ SDY
Sbjct: 301 ISDEVGLTLENVKIEDLGQAKKIEVGKENTIVIDGAGSQENIKTRIGQIKTQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L +TRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGATTEIEMKEKKARVEDALHSTRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++  KGDN DQ AGI+IV +A+  P RQI+ NAG ES ++V+ + E  T NYG+N
Sbjct: 421 RAKDAIAKTKGDNADQEAGIKIVLRAVEDPLRQIVSNAGIESSVVVNNVAEG-TGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMG++DP KV R+ALQ+A S+AG+ML TE ++ D PKD++A+P MP
Sbjct: 480 AANETYGDMVEMGVLDPTKVTRSALQNAASIAGLMLTTECMIADQPKDDSAAPAMP 535


>gi|145630276|ref|ZP_01786057.1| chaperonin GroEL [Haemophilus influenzae R3021]
 gi|144984011|gb|EDJ91448.1| chaperonin GroEL [Haemophilus influenzae R3021]
          Length = 548

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTTGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|282878354|ref|ZP_06287146.1| chaperonin GroL [Prevotella buccalis ATCC 35310]
 gi|281299540|gb|EFA91917.1| chaperonin GroL [Prevotella buccalis ATCC 35310]
          Length = 541

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 308/544 (56%), Positives = 404/544 (74%), Gaps = 6/544 (1%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKDIK    ARD +  GV+ LA AVK TLGPKGR V+I   FGAP++TKDGVTVAK I  
Sbjct: 2   AKDIKFDVEARDLLKQGVDKLANAVKITLGPKGRNVVIEKKFGAPQITKDGVTVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F   GA++++ VA+ T D +GDGTTTAT L QAI +EG K VTAG NPMD+KRGID 
Sbjct: 62  EDAFENTGAQLVKSVASKTGDDAGDGTTTATILTQAIVSEGLKNVTAGANPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSR-EEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           AV  VVEY+KA+ ++VG+  ++I QVAT+SAN D EIG+ +A AM ++  +G+ITI+++K
Sbjct: 122 AVSAVVEYIKAHAEQVGNNYDKIEQVATVSANNDAEIGKLLADAMRKVSKNGVITIEESK 181

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + VV+GMQ DRGY+S YFVT T++M + +ENPYILIY+KKIS ++  LPIL++A 
Sbjct: 182 SRDTNIGVVEGMQFDRGYLSSYFVTDTDKMESVMENPYILIYEKKISNIKEFLPILQNAA 241

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +SGRPL +IAEDV+ +AL TLVVNR+R GL + AVKAP FGDRRK +L DIA + G  VI
Sbjct: 242 ESGRPLLVIAEDVDSEALTTLVVNRLRAGLKICAVKAPGFGDRRKAMLEDIAILTGGVVI 301

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE GLKLE+AT+  LGSA+KV ++KD TT+V G G SE I+ RIN+I+  IE+T S YD
Sbjct: 302 SEEKGLKLEQATLEMLGSAEKVTVNKDYTTVVNGGGQSENIQARINQIKAEIENTTSSYD 361

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAVL VG  +E  + EKKDR  D+L ATRAA +EG+V GGGI  +R
Sbjct: 362 KEKLQERLAKLSGGVAVLYVGANSEVEMKEKKDRVDDALCATRAAIEEGVVAGGGITYIR 421

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A  AL  VKG N D+  GI IV +A+  P RQI+ NAG E  ++V K+++ K  +YGYNA
Sbjct: 422 ALDALKGVKGVNTDEQTGINIVERAIEEPLRQIVTNAGGEGAVVVDKVRQGKD-DYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           +   + D+ + GI+DP KV R AL++A S+AGM L TE ++VD P+++   P MPA  GM
Sbjct: 481 RTDSYEDLRKEGIVDPAKVARVALENAASIAGMFLTTECLIVDKPEEK---PAMPAAPGM 537

Query: 541 GGGM 544
           GG M
Sbjct: 538 GGMM 541


>gi|303258259|ref|ZP_07344266.1| chaperonin GroL [Burkholderiales bacterium 1_1_47]
 gi|331001097|ref|ZP_08324728.1| chaperonin GroL [Parasutterella excrementihominis YIT 11859]
 gi|302859012|gb|EFL82096.1| chaperonin GroL [Burkholderiales bacterium 1_1_47]
 gi|329569402|gb|EGG51180.1| chaperonin GroL [Parasutterella excrementihominis YIT 11859]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 290/531 (54%), Positives = 397/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AK +  G  AR  +  GVN LA+AVK TLGPKGR V++  +FG P +TKDGV+VAK +
Sbjct: 1   MTAKQVLFGNDARSRMVNGVNVLADAVKVTLGPKGRNVVLERAFGGPTITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D++GDGTTTAT LAQAI +EG KYV AG++PMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVDEGMKYVAAGMSPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E L +  K   + +E+ QV  ISAN D EIG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAAIEQLHSLSKPTTTSKEVAQVGAISANSDHEIGDIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A +ENPY+L+ +KKIS ++ LLPILE  
Sbjct: 181 KSLHNELEVVEGMQFDRGYLSPYFINNPDKQVALLENPYLLLVEKKISNIRDLLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKSGRPLLIIAEDIEGEALATLVVNSIRGVLKTVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS ++GL LEKAT+A+LGSAKKV ++K+ TTI+ G G  ++IE R+ +I+  +E+T SDY
Sbjct: 301 ISSDVGLTLEKATLAELGSAKKVEVNKESTTIIDGAGKEDQIEARVKQIRAQMEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDN +Q AGI+IV +A+  P RQI++NAGDE  ++V ++   K  N+G+N
Sbjct: 421 RAKQAIKEIKGDNPEQDAGIKIVLRAMEEPMRQIVRNAGDEPSVVVDRVANGK-GNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDM EMG++DP KV R ALQ+A S+A ++L TE ++ D P+D+ A
Sbjct: 480 AQTGEYGDMIEMGVLDPTKVTRTALQNAASVASLILTTECMIADMPEDKPA 530


>gi|262276786|ref|ZP_06054579.1| chaperonin GroL [alpha proteobacterium HIMB114]
 gi|262223889|gb|EEY74348.1| chaperonin GroL [alpha proteobacterium HIMB114]
          Length = 550

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/531 (56%), Positives = 407/531 (76%), Gaps = 5/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K +K  T AR+A+  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAGKIVKFDTEARNAMLKGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTT+T LAQ+I  EG KYV+AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKTNDEAGDGTTTSTVLAQSIAKEGCKYVSAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A+++V+E +K++ KKV + EEI QV TISANG++EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DTAIEKVIEEIKSSSKKVKTSEEIAQVGTISANGEKEIGDMISKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRG++SPYF+T++++M AE++NP IL+ +KK+S LQ ++P+LES 
Sbjct: 181 KGLQTELDVVEGMQFDRGFLSPYFITNSDKMVAELDNPLILLCEKKLSNLQSIVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS R L IIAE+VEG+ALATLVVN++R GL V+AVKAP FGDRRK +L DIA + G T+
Sbjct: 241 VQSSRSLLIIAEEVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKAMLEDIAILTGGTL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   I DLGS KK+ + KD+TTIV G G    IE R   I+K IE++ SDY
Sbjct: 301 ISEDLGIKLENVKINDLGSCKKIKVDKDNTTIVDGAGKKGDIEARCGSIRKQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+ATRAA +EG+V GGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGVVTGGGCALL 420

Query: 421 RAAQA---LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYG 477
            A++    L VKGD  DQ AG+EIV+KAL  P RQII NAG ++ ++V K+ E K  + G
Sbjct: 421 YASETLDNLKVKGD--DQKAGVEIVKKALQAPIRQIISNAGVDASVVVGKLLEGKKGSNG 478

Query: 478 YNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           Y+AQ   + DMF+ GIIDP KVVR ALQ A S+A +++ TEA++ D P D+
Sbjct: 479 YDAQSEEYCDMFQKGIIDPTKVVRTALQDAASIASLLITTEAMIADKPDDK 529


>gi|16272487|ref|NP_438701.1| chaperonin GroEL [Haemophilus influenzae Rd KW20]
 gi|1168916|sp|P43733|CH60_HAEIN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|1573528|gb|AAC22201.1| heat shock protein (groEL) [Haemophilus influenzae Rd KW20]
          Length = 548

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRHVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|126725847|ref|ZP_01741689.1| chaperonin GroEL [Rhodobacterales bacterium HTCC2150]
 gi|126705051|gb|EBA04142.1| chaperonin GroEL [Rhodobacterales bacterium HTCC2150]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 305/526 (57%), Positives = 405/526 (76%), Gaps = 1/526 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K GT AR  +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGTDARTRMLQGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDTAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA   VV+ +K+  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATANVVDAIKSASRPVNDSAEVAQVGTISANGEAEIGNQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ E+M A++E+  IL+++KK+S+LQP++P+LE+A
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNPEKMIADLEDCMILLHEKKLSSLQPMVPLLEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 MQSGKPLMIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AK V ++KD+TTIV GNG    IE R+ +I++ IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGTAKNVTITKDETTIVDGNGEKAEIEARVAQIRQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ LS V G+N DQ AG+ IVR+AL  P RQI +NAG +  ++  KI+ES   ++G+N
Sbjct: 421 QAAKGLSAVTGENSDQDAGVAIVRRALEAPLRQIAENAGVDGAVVAGKIRESDDTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAP 525
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVCRTALEDAASIAGLLITTEAMVGDKP 526


>gi|83950579|ref|ZP_00959312.1| chaperonin GroEL [Roseovarius nubinhibens ISM]
 gi|83838478|gb|EAP77774.1| chaperonin GroEL [Roseovarius nubinhibens ISM]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATSKVVEAIKAAARDVTDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  ++G N DQ AGI IVR+A+  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QAGKSLDGLEGANADQNAGIAIVRRAIEAPLRQIAENAGVDGAVVAGKVRESSDLSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPAKE 529


>gi|92114282|ref|YP_574210.1| chaperonin GroEL [Chromohalobacter salexigens DSM 3043]
 gi|119366234|sp|Q1QVJ7|CH60_CHRSD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|91797372|gb|ABE59511.1| chaperonin GroEL [Chromohalobacter salexigens DSM 3043]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/531 (56%), Positives = 396/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK IK    AR  +A GVN LA+AVK TLGPKGR V++  SFG+P VTKDGV+VAK I
Sbjct: 1   MAAKQIKFSDDARKRMARGVNVLADAVKVTLGPKGRNVVLEKSFGSPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K VTAG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVTEGMKGVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ +++        + I QV TISANGD+ IGE IA AM+++G  G+IT+D+ 
Sbjct: 121 DQAVDAAVKEIQSLSVPCTDAKAIAQVGTISANGDKRIGEIIADAMQKVGKEGVITVDEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYFVT+ + M  E+E+PY+L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 RGFEDELEVVEGMQFDRGYLSPYFVTNQDTMMVELEDPYLLMVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL IIAED+EG+ALATLVVN +R  +   A KAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKSGKPLGIIAEDIEGEALATLVVNTMRGIVKAAATKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE+A +  LGSAK+V MSK++TTI+ G G    IE R+++I+  IEDT SDY
Sbjct: 301 ISEEVGLTLEQANLDHLGSAKRVTMSKENTTIIDGAGVEADIEARVSQIRAQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L +TRAA +EG+VPGGG ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGAATEFEMKEKKARVEDALHSTRAAVEEGVVPGGGTALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R    L  +KGDNEDQ  GI I  +A+  P RQI+ NAG E+ +IV++++  +  NYGYN
Sbjct: 421 RILNKLVDLKGDNEDQTHGIAIALRAMEAPLRQIVTNAGQEASVIVNQVKAGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GD+F+MG++DP KV R+ALQSAGS+AG+M+ TEA++ D P ++ A
Sbjct: 480 AQTGEYGDLFDMGVLDPAKVTRSALQSAGSVAGLMITTEAMIADDPDEKEA 530


