PSIBLAST alignment of GI: 254780849 and protein with PDB id: 1we3

gi|50514033|pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543
>gi|50514034|pdb|1WE3|B Chain B, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543
 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 297/551 (53%), Positives = 391/551 (70%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIKALAIPVEDRKAIEEVATISANDPE-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  +IV +I    K   YG+
Sbjct: 420 AISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --SAGAGDMDF 543