PSIBLAST alignment of GI: 254780849 and protein with PDB id: 3iyg

>gi|291191145|pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515
 Score =  256 bits (653), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 84/523 (16%), Positives = 187/523 (35%), Gaps = 26/523 (4%)

Query: 9   GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHE 68
           G   +        T+A+ ++  LGPK    ++ +  G   +T DG  + + I  ++    
Sbjct: 7   GRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHP--- 63

Query: 69  VGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVV 128
             A+ + +++   ++  GDGTT+   LA  + +    ++   ++P  +      A+ +++
Sbjct: 64  -AAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMI 122

Query: 129 EYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVR 188
             LK     V +      +  I+++   ++  + +     I    + T+   +    E+ 
Sbjct: 123 STLKKISIPVDTSNRDTMLNIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEID 182

Query: 189 VVQGMQIDRGY---ISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGR 245
           + +  ++++     I    V     +  +V +P +  Y K    +     +     +S  
Sbjct: 183 IKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQT 242

Query: 246 PLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEI 305
            + I  E+     L        +    ++ +K       +         ++ A + +   
Sbjct: 243 DIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRR 302

Query: 306 GLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKL 365
             K +   IA    A+ V                E +          + + K   D    
Sbjct: 303 VRKTDNNRIARACGARIV-------------SRPEELREEDVGTGAGLLEIKKIGDEYFT 349

Query: 366 KERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQA 425
                K      +L  G   E     +++             D  +VPGGG + +  A A
Sbjct: 350 FITECKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHA 409

Query: 426 LSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKT----ANYGYN 479
           L+   K     +      V +AL    R +I+N G  +  +++ ++   T      +G N
Sbjct: 410 LTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVN 469

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV 522
            +     DM E+GI +P+ V     ++A   A ++L  + +V 
Sbjct: 470 GETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVS 512