>gi|219872090|ref|YP_002476465.1| chaperonin GroEL (HSP60 family) [Haemophilus parasuis SH0165]
 gi|254813891|sp|B8F865|CH60_HAEPS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|219692294|gb|ACL33517.1| chaperonin GroEL (HSP60 family) [Haemophilus parasuis SH0165]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 397/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  +FGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK+  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVEELKSLSKPCETSKEIEQVGTISANSDSTVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYIL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKATI +LG AK+VV+SKD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATIEELGQAKRVVISKDNTTIIDGVGDEVQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGI+ GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIIAGGGVALV 420

Query: 421 RAAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA  ++  VKGDNE+Q  GI +  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVADVVKGDNEEQNVGIRLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PK+E A
Sbjct: 480 NAATEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMVTDLPKEEKA 531


>gi|145635376|ref|ZP_01791078.1| chaperonin GroEL [Haemophilus influenzae PittAA]
 gi|145267382|gb|EDK07384.1| chaperonin GroEL [Haemophilus influenzae PittAA]
          Length = 545

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|145628924|ref|ZP_01784724.1| chaperonin GroEL [Haemophilus influenzae 22.1-21]
 gi|145638547|ref|ZP_01794156.1| chaperonin GroEL [Haemophilus influenzae PittII]
 gi|145640516|ref|ZP_01796100.1| chaperonin GroEL [Haemophilus influenzae R3021]
 gi|148825183|ref|YP_001289936.1| chaperonin GroEL [Haemophilus influenzae PittEE]
 gi|229844298|ref|ZP_04464438.1| chaperonin GroEL [Haemophilus influenzae 6P18H1]
 gi|229846626|ref|ZP_04466734.1| chaperonin GroEL [Haemophilus influenzae 7P49H1]
 gi|260580990|ref|ZP_05848813.1| chaperonin GroL [Haemophilus influenzae RdAW]
 gi|319775536|ref|YP_004138024.1| 60 kDa chaperonin [Haemophilus influenzae F3047]
 gi|329122421|ref|ZP_08251008.1| chaperone GroEL [Haemophilus aegyptius ATCC 11116]
 gi|166198464|sp|A5U9V2|CH60_HAEIE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|144979394|gb|EDJ89080.1| chaperonin GroEL [Haemophilus influenzae 22.1-21]
 gi|145272142|gb|EDK12050.1| chaperonin GroEL [Haemophilus influenzae PittII]
 gi|145275102|gb|EDK14964.1| chaperonin GroEL [Haemophilus influenzae 22.4-21]
 gi|148715343|gb|ABQ97553.1| chaperonin GroEL [Haemophilus influenzae PittEE]
 gi|229810719|gb|EEP46437.1| chaperonin GroEL [Haemophilus influenzae 7P49H1]
 gi|229812547|gb|EEP48236.1| chaperonin GroEL [Haemophilus influenzae 6P18H1]
 gi|260092349|gb|EEW76289.1| chaperonin GroL [Haemophilus influenzae RdAW]
 gi|301169258|emb|CBW28855.1| Cpn60 chaperonin GroEL, large subunit of GroESL [Haemophilus
           influenzae 10810]
 gi|309750051|gb|ADO80035.1| GroEL, chaperone Hsp60 [Haemophilus influenzae R2866]
 gi|317450127|emb|CBY86341.1| 60 kDa chaperonin [Haemophilus influenzae F3047]
 gi|327473703|gb|EGF19122.1| chaperone GroEL [Haemophilus aegyptius ATCC 11116]
          Length = 548

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|309972306|gb|ADO95507.1| GroEL, chaperone Hsp60 [Haemophilus influenzae R2846]
          Length = 551

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|78063463|ref|YP_373371.1| chaperonin GroEL [Burkholderia sp. 383]
 gi|119366174|sp|Q391Y9|CH601_BURS3 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|77971348|gb|ABB12727.1| Chaperonin Cpn60/GroEL [Burkholderia sp. 383]
          Length = 546

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 294/528 (55%), Positives = 399/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDVARAKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   +   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVAAAVDELKKISRPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  I++  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  ++G N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  + N+GYN
Sbjct: 421 RVRQAIRELQGVNADQNAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ  V+GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGVYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFEAPKD 527


>gi|999194|gb|AAB34346.1| GroEL [Pseudomonas aeruginosa]
          Length = 547

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 398/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLVKDVASRPTDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATVAIVAQLKELAKPCADTKAIAQVGTISANSDESIGQIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   + M AE+++P +L+ DKKIS ++ +LP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K IE+T SDY
Sbjct: 301 ISEEVGLSLEGATLEHLGNAKRVVINKENTTIIDGAGVQADIEARVLQIRKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK   +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKAPVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +KGDNE+Q  GI ++R+A+  P RQI+ NAGDE  ++V K+++  + NYG+N
Sbjct: 421 RALQAIEGLKGDNEEQNVGIALLRRAVESPVRQIVANAGDEPSVVVDKVKQG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G+M+ TEA+V +  +D+ A
Sbjct: 480 AATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEIVEDKPA 530


>gi|88811316|ref|ZP_01126571.1| Chaperonin Cpn60/TCP-1 [Nitrococcus mobilis Nb-231]
 gi|88791205|gb|EAR22317.1| Chaperonin Cpn60/TCP-1 [Nitrococcus mobilis Nb-231]
          Length = 548

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/529 (55%), Positives = 399/529 (75%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR  +  GVN LA AVK TLGP+GR V++  SFG+P +TKDGV+VAK I
Sbjct: 1   MAAKDVRFSDDARHRMIAGVNILANAVKVTLGPRGRNVVLEKSFGSPTMTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASQTSDKAGDGTTTATVLAQAILREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
             AV   VE LK   K   +   I QV TISAN +  IGE IA AM+++G  G+IT+++ 
Sbjct: 121 SKAVNAAVEELKKLSKPCDTDLSIAQVGTISANAESAIGEIIADAMKKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+T+ + M+AE+++P+IL+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELEVVEGMQFDRGYLSPYFITNQQNMSAELDDPFILLCDKKISNIRELLPLLENV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S RPL I++EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKSSRPLLIVSEDVEGEALATLVVNTIRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LEKA++ DLGSAKKV ++K++TTIVGGNG +E I+GR+ +I+K IE+  SDY
Sbjct: 301 ISEEIGLTLEKASLDDLGSAKKVNVTKENTTIVGGNGRNEDIKGRVEQIRKQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  + L  +KGDN DQ  G+ IVR+A+  P R ++ NAG+++ ++V+K++E +  NYGYN
Sbjct: 421 RVQKGLDGLKGDNHDQEVGVGIVRRAIEEPLRILVTNAGEDAAVVVNKVREGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
            Q   +GD+  MGI+DP KV R+ALQ+A S+AG+M+ TEA+V + PK+E
Sbjct: 480 VQTGEYGDLVSMGILDPTKVARSALQNAASIAGLMITTEAMVAEHPKEE 528


>gi|325983085|ref|YP_004295487.1| chaperonin GroEL [Nitrosomonas sp. AL212]
 gi|325532604|gb|ADZ27325.1| chaperonin GroEL [Nitrosomonas sp. AL212]
          Length = 549

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/529 (55%), Positives = 398/529 (75%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G +AR  +  GVN LA+AVK TLGPKGR V++  S+GAP +TKDGV+VAK I
Sbjct: 1   MSAKEVKFGDSARHRMVAGVNILADAVKVTLGPKGRNVVLDRSYGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLKEVASKTSDVAGDGTTTATVLAQAIVKEGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K   + +EI QV +ISAN D EIG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTTAVGELKKLSKPCATAKEIAQVGSISANSDNEIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV+S E+  A ++NPYIL++DKKIS ++ LLPILE  
Sbjct: 181 SGLQNELEVVEGMQFDRGYLSPYFVSSAEKQIALLDNPYILLHDKKISNIRDLLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDV+G+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++TTI+ G G ++ IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRIEVGKENTTIIDGAGNADNIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGVIPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S KGDN DQ AGI+IV +AL  P RQI+ N GDE  ++V+K+ E +  N+GYN
Sbjct: 421 RAISAVKSTKGDNHDQDAGIKIVLRALEEPLRQIVTNCGDEPSVVVNKVAEGQ-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A  S +GD+  MG++DP KV R+ALQ+A S+A +ML T+A+V + PK++
Sbjct: 480 AATSEYGDLVAMGVLDPTKVTRSALQNAASVASLMLTTDAMVAELPKED 528


>gi|294666065|ref|ZP_06731325.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292604166|gb|EFF47557.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 546

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/537 (55%), Positives = 399/537 (74%), Gaps = 4/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  + NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    FGDM + GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P +PA
Sbjct: 480 AANGEFGDMVQFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKD--EPALPA 534


>gi|260462987|ref|ZP_05811190.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|259031108|gb|EEW32381.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
          Length = 537

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 309/540 (57%), Positives = 399/540 (73%), Gaps = 5/540 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+IK  T ARD +  GV  L  AVK TLGPKGR V+I  ++GAPR+TKDGVTVAK I
Sbjct: 1   MSAKEIKFATDARDRMLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LA +I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGAKLVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  +KA  KKV S  EI QV TI+ANGD  +G  IA AM+++G  G+IT+++A
Sbjct: 121 DQAVAAVVVEIKAKAKKVKSSAEIAQVGTIAANGDASVGAMIAKAMDKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E PY+LI++KK+  LQ +LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNADKMRAELEEPYVLIHEKKLGNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AK+V++ KD TTIV G G    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIEMLGRAKRVLIEKDTTTIVDGAGTKATIQARVAQIKGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV+ VG VTE+ + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLSGGVAVIRVGGVTESEVKEKKDRIDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  ALS + G N D  AGI IV +AL  P RQI +N+G E  ++V K+ +SK  N G++
Sbjct: 421 RAKSALSGLNGANADVTAGISIVLRALEAPIRQIAENSGVEGSIVVGKLADSKDHNQGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GI+DP KVVR ALQ AGS+A +++  EA++ D P  + A    PAGGG
Sbjct: 481 AQNETYVDMIKAGIVDPAKVVRTALQDAGSIAALLITAEAMITDVPPKDAA----PAGGG 536


>gi|152980643|ref|YP_001354342.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille]
 gi|166198468|sp|A6T1E5|CH60_JANMA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|151280720|gb|ABR89130.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille]
          Length = 548

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/530 (55%), Positives = 395/530 (74%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++  G AAR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE L A  K   + +EI QV +ISAN D  IGE+IA AME++G  G+IT++  
Sbjct: 121 DKAVAATVEQLAAIAKPCTTTKEIAQVGSISANSDASIGERIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + E+ TA +ENP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 KSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAED+EG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++EE+GL LEK T+ +LG AK++ + K++TT++ GNG +  IE R+ +I+  IE+  SDY
Sbjct: 301 VAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAVTIEARVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  A+ +KGDN DQ AGI IV +A+  P R I++NAG+E+ ++V+K+ E K  N+GYNA
Sbjct: 421 RARAAIKIKGDNPDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGK-GNFGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               +GDM EMG++DP KV R+ALQ+A S+A ++L T+ +V +  +D+ A
Sbjct: 480 ANGTYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEDKAA 529


>gi|330819915|ref|YP_004348777.1| Chaperonin GroEL2 [Burkholderia gladioli BSR3]
 gi|327371910|gb|AEA63265.1| Chaperonin GroEL2 [Burkholderia gladioli BSR3]
          Length = 540

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/533 (56%), Positives = 398/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I   FGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERGFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + + +EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVGAVLDELRKLSKPISTNKEIAQVGSISANSDEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKISA++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINDPEKQAAYLDDALILLHDKKISAIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE G +LEKAT+ DLG AK+V + K+DT I+ G G ++RIE R+ +I+  IEDT SDY
Sbjct: 301 IAEETGKQLEKATLEDLGRAKRVEIRKEDTIIIDGAGEAKRIEARVKQIRAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L S+KG N +Q AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GY+
Sbjct: 421 RARAGLSSLKGANAEQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKDE A P
Sbjct: 480 AASGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKDEKAVP 532


