PSIBLAST alignment of GI: 254780849 and protein with PDB id: 1sx3

>gi|61679937|pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525
>gi|61679938|pdb|1SX3|B Chain B, Groel14-(Atpgammas)14 Length = 525
>gi|61679939|pdb|1SX3|C Chain C, Groel14-(Atpgammas)14 Length = 525
>gi|61679940|pdb|1SX3|D Chain D, Groel14-(Atpgammas)14 Length = 525
>gi|61679941|pdb|1SX3|E Chain E, Groel14-(Atpgammas)14 Length = 525
>gi|61679942|pdb|1SX3|F Chain F, Groel14-(Atpgammas)14 Length = 525
>gi|61679943|pdb|1SX3|G Chain G, Groel14-(Atpgammas)14 Length = 525
>gi|61679944|pdb|1SX3|H Chain H, Groel14-(Atpgammas)14 Length = 525
>gi|61679945|pdb|1SX3|I Chain I, Groel14-(Atpgammas)14 Length = 525
>gi|61679946|pdb|1SX3|J Chain J, Groel14-(Atpgammas)14 Length = 525
>gi|61679947|pdb|1SX3|K Chain K, Groel14-(Atpgammas)14 Length = 525
>gi|61679948|pdb|1SX3|L Chain L, Groel14-(Atpgammas)14 Length = 525
>gi|61679949|pdb|1SX3|M Chain M, Groel14-(Atpgammas)14 Length = 525
>gi|61679950|pdb|1SX3|N Chain N, Groel14-(Atpgammas)14 Length = 525
 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 284/526 (53%), Positives = 382/526 (72%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
           AAKD+K G  A   +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VA+ I 
Sbjct: 1   AAKDVKFGNDAGVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+M+++VA+   D++GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA        + I QV TISAN D  +G+ IA AM+++G  G+IT++   
Sbjct: 121 KAVTVAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGT 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
               E+ VV+GMQ DRGY+SPYF+   E    E+E+P+IL+ DKKIS ++ +LP+LE+  
Sbjct: 181 GLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TVI
Sbjct: 241 KAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEEIG++LEKAT+ DLG AK+VV++KD TTI+ G G    I+GR+ +I++ IE+  SDYD
Sbjct: 301 SEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+R
Sbjct: 361 REKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIR 420

Query: 422 AAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
            A  L  ++G NEDQ  GI++  +A+  P RQI+ N G+E  ++ + ++     NYGYNA
Sbjct: 421 VASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVK-GGDGNYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
               +G+M +MGI+DP KV R+ALQ A S+AG+M+ TE +V D PK
Sbjct: 480 ATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPK 525