PSIBLAST alignment of GI: 254780849 and protein with PDB id: 1q3s

>gi|42543369|pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548
>gi|42543370|pdb|1Q3S|B Chain B, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548
 Score =  292 bits (746), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 106/540 (19%), Positives = 199/540 (36%), Gaps = 59/540 (10%)

Query: 9   GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHE 68
           G  A+         +AE V+ TLGPKG   ++ +S G   VT D  T+   I  ++    
Sbjct: 21  GRDAQRLNILAARIIAETVRTTLGPKGMDKMLVDSLGDIVVTNDCATILDKIDLQHP--- 77

Query: 69  VGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVV 128
             A+M+ +VA   +  +GDGTTTA  +A  +  +  + +   ++P  I +G  LA ++  
Sbjct: 78  -AAKMMVEVAKTQDKEAGDGTTTAVVIAGELLRKAEELLDQNIHPSIIIKGYALAAEKAQ 136

Query: 129 EYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQ------------------IG 170
           E L     +V   +E   +   + +   +  E     + +                  + 
Sbjct: 137 EILDEIAIRVDPDDEETLLKIAATSITGKNAESHKELLAKLAVEAVKQVAEKKDGKYVVD 196

Query: 171 PHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL 230
              I    +A     E  +V+G+ ID+  + P      E     + N  + +   +  A 
Sbjct: 197 LDNIKFEKKAGEGVEESELVRGVVIDKEVVHPRMPKRVENAKIALINEALEVKKTETDA- 255

Query: 231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLR 290
                       +     +   + E   L  +V +  + G  V+ V+     D  +  L 
Sbjct: 256 --------KINITSPDQLMSFLEQEEKMLKDMVDHIAQTGANVVFVQKGI-DDLAQHYLA 306

Query: 291 DIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQ 350
               +    V   ++        +A    AK V   KD T    G               
Sbjct: 307 KYGIMAVRRVKKSDM------EKLAKATGAKIVTNVKDLTPEDLG-------------YA 347

Query: 351 KAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG 410
           + +E+ K   +     E          ++  G  TE  + E +   +D++   +   ++G
Sbjct: 348 EVVEERKLAGENMIFVEGCKNPKAVTILIRGG--TEHVIDEVERALEDAVKVVKDVMEDG 405

Query: 411 -IVPGGGIALVRAAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSK 467
            ++P GG   +  A  L          +   IE    AL    + + +NAG ++  ++ K
Sbjct: 406 AVLPAGGAPEIELAIRLDEYAKQVGGKEALAIENFADALKIIPKTLAENAGLDTVEMLVK 465

Query: 468 IQESKTA---NYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDA 524
           +           G +  +    DM E GII+P++V + A++SA   A M+L  + V+   
Sbjct: 466 VISEHKNRGLGIGIDVFEGKPADMLEKGIIEPLRVKKQAIKSASEAAIMILRIDDVIAAK 525