>gi|27382090|ref|NP_773619.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|543995|sp|P35861|CH602_BRAJA RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|312979|emb|CAA80318.1| GroEL2 [Bradyrhizobium japonicum]
 gi|27355260|dbj|BAC52244.1| chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 550

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 403/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV+ L  AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFGVDARDRMLRGVDILHNAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D++GDGTTTAT LA AI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VV  L  N KKV S EEI QV TISANGD EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DMAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDAEIGKFISDAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E+++ Y+LI +KK+S L  LLP+LE+ 
Sbjct: 181 KSLETELEVVEGMQFDRGYISPYFVTNADKMRVEMDDAYVLINEKKLSQLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVSGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  ++  N+DQ  G+EIVRKALSYP RQI  NAG++  +IV KI E    +YGY+
Sbjct: 421 RASEHLKGIRTKNDDQKTGVEIVRKALSYPARQIAINAGEDGSVIVGKILEKDQYSYGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           +Q   +G++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK  T +
Sbjct: 481 SQTGEYGNLVSKGIIDPTKVVRVAIQNAASVAALLITTEAMVAEVPKKNTGA 532


>gi|68249140|ref|YP_248252.1| chaperonin GroEL [Haemophilus influenzae 86-028NP]
 gi|81336454|sp|Q4QN05|CH60_HAEI8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|68057339|gb|AAX87592.1| 60 kDa chaperonin [Haemophilus influenzae 86-028NP]
          Length = 545

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ N+G+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNSGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|288940591|ref|YP_003442831.1| chaperonin GroEL [Allochromatium vinosum DSM 180]
 gi|288895963|gb|ADC61799.1| chaperonin GroEL [Allochromatium vinosum DSM 180]
          Length = 543

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 302/539 (56%), Positives = 401/539 (74%), Gaps = 3/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  GV+ LA AVK TLGPKGR V+I  S+GAP VTKDGV+VAK+I
Sbjct: 1   MAAKQIFFSENARVRMLRGVDVLANAVKVTLGPKGRNVVIEKSWGAPTVTKDGVSVAKAI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQA+  EG K V AG+NPMDIKRG+
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAMVREGLKSVAAGMNPMDIKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  ++ L+A  +   + +EI QV TISAN D  IG  IA AME++G  G+IT+++ 
Sbjct: 121 DQAVEAAIKELQALSRPCSTNKEIAQVGTISANSDDSIGNIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + +    E+++P+IL+YDKKIS ++ LLP+LE  
Sbjct: 181 KSLHNELDLVEGMQFDRGYLSPYFINNQQSQKTELDDPFILLYDKKISNIRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKAGKPLLILAEDIEGEALATLVVNTLRGILKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKAT+ DLG+AK+V + KDDTTI+ G G  + I+ R  +I+  +E+T SDY
Sbjct: 301 ISEEVGLSLEKATLNDLGTAKRVQVGKDDTTIIDGAGSHDDIKARCEQIRAQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEIEMKEKKMRVEDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG N+DQ  GI I R+A+  P RQI+ NAG+E  +I++ + +  + ++GYN
Sbjct: 421 RALTAIKDLKGANDDQTVGITIARRAMEEPLRQIVANAGEEPSVILNTVADG-SGSFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           A    FGDM EMG+IDP KV R+ALQ+A S+AG+M+ TEA+V D PK E AS   PAGG
Sbjct: 480 AANGEFGDMMEMGVIDPTKVTRSALQNACSVAGLMITTEAMVADEPKKEKASAA-PAGG 537


>gi|40714530|dbj|BAD06926.1| molecular chaperone GroEL [Ralstonia pickettii]
          Length = 544

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVIFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRR  +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRNGMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAGAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PK+E+A
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKEESA 530


>gi|77359226|ref|YP_338801.1| chaperonin GroEL [Pseudoalteromonas haloplanktis TAC125]
 gi|84028187|sp|Q9XAU7|CH60_PSEHT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|76874137|emb|CAI85358.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 547

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/532 (55%), Positives = 403/532 (75%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++     AR  +  GVN LA AVK TLGPKGR V++  SFG+P +TKDGV+VAK I
Sbjct: 1   MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPH-GIITIDQ 179
           D AV   V  LKA        + I QV TISAN D+EIG+ IA AME++G + G+IT+++
Sbjct: 121 DKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIAQAMEKVGRNSGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
            ++   E+ VV+GMQ DRGY+SPYF+ S E+ T E++NP+IL+ DKKIS ++ LLP LE+
Sbjct: 181 GQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFILLVDKKISNIRELLPTLEA 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             ++ +PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G T
Sbjct: 241 VAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAVLTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEEIGL+LEKAT+ DLG+AK+V+++KDDTTI+ G G    I GR+++I+  IE+  SD
Sbjct: 301 VISEEIGLELEKATVEDLGTAKRVIITKDDTTIIDGAGEEAGINGRVSQIKAQIEEATSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YD++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L+ATRAA +EG+VPGGG+AL
Sbjct: 361 YDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVEDALNATRAAVEEGVVPGGGVAL 420

Query: 420 VRAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRAA  L  + GDNEDQ  GI++  +A+  P RQI+ NAGDE+ ++++ ++ + + N+GY
Sbjct: 421 VRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTNAGDEASVVINAVK-AGSGNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    + DM EMGI+DP KV R+ALQ AGS+AG+M+ TEA+V + PKD++A
Sbjct: 480 NAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMITTEAMVAEIPKDDSA 531


>gi|260549237|ref|ZP_05823457.1| chaperonin GroL [Acinetobacter sp. RUH2624]
 gi|260407643|gb|EEX01116.1| chaperonin GroL [Acinetobacter sp. RUH2624]
          Length = 544

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 403/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ +++ +  N+GYN
Sbjct: 421 RAVNALEGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKKGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|172065373|ref|YP_001816085.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
 gi|171997615|gb|ACB68532.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
          Length = 540

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/537 (56%), Positives = 399/537 (74%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLGSAK+V + K+DT I+ G G  ERIE R+  I+  IE+T SDY
Sbjct: 301 ISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE  + Q PA
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPA-QAPA 535


>gi|165976437|ref|YP_001652030.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|190150338|ref|YP_001968863.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|303251055|ref|ZP_07337241.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|303253645|ref|ZP_07339783.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307245922|ref|ZP_07528005.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307248055|ref|ZP_07530084.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307250260|ref|ZP_07532214.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|307252648|ref|ZP_07534541.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307257058|ref|ZP_07538833.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|307263679|ref|ZP_07545288.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|226704076|sp|B3H1P4|CH60_ACTP7 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704077|sp|B0BPV1|CH60_ACTPJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|165876538|gb|ABY69586.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|189915469|gb|ACE61721.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|302647565|gb|EFL77783.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|302650065|gb|EFL80235.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306853141|gb|EFM85363.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306855453|gb|EFM87627.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306857701|gb|EFM89803.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|306859893|gb|EFM91913.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306864429|gb|EFM96337.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306870992|gb|EFN02727.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 547

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/534 (55%), Positives = 399/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYI++ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ +LG AK+VV++KD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATLEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++ GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVATTLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PK+E   P
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKEEKLDP 533


>gi|154251066|ref|YP_001411890.1| chaperonin GroEL [Parvibaculum lavamentivorans DS-1]
 gi|187470763|sp|A7HQQ0|CH60_PARL1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|154155016|gb|ABS62233.1| chaperonin GroEL [Parvibaculum lavamentivorans DS-1]
          Length = 550

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/525 (57%), Positives = 405/525 (77%), Gaps = 1/525 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFG+PR TKDGVTVAK I  
Sbjct: 2   AKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGSPRTTKDGVTVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+++VA+ T D++GDGTTTAT L QAI  EG K V AG+NPMD+KRGI++
Sbjct: 62  EDKFENMGAQMVKEVASKTNDTAGDGTTTATVLTQAIVREGAKSVAAGMNPMDLKRGIEI 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV+  VE +    KKV S +E+ QV TISANG+ EIG  IA AM ++G  G+IT+++AK+
Sbjct: 122 AVRTAVEDITKRSKKVKSNDEVAQVGTISANGESEIGAMIAQAMSRVGNEGVITVEEAKS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             TE+ VV+GMQ DRGY+SPYF+T+ ++M  E++ P IL+++KK+++LQP+LP+LE+  Q
Sbjct: 182 LDTELDVVEGMQFDRGYLSPYFITNADKMVVELDEPLILLHEKKLTSLQPMLPVLEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           SGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A + G  VIS
Sbjct: 242 SGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDLAVLSGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           E++G+KLE  T+  LG AK+V ++KDDTTIV G G  + IE R+ +I++ IEDT SDYD+
Sbjct: 302 EDLGIKLESVTLDMLGKAKRVSITKDDTTIVDGAGKKKDIEARVAQIKRQIEDTTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV++VG  TEA + E+KDR  D+L+ATRAA +EGIVPGGG AL+ A
Sbjct: 362 EKLQERLAKLAGGVAVIKVGGATEAEVKERKDRVDDALNATRAAVEEGIVPGGGTALLMA 421

Query: 423 AQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           ++A+  +  DN D  AGI I+R+AL  P RQI++NAG E  ++V K+ ESK AN+G++AQ
Sbjct: 422 SKAVGKLVEDNRDIQAGINIIRRALEAPIRQIVENAGVEGSIVVQKVLESKQANFGFDAQ 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           K  + D+   GIIDP KVVR ALQ A S+AG+++ TEA++ DAPK
Sbjct: 482 KEEYCDLVAAGIIDPTKVVRTALQDAASIAGLLITTEAMIADAPK 526


>gi|307254896|ref|ZP_07536718.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259336|ref|ZP_07541063.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|306862137|gb|EFM94109.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866572|gb|EFM98433.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 547

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/534 (55%), Positives = 399/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYI++ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ +LG AK+VV++KD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATLEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++ GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVAATLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PK+E   P
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKEEKLDP 533


>gi|326798181|ref|YP_004316000.1| 60 kDa chaperonin [Sphingobacterium sp. 21]
 gi|326548945|gb|ADZ77330.1| 60 kDa chaperonin [Sphingobacterium sp. 21]
          Length = 545

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 304/528 (57%), Positives = 392/528 (74%), Gaps = 3/528 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           +K +K    ARDA+  GV+ LA AVK TLGPKGR VII   FG+P +TKDGVTVAK I  
Sbjct: 2   SKQVKYNVEARDALKKGVDILANAVKVTLGPKGRNVIIEKKFGSPAITKDGVTVAKEIDL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           K+    +GA+M+++VA+ T D +GDGTTTAT LAQAI   G K V AG NPMD+KRGID 
Sbjct: 62  KDALENMGAQMVKEVASKTADQAGDGTTTATVLAQAIVTAGIKNVAAGANPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGS-REEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           AV  +VE LKA  + VG    +I QVATISAN D  IGE IA AME++G  G+IT+++AK
Sbjct: 122 AVATIVENLKAQSQTVGEDNSKIKQVATISANNDEVIGELIAEAMEKVGKDGVITVEEAK 181

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TEV+ V+GMQ DRGY+SPYF T+TE+M AE+ENPYILIYDKKIS ++ LLPILE   
Sbjct: 182 GTETEVKTVEGMQFDRGYLSPYFATNTEKMEAELENPYILIYDKKISNMKELLPILEKQV 241

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAED++G+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TVI
Sbjct: 242 QTGKPLLIIAEDLDGEALATLVVNKIRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGTVI 301

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE G KLE A ++ LG A+KVV+ KD+TTI+ G+G  E I+GR+N+I+  IE T SDYD
Sbjct: 302 SEERGYKLENADLSYLGQAEKVVVDKDNTTIINGSGEVETIKGRVNQIKAQIETTTSDYD 361

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAVL VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+A +R
Sbjct: 362 REKLQERLAKLAGGVAVLYVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVAFIR 421

Query: 422 AAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A ++L ++KG++ED+  GI I+++A+  P R I  NAG E  ++V K++E  + ++GYNA
Sbjct: 422 AIESLENLKGESEDETTGINIIKRAIEEPLRTICNNAGVEGSIVVQKVKEG-SGDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           +   + ++   G+IDP KV R AL++A S+A M+L TE V+ D P+DE
Sbjct: 481 RFDRYENLISAGVIDPTKVSRVALENAASIASMLLTTECVLADEPEDE 528


>gi|184159228|ref|YP_001847567.1| chaperonin GroEL [Acinetobacter baumannii ACICU]
 gi|226704071|sp|B2HXB6|CH60_ACIBC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|183210822|gb|ACC58220.1| Chaperonin GroEL (HSP60 family) [Acinetobacter baumannii ACICU]
          Length = 547

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 402/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNALEGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKNGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|169632653|ref|YP_001706389.1| chaperonin GroEL [Acinetobacter baumannii SDF]
 gi|226704072|sp|B0VSP5|CH60_ACIBS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|169151445|emb|CAP00185.1| chaperone Hsp60, peptide-dependent ATPase, heat shock protein
           [Acinetobacter baumannii]
          Length = 541

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 402/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNALEGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKNGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|169794986|ref|YP_001712779.1| chaperonin GroEL [Acinetobacter baumannii AYE]
 gi|213158349|ref|YP_002320400.1| chaperonin GroL [Acinetobacter baumannii AB0057]
 gi|215482536|ref|YP_002324726.1| chaperonin GroL [Acinetobacter baumannii AB307-0294]
 gi|239503402|ref|ZP_04662712.1| chaperonin GroEL [Acinetobacter baumannii AB900]
 gi|260556468|ref|ZP_05828686.1| chaperonin GroL [Acinetobacter baumannii ATCC 19606]
 gi|301511908|ref|ZP_07237145.1| chaperonin GroEL [Acinetobacter baumannii AB058]
 gi|301597052|ref|ZP_07242060.1| chaperonin GroEL [Acinetobacter baumannii AB059]
 gi|332855905|ref|ZP_08436079.1| chaperonin GroL [Acinetobacter baumannii 6013150]
 gi|332867132|ref|ZP_08437411.1| chaperonin GroL [Acinetobacter baumannii 6013113]
 gi|332876176|ref|ZP_08443955.1| chaperonin GroL [Acinetobacter baumannii 6014059]
 gi|226704069|sp|B7GY36|CH60_ACIB3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704070|sp|B7I618|CH60_ACIB5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704073|sp|B0VDR6|CH60_ACIBY RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704107|sp|A3M836|CH60_ACIBT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|169147913|emb|CAM85776.1| chaperone Hsp60, peptide-dependent ATPase, heat shock protein
           [Acinetobacter baumannii AYE]
 gi|193078137|gb|ABO13080.2| chaperone Hsp60 [Acinetobacter baumannii ATCC 17978]
 gi|213057509|gb|ACJ42411.1| chaperonin GroL [Acinetobacter baumannii AB0057]
 gi|213986861|gb|ACJ57160.1| chaperonin GroL [Acinetobacter baumannii AB307-0294]
 gi|260409727|gb|EEX03027.1| chaperonin GroL [Acinetobacter baumannii ATCC 19606]
 gi|322509142|gb|ADX04596.1| groEL [Acinetobacter baumannii 1656-2]
 gi|323519170|gb|ADX93551.1| chaperonin GroEL [Acinetobacter baumannii TCDC-AB0715]
 gi|332727224|gb|EGJ58673.1| chaperonin GroL [Acinetobacter baumannii 6013150]
 gi|332734205|gb|EGJ65335.1| chaperonin GroL [Acinetobacter baumannii 6013113]
 gi|332735610|gb|EGJ66658.1| chaperonin GroL [Acinetobacter baumannii 6014059]
          Length = 544

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 402/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNALEGLKGANEDQTAGINILRRAIEAPLRQIVANAGDEPSVVINAVKNGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|145637416|ref|ZP_01793075.1| chaperonin GroEL [Haemophilus influenzae PittHH]
 gi|145269362|gb|EDK09306.1| chaperonin GroEL [Haemophilus influenzae PittHH]
          Length = 548

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA KD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAVKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +  +TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTASTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S+KGDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|115361133|ref|YP_778270.1| chaperonin GroEL [Burkholderia ambifaria AMMD]
 gi|122319442|sp|Q0B1N7|CH603_BURCM RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|115286461|gb|ABI91936.1| chaperonin GroEL [Burkholderia ambifaria AMMD]
          Length = 540

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/537 (56%), Positives = 399/537 (74%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLGSAK+V + K+DT I+ G G  ERIE R+  I+  I++T SDY
Sbjct: 301 ISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE  + Q PA
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPA-QAPA 535


>gi|307261496|ref|ZP_07543165.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306868779|gb|EFN00587.1| 60 kDa chaperonin [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
          Length = 547

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/534 (55%), Positives = 399/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYI++ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ +LG AK+VV++KD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATLEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++ GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVAATLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PK+E   P
Sbjct: 480 NAGTEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMITDLPKEEKLDP 533


>gi|167855908|ref|ZP_02478658.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
 gi|167852996|gb|EDS24260.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
          Length = 547

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 396/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  +FGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK+  K     +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVEELKSLSKPCEMSKEIEQVGTISANSDSTVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYIL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYILLVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKATI +LG AK+VV+SKD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATIEELGQAKRVVISKDNTTIIDGVGDEVQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGI+ GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIIAGGGVALV 420

Query: 421 RAAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA  ++  VKGDNE+Q  GI +  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVADVVKGDNEEQNVGIRLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PK+E A
Sbjct: 480 NAATEQYGDMLEMGILDPTKVTRSALQFAASIAGLMITTECMVTDLPKEEKA 531


>gi|91786661|ref|YP_547613.1| chaperonin GroEL [Polaromonas sp. JS666]
 gi|118597119|sp|Q12FH7|CH60_POLSJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|91695886|gb|ABE42715.1| chaperonin GroEL [Polaromonas sp. JS666]
          Length = 550

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/530 (55%), Positives = 397/530 (74%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVIFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDIAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVEELKKASKATTTSKEIAQVGSISANSDEAIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  +E+ VV+GMQ DRGY+SPYF+ + E+ +A ++NP++L+YDKKIS ++ LLP LE  
Sbjct: 181 KSLESELDVVEGMQFDRGYLSPYFINNPEKQSAILDNPFVLLYDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTLRGILKVVAVKAPGFGDRRKAMLEDIACLTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+G+ LEK T+ADLG+AK++ + K++T I+ G G ++ IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGMSLEKVTLADLGTAKRIEVGKENTIIIDGAGEAKDIEARVKQVRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA  ++KGDN DQ AGI++V +A+  P R+I+ NAG E+ ++V+ +   K  NYG+N
Sbjct: 421 RAKQAAGAIKGDNADQEAGIKLVLRAIEAPLREIVYNAGGEASVVVNAVLAGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A    +GDM EMGI+DP KV R ALQ+A S+A +ML TEA+V +APKDE+
Sbjct: 480 AANDTYGDMIEMGILDPTKVTRTALQNAASVASLMLTTEAMVAEAPKDES 529


>gi|167590159|ref|ZP_02382547.1| chaperonin GroEL [Burkholderia ubonensis Bu]
          Length = 547

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/530 (55%), Positives = 397/530 (74%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDVARAKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVAAAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRELLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G +  IE R+ +I+  I++  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAASIEARVKQIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  + G N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+ E  + N+GYN
Sbjct: 421 RVKQAIRELTGANADQHAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APK+ T
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVHEAPKEAT 529


>gi|292490325|ref|YP_003525764.1| chaperonin GroEL [Nitrosococcus halophilus Nc4]
 gi|291578920|gb|ADE13377.1| chaperonin GroEL [Nitrosococcus halophilus Nc4]
          Length = 549

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/533 (55%), Positives = 396/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR  + +GVN LAEAV+ TLGP+GR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVRFSEDARHRMIHGVNILAEAVRVTLGPRGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASQTSDEAGDGTTTATVLAQSILREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K     + I QV TISAN +  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVVSAVGALKKLSKPCEDSKAIGQVGTISANAEESVGKIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+T  + M AE+++PYILI+DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELEVVEGMQFDRGYLSPYFITDQQTMAAELDDPYILIHDKKISNIRELLPVLENV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL +I+EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGKPLLVISEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKAT+ DLG AKKV ++K++TTIV G G +E I+ R+ +I+  +E+  SDY
Sbjct: 301 ISEEVGLSLEKATLDDLGRAKKVSVNKENTTIVDGAGSAEDIKARVEQIRVQMEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEMEMKEKKARVEDALHATRAAVEEGVVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA Q +  +KG N DQ  GI I R+A+  P RQI+ NAG E+ +IV++++E +  NYGYN
Sbjct: 421 RALQGIQDLKGANHDQDVGINIARRAMEEPLRQIVTNAGAEASVIVNQVKEGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    FGDM  MGI+DP KV R ALQ+A S+AG+M+ TEA++ +APK+E   P
Sbjct: 480 AATGEFGDMIAMGILDPTKVSRTALQNAASIAGLMITTEAMIAEAPKEEEPVP 532


>gi|94502301|ref|ZP_01308779.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|161833791|ref|YP_001597987.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS]
 gi|293977902|ref|YP_003543332.1| chaperonin GroL [Candidatus Sulcia muelleri DMIN]
 gi|189082373|sp|A8Z640|CH60_SULMW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|94451140|gb|EAT14087.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|152206281|gb|ABS30591.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS]
 gi|292667833|gb|ADE35468.1| chaperonin GroL [Candidatus Sulcia muelleri DMIN]
          Length = 543

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 308/544 (56%), Positives = 400/544 (73%), Gaps = 4/544 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AK+I+    ARD +  GV+ LA AVK TLGPKGR V++  SFG P+VTKDGV+VAK I  
Sbjct: 2   AKNIQFDIEARDKLKKGVDALANAVKVTLGPKGRNVVLQKSFGGPQVTKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++    +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRGID 
Sbjct: 62  EDPIENLGAQMVKEVASKTNDIAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVG-SREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           AV+ VV  LK   ++VG S E+I QVA+ISAN D  IGE I+ A +++G  G+IT+++AK
Sbjct: 122 AVEAVVNDLKKQSREVGGSNEKIKQVASISANNDEAIGELISVAFDKVGKEGVITVEEAK 181

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T V VV+GMQ DRGY SPYFVT++++M  E +NPYIL+ DKKIS+++ LLPILE   
Sbjct: 182 GIETTVDVVEGMQFDRGYQSPYFVTNSDKMITEFDNPYILLSDKKISSMKDLLPILEPVA 241

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSG+PL II+E+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TVI
Sbjct: 242 QSGKPLLIISEEVEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVI 301

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE G KLE   ++ LG A++V + KD+TTIV GNG    IE R+N+I+  IE T SDYD
Sbjct: 302 SEETGSKLEDTKLSFLGKAERVTIDKDNTTIVNGNGKKSDIESRVNQIKAQIEKTTSDYD 361

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAVL VG  +E  + EKKDR  D+L ATRAA +EGIV GGG+ALVR
Sbjct: 362 KEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVR 421

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A ++L+ +K DN DQ  GI+IV+++L  P RQI+ NAG+E  +IV+K+ E K   +GY+A
Sbjct: 422 AIKSLNGLKVDNVDQDTGIKIVKRSLQEPLRQIVANAGEEGSVIVAKVAEGKN-EFGYDA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           +   + +M   GIIDP KV R AL++A S++GM+L TE V+ +  K+E A PQMP   GM
Sbjct: 481 KLGEYKNMISEGIIDPTKVTRVALENAASVSGMLLTTECVITEIKKEEPAMPQMP-NSGM 539

Query: 541 GGGM 544
           GG M
Sbjct: 540 GGMM 543


>gi|88860974|ref|ZP_01135609.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein)
           [Pseudoalteromonas tunicata D2]
 gi|88816902|gb|EAR26722.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein)
           [Pseudoalteromonas tunicata D2]
          Length = 547

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 396/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++     AR  +  GVN LA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MAAKEVLFAGEARGKMLVGVNILADAVKVTLGPKGRNVVIDKSFGSPIITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+   D++GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELTDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIG-PHGIITIDQ 179
           D AV   V  LKA        + I QV TISAN D EIGE IA AME++G   G+IT++ 
Sbjct: 121 DKAVIAAVAELKALSVPCADAKAIAQVGTISANSDTEIGEIIATAMEKVGRESGVITVED 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
            +   TE+ VV+GMQ DRGY+SPYF+ + E+   E++NPYIL+ DKKIS ++ LLP LE+
Sbjct: 181 GQALETELDVVEGMQFDRGYLSPYFINNAEKGAVELDNPYILLVDKKISNIRELLPTLEA 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             +SG+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G T
Sbjct: 241 VAKSGKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAVLTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEEIGL+LEKAT+ DLG+AK+VV++KDDTTI+ G G  + I GR+ +I+  IE+  SD
Sbjct: 301 VISEEIGLELEKATLEDLGTAKRVVITKDDTTIIDGAGEEDGIVGRVAQIKAQIEEATSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YD++KL+ER+AKL+GGVAV++VG  TE  + EKKDR  D+L ATRAA  EG+VPGGG+AL
Sbjct: 361 YDKEKLQERMAKLSGGVAVIKVGAATEIEMKEKKDRVDDALHATRAAVQEGVVPGGGVAL 420

Query: 420 VRAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRAA  L+ ++GDNEDQ  GI++  +A+  P RQI+ NAGDE+ ++V+ ++ +   N+GY
Sbjct: 421 VRAASKLADLRGDNEDQNHGIKVALRAMEAPLRQIVTNAGDEASVVVNAVK-AGAGNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    + DM EMGI+DP KV R+ALQ A S+AG+M+ TEA++ + PKD +A
Sbjct: 480 NAATGEYNDMIEMGILDPTKVTRSALQFAASIAGLMITTEAMIAEVPKDNSA 531


>gi|27364661|ref|NP_760189.1| chaperonin GroEL [Vibrio vulnificus CMCP6]
 gi|37681290|ref|NP_935899.1| chaperonin GroEL [Vibrio vulnificus YJ016]
 gi|320155056|ref|YP_004187435.1| heat shock protein 60 family chaperone GroEL [Vibrio vulnificus
           MO6-24/O]
 gi|28201775|sp|Q9ALA9|CH601_VIBVU RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|41016832|sp|Q7M7I7|CH601_VIBVY RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|27360806|gb|AAO09716.1| chaperonin GroL [Vibrio vulnificus CMCP6]
 gi|37200041|dbj|BAC95870.1| chaperonin GroEL [Vibrio vulnificus YJ016]
 gi|319930368|gb|ADV85232.1| heat shock protein 60 family chaperone GroEL [Vibrio vulnificus
           MO6-24/O]
          Length = 546

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/530 (55%), Positives = 396/530 (74%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M++ VA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFQNMGAQMVKQVASQANDVAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA  K   +  EI QV TISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVAAAVEELKALSKDCSTSTEIEQVGTISANSDSSVGKIIAEAMEKVGRDGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  + E+E+P+IL+ DKKIS ++ LLP LE+ 
Sbjct: 181 QALHDELDVVEGMQFDRGYLSPYFINNQESGSVELESPFILLVDKKISNIRELLPALEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL+LEKAT+ DLG AK+V ++K++TTI+ G G    I+GR+ +I++ IED  SDY
Sbjct: 301 ISEEVGLELEKATLEDLGQAKRVSITKENTTIIDGVGEEAMIQGRVAQIRQQIEDATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVAGGGVALI 420

Query: 421 RAA-QALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA + + ++GDNE+Q  GI +  +A+  P RQI KNAGDE  ++ + ++  +  +YGYN
Sbjct: 421 RAASKIVDLQGDNEEQNVGIRVALRAMEAPLRQITKNAGDEESVVANNVRAGE-GSYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A   V+GDM EMGI+DP KV R+ALQ A S+AG+M+ TEA+V D P+ ++
Sbjct: 480 AATGVYGDMLEMGILDPTKVTRSALQFAASVAGLMITTEAMVTDLPQKDS 529


>gi|309780747|ref|ZP_07675488.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
 gi|308920429|gb|EFP66085.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
          Length = 547

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/531 (55%), Positives = 391/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +S +KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++VSK+ E K  NYGYN
Sbjct: 421 RARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVSKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PKD+ A
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAELPKDDAA 530


>gi|145633505|ref|ZP_01789234.1| chaperonin GroEL [Haemophilus influenzae 3655]
 gi|144985874|gb|EDJ92482.1| chaperonin GroEL [Haemophilus influenzae 3655]
          Length = 548

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/532 (55%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK   K   + +EI QV TISAN D  +G+ I+ AME++G  G+IT++  
Sbjct: 121 DKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E++NPY+L+ DKKIS ++ LLP+LE  
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK++V++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRIVINKDNTTIIDGVGDESQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++KGDNE+Q  GI++  +A+  P RQI+ N+G+E+ ++ S ++  +  N+GY
Sbjct: 421 RAAAKVAANLKGDNEEQNVGIKLALRAMEAPLRQIVTNSGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE +V D PKD+ A
Sbjct: 480 NAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKA 531


>gi|262278078|ref|ZP_06055863.1| chaperonin GroL [Acinetobacter calcoaceticus RUH2202]
 gi|262258429|gb|EEY77162.1| chaperonin GroL [Acinetobacter calcoaceticus RUH2202]
          Length = 544

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/533 (55%), Positives = 400/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE ++ N K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVRTVVENIRLNSKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKI  ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKIGNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESSSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNALDGLKGINEDQTAGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKAAVP 532


>gi|52424514|ref|YP_087651.1| chaperonin GroEL [Mannheimia succiniciproducens MBEL55E]
 gi|59797700|sp|Q65VE4|CH60_MANSM RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|52306566|gb|AAU37066.1| GroL protein [Mannheimia succiniciproducens MBEL55E]
          Length = 547

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/530 (55%), Positives = 400/530 (75%), Gaps = 3/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVVTELKALSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E  T E+++P+IL+ DKKIS ++ LLP+LE+ 
Sbjct: 181 TGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDSPFILLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE++ SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVAGGGVALI 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A S++GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAASKAAASLQGDNEEQNVGIKLALRAMESPLRQIVANAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           NA    +GDM  MGI+DP KV R+ALQ A S+AG+M+ TEA+V + PKD+
Sbjct: 480 NAGTEQYGDMIAMGILDPTKVTRSALQFAASIAGLMITTEAMVTELPKDD 529


>gi|56552825|ref|YP_163664.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59802829|sp|P48220|CH60_ZYMMO RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|56544399|gb|AAV90553.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 546

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/529 (56%), Positives = 390/529 (73%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE L++  K V    E+ QV  ISANGD E+G +IA AME++G  G+IT+++A
Sbjct: 121 DLAATKVVESLRSRSKPVSDFNEVAQVGIISANGDEEVGRRIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M AE+ +PYILIY+KK+S LQ +LPILES 
Sbjct: 181 KGFDFELDVVEGMQFDRGYLSPYFITNPEKMVAELADPYILIYEKKLSNLQSILPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAK+V ++K++TTIV G G    I+ R+  I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGSAKRVSITKENTTIVDGAGDQSTIKDRVEAIRSQIEATTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A + L  + G NEDQ  GI+IVR+AL  P RQI +NAG +  ++  K+ +      G+N
Sbjct: 421 YATKTLEGLNGVNEDQQRGIDIVRRALQAPVRQIAQNAGFDGAVVAGKLIDGNDDKIGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA V D P+D+
Sbjct: 481 AQTEKYEDLAATGVIDPTKVVRTALQDAASVAGLLITTEAAVGDLPEDK 529


>gi|3913235|sp|P94166|CH60_ACTPL RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|1732039|gb|AAB51437.1| heat-shock 60 protein GroEL [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 547

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/534 (55%), Positives = 399/534 (74%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GVN LA+AVK TLGPKGR V++  ++GAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LKA  K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+   E  T E+ENPYI++ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNIREILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ +LG AK+VV++KD+TTI+ G G   +I+ R+ +I++ IED+ SDY
Sbjct: 301 ISEEIGMELEKATLEELGQAKRVVITKDNTTIIDGIGDEAQIKARVAQIRQQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE A+ EKKDR  D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++ GDNE+Q  GI++  +A+  P RQI+ NAG+E+ ++   +++    NYGY
Sbjct: 421 RAASKVATTLTGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVARNVKDG-NGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    +GDM EMGI+DP KV R+ALQ A S+AG+M+ TE ++ D PK+E   P
Sbjct: 480 NAGTEQYGDMLEMGILDPPKVTRSALQFAASIAGLMITTECMITDLPKEEKLDP 533


>gi|83596013|gb|ABC25372.1| chaperonin (groEL) [uncultured marine bacterium Ant29B7]
          Length = 542

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 315/546 (57%), Positives = 402/546 (73%), Gaps = 6/546 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I    AAR+ +  GV+ LA AVK TLGPKGR VII  SFG+P VTKDGVTVA+ I
Sbjct: 1   MSAKEITFDVAARNGLRAGVDALANAVKVTLGPKGRNVIIEKSFGSPVVTKDGVTVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + +N    +GA+M+++VA+ T D +GDGTTTAT LAQAI   G K V AG NPMD+KRGI
Sbjct: 61  TLENKLENLGAQMLKEVASKTADVAGDGTTTATVLAQAIIKHGHKNVMAGANPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVG-SREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQ 179
           D AV  VV+ L     +VG S ++I QVAT+SAN D  IG+ IA AM+++   G+IT+++
Sbjct: 121 DKAVAVVVKALAKMSIEVGESNDKIEQVATVSANNDPSIGKLIAEAMDKVKKEGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
           +K   T V VV+GMQ DRGY+SPYF T+TE+M A++ENPYILIYDKKIS ++ LLP+LE 
Sbjct: 181 SKGTETYVDVVEGMQFDRGYLSPYFTTNTEKMVADLENPYILIYDKKISTMKELLPVLEP 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             QSGRP  IIAEDV+G+AL TLVVN++R  L V AVKAP FGDRRK +L DIA + G T
Sbjct: 241 VAQSGRPFLIIAEDVDGEALGTLVVNKIRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEE G KLE AT+  LG+A+KV + KD+TT+V G G  + I GR+ +I+  IE T SD
Sbjct: 301 VISEERGFKLENATLDMLGTAEKVTLDKDNTTVVNGAGNKDDISGRVGQIKAQIETTTSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YDR+KL+ERLAKLAGGVAVL VG  +E  L EKKDR  D+L AT+AA +EGIVPGGG+AL
Sbjct: 361 YDREKLQERLAKLAGGVAVLYVGAASEVELKEKKDRVDDALSATKAAIEEGIVPGGGVAL 420

Query: 420 VRAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRA ++LS +KG+N D+  GI I+ +A+  P RQI+ NAG E  +IVSK++E K  +YG+
Sbjct: 421 VRAIESLSKLKGENADETTGIAIIARAIEEPLRQIVLNAGLEGSVIVSKVREGK-GDYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA+   + +M E GIIDP KV R AL++A S+A ++L TEA +V+ PK E   P MPAG 
Sbjct: 480 NAKTDNYCNMHEAGIIDPTKVTRVALENAASVASLLLTTEATIVEIPKPE---PAMPAGP 536

Query: 539 GMGGGM 544
            MGG M
Sbjct: 537 DMGGMM 542


>gi|332532750|ref|ZP_08408624.1| heat shock protein 60 family chaperone GroEL [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037777|gb|EGI74227.1| heat shock protein 60 family chaperone GroEL [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 549

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 400/532 (75%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++     AR  +  GVN LA AVK TLGPKGR V++  SFG+P +TKDGV+VAK I
Sbjct: 1   MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPH-GIITIDQ 179
           D AV   V  LKA        + I QV TISAN D+EIG  IA AME++G + G+IT+++
Sbjct: 121 DKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDQEIGNIIAQAMEKVGRNSGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
            ++   E+ VV+GMQ DRGY+SPYF+ S E+ T E++NP+IL+ DKKIS ++ LLP LE+
Sbjct: 181 GQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFILLVDKKISNIRELLPTLEA 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             ++ +PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G T
Sbjct: 241 VAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAVLTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEEIGL+LEKAT+ DLG+AK+V+++KDDTTI+ G G    I GR+++I+  IE+  SD
Sbjct: 301 VISEEIGLELEKATVEDLGTAKRVIITKDDTTIIDGAGEEAGITGRVSQIKAQIEEATSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YD++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L+ATRAA +EG+VPGGG+AL
Sbjct: 361 YDKEKLQERMAKLAGGVAVIKVGAATEIEMKEKKDRVEDALNATRAAVEEGVVPGGGVAL 420

Query: 420 VRAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRAA  L  + GDNEDQ  GI++  +A+  P RQI+ NAGDE+ ++++ ++     NYGY
Sbjct: 421 VRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTNAGDEASVVINAVK-GGDGNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    + DM EMGI+DP KV R+ALQ AGS+AG+M+ TEA+V + PKDE+A
Sbjct: 480 NAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMITTEAMVAEIPKDESA 531


>gi|3603167|gb|AAD04242.1| 60 kDa heat shock protein [Bartonella grahamii]
          Length = 503

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 378/498 (75%)

Query: 38  VIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQ 97
           ++I  SFGAPR+TKDGV+VAK I  ++ F  +GA+M+R+VA+ T D +GDGTTTAT L Q
Sbjct: 1   MVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQ 60

Query: 98  AIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDRE 157
           AI  EG K V A +NPMD+KRGID AV EVV  L    KK+ +  EI QV TISANG  E
Sbjct: 61  AIVQEGVKAVVADMNPMDLKRGIDAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAE 120

Query: 158 IGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVEN 217
           IG+ IA AME++G  G+IT+++AKTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++
Sbjct: 121 IGKMIADAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDD 180

Query: 218 PYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVK 277
           PYILI++KK+S LQ LLP+LE+  QSG+PL IIAEDVEG+ALATLVVN++R GL + AVK
Sbjct: 181 PYILIHEKKLSNLQSLLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVK 240

Query: 278 APAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNG 337
           AP FGDRRK +L DIA +    VISE++G+KLE  T+  LG AKKV +SK++TTI+ G G
Sbjct: 241 APGFGDRRKAMLEDIAILTSGQVISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAG 300

Query: 338 PSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQ 397
               I  R+N+I+  IE+T SDYDR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  
Sbjct: 301 QKSEITARVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVD 360

Query: 398 DSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNA 457
           D+L+ATRAA +EGIV GGG AL+RAA AL+VKG N DQ AGI IVR+AL  P RQI  NA
Sbjct: 361 DALNATRAAVEEGIVAGGGTALLRAANALTVKGSNPDQEAGIHIVRRALQAPARQIATNA 420

Query: 458 GDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLIT 517
           G+E+ +IV K+ E+    YGYN     FGD+  +GI+DPVKVVR+ALQ+A S+A +++ T
Sbjct: 421 GEEAAIIVGKVLENNADTYGYNTATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITT 480

Query: 518 EAVVVDAPKDETASPQMP 535
           EA+V + PK +T  P MP
Sbjct: 481 EAMVAEVPKKDTPMPPMP 498


>gi|148254001|ref|YP_001238586.1| 60 kDa chaperonin (protein Cpn60) [Bradyrhizobium sp. BTAi1]
 gi|187470686|sp|A5EET6|CH602_BRASB RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|146406174|gb|ABQ34680.1| 60 kDa chaperonin (protein Cpn60) [Bradyrhizobium sp. BTAi1]
          Length = 541

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/529 (55%), Positives = 399/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFAADARERLIRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+++R VA+ T D +GDGTTTAT LAQAI  EG K V A LNP+D+KRGI
Sbjct: 61  ELEDKYENLGAQLLRQVASKTNDLAGDGTTTATVLAQAIVREGAKAVAASLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV E ++ ++   +KV S EE+ QV TISAN D  +G+ IA A++++G  G+IT+++A
Sbjct: 121 DLAVAEAIKDIEKRARKVQSSEEVAQVGTISANSDAAVGKIIATAVKKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+G+Q DRGY+SPYFVT+++++  E E PYILI++ K+++LQPLLP+LE+ 
Sbjct: 181 KSLETELDVVEGLQFDRGYLSPYFVTNSDKLLVEFEEPYILIHESKLTSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL +IAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK  L DIA + G   
Sbjct: 241 VQTGRPLLVIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAQLEDIAILTGGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T++ LG A+++ + K++TT+VGG G  + I+ RI +I+  IE+T SDY
Sbjct: 301 ISQDLGIKLENVTLSQLGRARRIRIDKENTTVVGGTGKKKDIDARIAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLSGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIAEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +   N D  AGI+IV KAL  P RQI  NAG E  ++V KI E+++  +G++
Sbjct: 421 RAKAAVSKLTNPNPDIQAGIQIVLKALEAPIRQIADNAGVEGSIVVGKILENRSPTFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQK  + D+ E GI+DP KVVR ALQ A S+A +++ TEA+VV+ PK++
Sbjct: 481 AQKEEYVDLIEAGIVDPAKVVRTALQDAASVAALIVTTEALVVELPKEK 529


>gi|307726950|ref|YP_003910163.1| chaperonin GroEL [Burkholderia sp. CCGE1003]
 gi|307587475|gb|ADN60872.1| chaperonin GroEL [Burkholderia sp. CCGE1003]
          Length = 540

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/522 (57%), Positives = 393/522 (75%), Gaps = 2/522 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD++   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVRFHDSARSRIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L    K++ + +EI QVA+ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELMRTSKRISTSKEIAQVASISANADEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + +R  A +++P IL+YDKKISA++ LLPILE++
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPDRQAAYLDDPLILLYDKKISAVRDLLPILEAS 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLFIIAEDVEGEALATLVVNSMRGVLKVAAVKAPGFGDRRKAMLEDIAVLTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LEKAT+ DLGSAK+V + KDDT I+ G G  +RIE R+  I+  IE+T SDY
Sbjct: 301 ISEETGKQLEKATLEDLGSAKRVEVRKDDTIIIDGAGQQQRIEARVKAIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ +KG N DQ AGI IV +AL  P R I  NAGDE  ++++K+ E K  N+GY+
Sbjct: 421 RARSAIANLKGANADQDAGIRIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVV 521
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V
Sbjct: 480 ASTGQYGDLVEAGVVDPTKVTRTALQNAASVAGLILTTDATV 521


>gi|262401951|ref|ZP_06078516.1| heat shock protein 60 family chaperone GroEL [Vibrio sp. RC586]
 gi|262351923|gb|EEZ01054.1| heat shock protein 60 family chaperone GroEL [Vibrio sp. RC586]
          Length = 544

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 294/536 (54%), Positives = 398/536 (74%), Gaps = 4/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G  AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VA+ I
Sbjct: 1   MAAKDVRFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D  +G  IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKALSVTCADTKAIAQVGTISANSDSSVGNIIAEAMEKVGRDGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  + E++NP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 QALQDELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKASRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL+LEKAT+ DLG AK+V ++K+++TI+ G G    I+GR+ +I++ IE+  SDY
Sbjct: 301 ISEEIGLELEKATLEDLGQAKRVSITKENSTIIDGAGDQAAIQGRVAQIRQQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L S++GDNE+Q  GI +  +A+  P RQI+KNAGDE  ++ + ++  +  NYGYN
Sbjct: 421 RAASKLSSLEGDNEEQNVGIRVALRAMEAPLRQIVKNAGDEESVVANNVRAGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A   V+GDM EMGI+DP KV R+ALQ A S+AG+M+ TEA++ + PK +  +P MP
Sbjct: 480 AATGVYGDMIEMGILDPTKVTRSALQFAASVAGLMITTEAMITELPKKD--APAMP 533


>gi|5524758|emb|CAB50775.1| GroEL protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 547

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/532 (55%), Positives = 403/532 (75%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++     AR  +  GVN LA AVK TLGPKGR V++  SFG+P +TKDGV+VAK I
Sbjct: 1   MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPH-GIITIDQ 179
           D AV   V  LKA        + I QV TISAN D+EIG+ IA AME++G + G+IT+++
Sbjct: 121 DKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIAQAMEKVGRNSGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
            ++   E+ VV+GMQ DRGY+SPYF+ S E+ T E++NP+IL+ DKKIS ++ LLP LE+
Sbjct: 181 GQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFILLVDKKISNIRELLPTLEA 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             ++ +PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G T
Sbjct: 241 VAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAVLTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEEIGL+LEKAT+ DLG+A++V+++KDDTTI+ G G    I GR+++I+  IE+  SD
Sbjct: 301 VISEEIGLELEKATVEDLGTAERVIITKDDTTIIDGAGEEAGINGRVSQIKAQIEEATSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YD++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L+ATRAA +EG+VPGGG+AL
Sbjct: 361 YDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVEDALNATRAAVEEGVVPGGGVAL 420

Query: 420 VRAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRAA  L  + GDNEDQ  GI++  +A+  P RQI+ NAGDE+ ++++ ++ + + N+GY
Sbjct: 421 VRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTNAGDEASVVINAVK-AGSGNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    + DM EMGI+DP KV R+ALQ AGS+AG+M+ TEA+V + PKD++A
Sbjct: 480 NAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMITTEAMVAEIPKDDSA 531


>gi|29655007|ref|NP_820699.1| chaperonin GroL [Coxiella burnetii RSA 493]
 gi|153209043|ref|ZP_01947222.1| chaperonin GroL [Coxiella burnetii 'MSU Goat Q177']
 gi|154706878|ref|YP_001423710.1| chaperonin GroEL [Coxiella burnetii Dugway 5J108-111]
 gi|212211763|ref|YP_002302699.1| chaperonin GroEL [Coxiella burnetii CbuG_Q212]
 gi|212217957|ref|YP_002304744.1| chaperonin GroEL [Coxiella burnetii CbuK_Q154]
 gi|116236|sp|P19421|CH60_COXBU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein B; AltName:
           Full=Protein Cpn60
 gi|189082348|sp|A9KC15|CH60_COXBN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704110|sp|B6J4T4|CH60_COXB1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704111|sp|B6J2I0|CH60_COXB2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|144998|gb|AAA23309.1| heat shock protein B (htpB) [Coxiella burnetii]
 gi|29542276|gb|AAO91213.1| 60 kDa chaperonin GROEL [Coxiella burnetii RSA 493]
 gi|120575525|gb|EAX32149.1| chaperonin GroL [Coxiella burnetii 'MSU Goat Q177']
 gi|154356164|gb|ABS77626.1| 60 kDa chaperonin GROEL [Coxiella burnetii Dugway 5J108-111]
 gi|212010173|gb|ACJ17554.1| 60 kDa chaperonin GROEL [Coxiella burnetii CbuG_Q212]
 gi|212012219|gb|ACJ19599.1| 60 kDa chaperonin GROEL [Coxiella burnetii CbuK_Q154]
          Length = 552

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/536 (55%), Positives = 396/536 (73%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +K       A++ GV  LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K    ++ I QV TISAN D+ IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVTAAVAELKKISKPCKDQKAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+ + + M+AE+ENP+IL+ DKKIS ++ L+P+LE+ 
Sbjct: 181 SGLENALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNIRELIPLLENV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL +IAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAVLTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE A++ DLGSAK+VV++KDDTTI+ G+G +  I+ R+ +I+K IE++ SDY
Sbjct: 301 ISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  ++L SV+ +NEDQ  G+EI R+A++YP  QI+KN G ++ ++  K+   K  NYGYN
Sbjct: 421 RVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+AG+M+ TE +V +APK +  S  MP
Sbjct: 481 AATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES--MP 534


>gi|3913227|sp|O33500|CH60_PSEST RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|2564288|emb|CAA74154.1| Hsp60 protein [Pseudomonas stutzeri]
          Length = 552

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/531 (55%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++DVA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATIAIVAELKNLAKPCTDSKAIAQVGTISANSDSSIGDIIAEAMERVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M AE+++P +L+ DKKIS ++ LLP+LE+ 
Sbjct: 181 SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPLLLLVDKKISNIRELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE AT+  LG+AK+VV++K++TTI+ G G    IE R+ +I+K +EDT SDY
Sbjct: 301 ISEEVGLSLETATLEHLGNAKRVVLNKENTTIIDGAGQQADIEARVAQIRKQVEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+A V
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVAWV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+S +KG+NEDQ  GI ++R+A+  P RQI+ NAG E  ++V K+++ +  NYG+N
Sbjct: 421 RALQAISELKGENEDQNVGIALLRRAVEAPLRQIVTNAGGEPSVVVDKVKQGE-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMGI+DP KV R+ALQ+A S+  +M+ TEA++ +  +D+ A
Sbjct: 480 AASDTYGDMIEMGILDPAKVTRSALQAAASIGSLMITTEAMIAEVAEDKAA 530


>gi|221133555|ref|ZP_03559860.1| Chaperonin GroEL (HSP60 family) protein [Glaciecola sp. HTCC2999]
          Length = 547

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 298/536 (55%), Positives = 393/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++     AR  +  GVN LA AV+ TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKEVLFSDDARGRMLNGVNILANAVRVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D  +G+ IA AM+++G  G+IT+++ 
Sbjct: 121 DKAVLAAVEELKALSTPCADNKSIAQVGTISANSDTVVGDIIAEAMDKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T EVE+PYIL+ DKKIS ++ LLP LE+ 
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVEVESPYILLVDKKISNIRELLPTLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S +PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKSSKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL+LEK T+ DLG+AK+VV++KD+TT+V G G    IEGR  +I+  IED+ SDY
Sbjct: 301 ISEEIGLELEKVTLEDLGTAKRVVINKDNTTVVDGAGEQAGIEGRCAQIRAQIEDSSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R A  L+ + GDNE+Q  G+++  +A+  P RQI  NAG E+ ++V+ ++ +  ANYGYN
Sbjct: 421 RVAAKLADLTGDNEEQTLGVKLALRAMEAPMRQIATNAGAEASVVVNNVK-AGDANYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA+V D P D +A+P MP
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFASSIASLMITTEAMVADVPADASAAPAMP 535


>gi|229592374|ref|YP_002874493.1| chaperonin GroEL [Pseudomonas fluorescens SBW25]
 gi|259585912|sp|C3K1A0|CH60_PSEFS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|229364240|emb|CAY51939.1| chaperone Hsp60, peptide-dependent ATPase, heat shock protein
           [Pseudomonas fluorescens SBW25]
          Length = 548

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/529 (55%), Positives = 392/529 (74%), Gaps = 2/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR  +  GVN LA+AVK TLGPKGR VII  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARKKMLTGVNVLADAVKATLGPKGRNVIIEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA++++DVA+   D +GDGTTTAT LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGYKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A   +V  LK   K     + I QV TISAN D  IG+ IA AME++G  G+IT+++ 
Sbjct: 121 DKATIAIVAELKNLSKPCADTKAIAQVGTISANSDSSIGDIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV   E M AE+++P IL+ DKKIS ++ +LP+LE+ 
Sbjct: 181 TGLENELSVVEGMQFDRGYLSPYFVNKPETMVAELDSPLILLVDKKISNIREMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I++EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGRPLLIVSEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LE AT+ +LGSAK+V +SK++T IV G G  + I+ RI +I+  + +T SDY
Sbjct: 301 ISEEIGLSLESATLENLGSAKRVTISKENTIIVDGAGVEQDIQARITQIRAQVAETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV++VG  +E  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL+ + GDN DQ  GI ++R+A+  P RQI  N+GDE  ++V++++  K  NYGYN
Sbjct: 421 RALEALTNLTGDNADQNVGIAVLRRAVEAPLRQIAANSGDEPSVVVNEVKNGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A   V+GDM EMGI+DP KV R+ALQ+A S+ G++L TEA + D PK E
Sbjct: 480 AATGVYGDMIEMGILDPTKVTRSALQAAASIGGLILTTEAAIADKPKAE 528


>gi|209886384|ref|YP_002290241.1| chaperonin GroL [Oligotropha carboxidovorans OM5]
 gi|209874580|gb|ACI94376.1| chaperonin GroL [Oligotropha carboxidovorans OM5]
          Length = 549

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 399/526 (75%), Gaps = 1/526 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K    AR+ +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I  
Sbjct: 2   AKDVKFSGDARERMLRGVDTLANAVKVTLGPKGRNVVINKSFGAPRITKDGVTVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           ++ F  +GA+M+R+VA+ T D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID+
Sbjct: 62  EDKFENMGAQMVREVASKTNDTAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDI 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV  V++ ++   K V +  E+ QV TISANGD  IG+ IA AM+++G  G+IT+++AK+
Sbjct: 122 AVTAVIKDIEKRAKPVAASSEVAQVGTISANGDSTIGKMIAQAMQKVGNEGVITVEEAKS 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
             T+V +V+GM+ DRGY+SPYFVT+ E+MTAE+E+ YIL+++KK+S LQ +LP+LE+  Q
Sbjct: 182 LDTDVDIVEGMKFDRGYLSPYFVTNAEKMTAELEDAYILLHEKKLSGLQAMLPVLEAVVQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
           SG+PL IIAED+EG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  VIS
Sbjct: 242 SGKPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTGGQVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           +++G+KLE  T+  LG AKK V+ K++TTIV G G    IE R+N+I+  IE+T SDYDR
Sbjct: 302 DDLGMKLENVTLKQLGRAKKAVIDKENTTIVNGAGKKADIEARVNQIKAQIEETTSDYDR 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG AL+RA
Sbjct: 362 EKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGTALLRA 421

Query: 423 AQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
            +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI ++KT  +G++AQ
Sbjct: 422 KKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILDNKTETFGFDAQ 481

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PKD
Sbjct: 482 NEEYVDMVAKGIIDPAKVVRTALQDAASVAGLLVTTEAMVAELPKD 527


>gi|91976704|ref|YP_569363.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
 gi|123762800|sp|Q138M7|CH601_RHOPS RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|91683160|gb|ABE39462.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
          Length = 547

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFGVDARDRMMRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ + D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGGKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S EEI QV TISANGD EIG+ ++ AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVKNSKKVTSNEEIAQVGTISANGDVEIGKFLSDAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGYISPYFVT+ ++M  E ++ YILI +KK+S L  LLP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYISPYFVTNADKMRVEFDDAYILINEKKLSNLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+K+E  T+  LG AKKV++ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKMENVTLQMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV K+ E    NYG++
Sbjct: 421 RASEQLKRIKTQNDDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKVLEKDQYNYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   +GD+ + GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQTGEYGDLVKKGIIDPTKVVRTAIQNAASVAALLITTEAMVAELPK 527


>gi|190576042|ref|YP_001973887.1| chaperonin GroEL [Stenotrophomonas maltophilia K279a]
 gi|226704176|sp|B2FIU9|CH60_STRMK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|190013964|emb|CAQ47604.1| putative GroEL protein [Stenotrophomonas maltophilia K279a]
          Length = 549

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/527 (55%), Positives = 393/527 (74%), Gaps = 2/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARSRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDDAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K     + I QV TISAN D  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DKAVSAAVAELKNISKPTADDKAIAQVGTISANSDESIGQIIADAMKEVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  TA++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLDNELDVVKGMQFDRGYLSPYFINNQQSQTADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G    ++ R+ +I+  I+DT SDY
Sbjct: 301 ISEEVGLSLEKATIKDLGRAKKVQVSKENTTIIDGVGDKANVDARVAQIKTQIQDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKDRVDDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL+ +KG NEDQ  GI+I  +A+  P R+I+ NAGDE  +I++K++E  T ++GYN
Sbjct: 421 RAITALAGLKGANEDQNHGIQIALRAMEAPLREIVANAGDEPSVIINKVKEG-TGSFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           A    FGDM + GI+DP KV R+ALQ+A S+AG+M+ TEA+V +APK
Sbjct: 480 AATGEFGDMLQFGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPK 526


>gi|207728090|ref|YP_002256484.1| 60 kda chaperonin [Ralstonia solanacearum MolK2]
 gi|206591335|emb|CAQ56947.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum MolK2]
          Length = 550

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 391/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKNISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+ +   K  N+GYN
Sbjct: 421 RARAAISSLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVANVIAGK-GNHGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAA 530


>gi|83747556|ref|ZP_00944593.1| 60 kDa chaperonin GROEL [Ralstonia solanacearum UW551]
 gi|207742485|ref|YP_002258877.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum IPO1609]
 gi|83725736|gb|EAP72877.1| 60 kDa chaperonin GROEL [Ralstonia solanacearum UW551]
 gi|206593876|emb|CAQ60803.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum IPO1609]
          Length = 547

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 391/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKNISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+ +   K  N+GYN
Sbjct: 421 RARAAISSLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVANVIAGK-GNHGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAA 530


>gi|92116746|ref|YP_576475.1| chaperonin GroEL [Nitrobacter hamburgensis X14]
 gi|119366179|sp|Q1QP32|CH601_NITHX RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|91799640|gb|ABE62015.1| chaperonin GroEL [Nitrobacter hamburgensis X14]
          Length = 545

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 304/527 (57%), Positives = 401/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G  ARD +  GV  L  AVK TLGPKGR V++  S+GAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFGVDARDRMLRGVEILNNAVKVTLGPKGRNVVLDKSYGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ + D++GDGTTTAT LA AI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAAAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  L  N KKV S EEI QV TIS+NGD EIG+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADLVRNSKKVTSNEEIAQVGTISSNGDTEIGKFLADAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ +V+GMQ DRGYISPYFVT+ ++M  E+E+ Y+LI +KK+S L  LLP+LE+ 
Sbjct: 181 KSLETELEIVEGMQFDRGYISPYFVTNADKMRVEMEDAYVLINEKKLSQLNELLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L+DIA + G   
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV++ K++TTIV G G    IE R+N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLAMLGRAKKVMIDKENTTIVSGAGKKADIEARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K  N+DQ  G+EIVRKALS P RQI  NAG++  +IV KI E +  +YG++
Sbjct: 421 RASEQLKRIKTANDDQKTGVEIVRKALSAPARQIAINAGEDGSIIVGKILEKEQYSYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           +Q   + ++   GIIDP KVVR A+Q+A S+A +++ TEA+V + PK
Sbjct: 481 SQTGEYVNLISKGIIDPTKVVRAAIQNAASVAALLITTEAMVAELPK 527


>gi|326386246|ref|ZP_08207870.1| chaperonin GroEL [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209471|gb|EGD60264.1| chaperonin GroEL [Novosphingobium nitrogenifigens DSM 19370]
          Length = 546

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 296/529 (55%), Positives = 393/529 (74%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVRFSRDARERILKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKANDKAGDGTTTATVLAQAIVREGMKSVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV +V+E LK     V    EI QV  ISANGD E+G+KIA AME++G  G+IT+++A
Sbjct: 121 DIAVAKVIEDLKGRSTPVSGSSEISQVGVISANGDVEVGQKIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+E+PYILI++KK+S+LQ LLPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMIVELESPYILIHEKKLSSLQALLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLGDIATLTAGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + KD+TTIV G G ++ I+ R+ +I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGQAKKVTIDKDNTTIVDGAGSADDIKARVEQIRAQIEVTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVTGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL+ + G NEDQ  G++IVR+A++ P +QI +NAG +  ++  K+ +      G+N
Sbjct: 421 YATKALAGLTGANEDQTRGVDIVRRAITAPLKQIAENAGHDGAVVAGKLLDQADEGLGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           A   V+ ++   G+IDP KVVR ALQ A S+AG+++ TEA + + P D+
Sbjct: 481 AATDVYENLKAAGVIDPTKVVRTALQDAASVAGLLITTEAAISEKPDDK 529


>gi|332977952|gb|EGK14696.1| chaperone GroEL [Psychrobacter sp. 1501(2011)]
          Length = 548

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 294/526 (55%), Positives = 385/526 (73%), Gaps = 2/526 (0%)

Query: 3   AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISF 62
           AKD+K G  AR  +  GVN LA AV+ TLGPKGR V+I  SFGAP +TKDGV+VAK I  
Sbjct: 2   AKDVKFGIDARKQMMDGVNILANAVRVTLGPKGRNVVIDKSFGAPAITKDGVSVAKEIEL 61

Query: 63  KNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDL 122
           +N F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID 
Sbjct: 62  ENKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILVEGMKSVAAGMNPMDLKRGIDK 121

Query: 123 AVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKT 182
           AV   V  +          + I QV +ISAN D +IGE IA AME++G  G+IT+++   
Sbjct: 122 AVAAAVAEIHKISTPADDSKAIAQVGSISANSDTKIGELIAEAMEKVGKKGVITVEEGSG 181

Query: 183 ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQ 242
               + VV+GMQ DRGYISPYF    + +TAE ENP+IL+ DKKIS ++ ++P+LE   Q
Sbjct: 182 FEDSLEVVEGMQFDRGYISPYFANKQDSLTAEFENPFILLVDKKISNIREIVPLLEQVMQ 241

Query: 243 SGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVIS 302
             +PL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G TVIS
Sbjct: 242 QSKPLLIIAEDVENEALATLVVNNMRGGLKTCAVKAPGFGDRRKAMLQDIAILTGGTVIS 301

Query: 303 EEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDR 362
           EE+GL LE ATI  LG+AKKV + K++T IV G G    IE R+  I + IE++ SDYD+
Sbjct: 302 EEVGLSLENATIEHLGTAKKVTVGKENTVIVDGAGSKAEIESRVESINRQIEESTSDYDK 361

Query: 363 DKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRA 422
           +KL+ER+AKL+GGVAV++VG  TE A+ EKKDR  D+L ATRAA +EG+VPGGG+A+VRA
Sbjct: 362 EKLQERVAKLSGGVAVIKVGAATETAMKEKKDRVDDALHATRAAVEEGVVPGGGVAMVRA 421

Query: 423 AQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             AL+ ++GDN+DQ AGI I+R+A+  P RQI+ NAGDE+ ++V++++   + N+GYNA 
Sbjct: 422 LNALADLQGDNDDQNAGINILRRAMEAPLRQIVTNAGDEASVVVNEVKNG-SGNFGYNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
             V+GDM EMGI+DP KV R+AL+ A S+AG+ML TEA++ D P+D
Sbjct: 481 TGVYGDMLEMGILDPAKVSRSALEHAASVAGLMLTTEAMITDKPED 526


>gi|113460613|ref|YP_718679.1| chaperonin GroEL [Haemophilus somnus 129PT]
 gi|170718937|ref|YP_001784105.1| chaperonin GroEL [Haemophilus somnus 2336]
 gi|123031206|sp|Q0I284|CH60_HAES1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189082355|sp|B0USK6|CH60_HAES2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|112822656|gb|ABI24745.1| 60 kDa chaperonin (groEL protein) [Haemophilus somnus 129PT]
 gi|168827066|gb|ACA32437.1| chaperonin GroEL [Haemophilus somnus 2336]
          Length = 547

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 297/532 (55%), Positives = 397/532 (74%), Gaps = 3/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AKD+K G  AR  +  GVN LA+AVK TLGPKGR VI+  +FGAP +TKDGV+VA+ I
Sbjct: 1   MTAKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKAFGAPTITKDGVSVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI +EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVSEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK   K   + +EI QV TISAN D  +G+ IA AME++G  G+IT++  
Sbjct: 121 DKAVNAVVEELKILSKPCETSKEIEQVGTISANADETVGKLIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
              + E+ VV+GMQ DRGY+SPYF+   E  T E++NP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 SGLSDELDVVEGMQFDRGYLSPYFINKPEAATVELDNPFILLVDKKISNIRELLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA +   TV
Sbjct: 241 AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++LEKAT+ DLG AK+VV++KD+TTI+ G G   +I+GR+ +I++ IE+  SDY
Sbjct: 301 ISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALI 420

Query: 421 RAAQ--ALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RAA   A ++KGDNEDQ  GI++  +A+  P RQI+ NAG+E+ ++ S ++  +  N+GY
Sbjct: 421 RAATKVATTLKGDNEDQDVGIKLALRAMEAPLRQIVTNAGEEASVVASAVKNGE-GNFGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           NA    +GDM  MGI+DP KV R+ALQ A S+AG+M+ TE +V D PK+E A
Sbjct: 480 NAGTEQYGDMIAMGILDPTKVTRSALQFAASIAGLMVTTECMVADLPKEEKA 531


>gi|161830449|ref|YP_001597541.1| chaperonin GroEL [Coxiella burnetii RSA 331]
 gi|189082349|sp|A9NA82|CH60_COXBR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|30142090|gb|AAP13855.1| heat shock protein B [Coxiella burnetii]
 gi|161762316|gb|ABX77958.1| chaperonin GroL [Coxiella burnetii RSA 331]
          Length = 552

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 295/536 (55%), Positives = 396/536 (73%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +K       A++ GV  LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K    ++ I QV TISAN D+ IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVTAAVAELKKISKPCKDQKAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGY+SPYF+ + + M+AE+ENP+IL+ DKKIS ++ L+P+LE+ 
Sbjct: 181 SGLENALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNIRELIPLLENI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL +IAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAVLTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LE A++ DLGSAK+VV++KDDTTI+ G+G +  I+ R+ +I+K IE++ SDY
Sbjct: 301 ISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  ++L SV+ +NEDQ  G+EI R+A++YP  QI+KN G ++ ++  K+   K  NYGYN
Sbjct: 421 RVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+AG+M+ TE +V +APK +  S  MP
Sbjct: 481 AATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES--MP 534


>gi|299769027|ref|YP_003731053.1| chaperonin GroEL [Acinetobacter sp. DR1]
 gi|298699115|gb|ADI89680.1| chaperonin GroEL [Acinetobacter sp. DR1]
          Length = 544

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 295/533 (55%), Positives = 401/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +++N K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRSNAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKI  ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKIGNIRELISVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+AT+ DLG+A K+ +SK++T IV G G +  I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQATLQDLGTAHKITVSKENTVIVDGAGDAAAIAERVQQIRAQIEESSSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L ++KG N+DQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNVLDNLKGANDDQTAGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAVP 532


>gi|239814125|ref|YP_002943035.1| chaperonin GroEL [Variovorax paradoxus S110]
 gi|259585918|sp|C5CPP8|CH60_VARPS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|239800702|gb|ACS17769.1| chaperonin GroEL [Variovorax paradoxus S110]
          Length = 550

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 396/530 (74%), Gaps = 3/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGFKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVEELKKASKPTTTSKEIAQVGSISANSDETIGKLIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  +E+ VV+GMQ DRGY+SPYF+ + E+ +A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLDSELDVVEGMQFDRGYLSPYFINNPEKQSALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++T I+ G+G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTIIIDGSGAAADIEARVKQVRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQAL--SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           RA QA+   VKGDN DQ AGI++V KA+  P R+I+ NAG E+ ++V+ +   K  NYG+
Sbjct: 421 RAKQAVGDKVKGDNADQDAGIKLVLKAIEAPLREIVNNAGGEASVVVNAVLAGK-GNYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           NA    +GDM E+GI+DP KV R ALQ+A S+A ++L TEA+V DAPK+E
Sbjct: 480 NAANDTYGDMLELGILDPTKVTRTALQNAASVASLLLTTEAMVADAPKEE 529


>gi|153006553|ref|YP_001380878.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5]
 gi|187470681|sp|A7HGP8|CH602_ANADF RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|152030126|gb|ABS27894.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5]
          Length = 547

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 393/532 (73%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MASKEIIFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQA+Y EG K V AG NPM+IKRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQALYREGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK   K    ++EI QV  ISANGD  IG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVEIIVGELKKLSKPTKDQKEIAQVGIISANGDETIGNIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM A +E+ YILI++KKIS ++ LLP+LE  
Sbjct: 181 KGLETTLEVVEGMQFDRGYLSPYFVTDAERMVANLEDAYILIHEKKISNMKDLLPLLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 ARSGKPLLIVAEEVEGEALATLVVNKLRGTLHVAAVKAPGFGDRRKAMLEDIAILTGGRM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE+ ++ DLG AK++ + KD+TTIV G G    IE R+  I+  IE+T SDY
Sbjct: 301 IAEELGLKLEQVSLKDLGRAKRISIDKDNTTIVDGAGQKADIEARVKTIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA +AL     +E +  G++IVR+AL  P RQI  N G E+ ++V+K++ESK  N+G+NA
Sbjct: 421 RAVKALEGVKVSEGEKFGLDIVRRALEEPLRQIAGNGGYEASIVVNKVKESKDTNFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
               + D+ + G+IDP KV R+ALQ+A S+A +ML T A+V + PK+E+A+P
Sbjct: 481 ATGDYEDLVKSGVIDPTKVSRSALQNASSVASLMLTTMALVAEKPKEESAAP 532


>gi|315127893|ref|YP_004069896.1| chaperonin GroEL [Pseudoalteromonas sp. SM9913]
 gi|315016407|gb|ADT69745.1| chaperonin GroEL [Pseudoalteromonas sp. SM9913]
          Length = 548

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 296/534 (55%), Positives = 401/534 (75%), Gaps = 3/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++     AR  +  GVN LA AVK TLGPKGR V++  SFG+P +TKDGV+VAK I
Sbjct: 1   MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D++GDGTTTAT LAQ+I NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPH-GIITIDQ 179
           D A+   V  LKA        + I QV TISAN D+EIGE IA AME++G + G+IT+++
Sbjct: 121 DKAIIAAVAELKALSVPCADTKAIAQVGTISANSDKEIGEIIADAMEKVGRNTGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
            ++   E+ VV+GMQ DRGY+SPYF+ + E+   E++NP+IL+ DKKIS ++ LLP LE+
Sbjct: 181 GQSLENELDVVEGMQFDRGYLSPYFINNAEKGAVELDNPFILLVDKKISNIRELLPTLEA 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             ++ +PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G T
Sbjct: 241 VAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAVLTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEEIGL+LEKAT+ DLG+AK+VV++KDDTTI+ G G  + I GR+ +I+  IE+  SD
Sbjct: 301 VISEEIGLELEKATVEDLGTAKRVVITKDDTTIIDGAGEEDGINGRVAQIKAQIEEATSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YD++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+AL
Sbjct: 361 YDKEKLQERMAKLAGGVAVIKVGAATEIEMKEKKDRVEDALHATRAAVEEGVVPGGGVAL 420

Query: 420 VRAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRAA  L+ + GDNEDQ  GI++  +A+  P RQI+ NAGDE+ ++++ ++  +  NYGY
Sbjct: 421 VRAASKLADLLGDNEDQNHGIKVALRAMEAPLRQIVTNAGDEASVVINAVKGGE-GNYGY 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           NA    + DM EMGI+DP KV R+ALQ AGS+AG+M+ TEA+V + PK+E  +P
Sbjct: 480 NAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMITTEAMVAEIPKEEAGAP 533


>gi|86160012|ref|YP_466797.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C]
 gi|119366196|sp|Q2IFK0|CH602_ANADE RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|85776523|gb|ABC83360.1| chaperonin Cpn60, GroEL [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 547

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 302/532 (56%), Positives = 390/532 (73%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MAAKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGD