PSIBLAST alignment of GI: 254780849 and protein with PDB id: 3izi

>gi|321159679|pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513
>gi|321159680|pdb|3IZI|B Chain B, Mm-Cpn Rls With Atp Length = 513
>gi|321159681|pdb|3IZI|C Chain C, Mm-Cpn Rls With Atp Length = 513
>gi|321159682|pdb|3IZI|D Chain D, Mm-Cpn Rls With Atp Length = 513
>gi|321159683|pdb|3IZI|E Chain E, Mm-Cpn Rls With Atp Length = 513
>gi|321159684|pdb|3IZI|F Chain F, Mm-Cpn Rls With Atp Length = 513
>gi|321159685|pdb|3IZI|G Chain G, Mm-Cpn Rls With Atp Length = 513
>gi|321159686|pdb|3IZI|H Chain H, Mm-Cpn Rls With Atp Length = 513
>gi|321159687|pdb|3IZI|I Chain I, Mm-Cpn Rls With Atp Length = 513
>gi|321159688|pdb|3IZI|J Chain J, Mm-Cpn Rls With Atp Length = 513
>gi|321159689|pdb|3IZI|K Chain K, Mm-Cpn Rls With Atp Length = 513
>gi|321159690|pdb|3IZI|L Chain L, Mm-Cpn Rls With Atp Length = 513
>gi|321159691|pdb|3IZI|M Chain M, Mm-Cpn Rls With Atp Length = 513
>gi|321159692|pdb|3IZI|N Chain N, Mm-Cpn Rls With Atp Length = 513
>gi|321159693|pdb|3IZI|O Chain O, Mm-Cpn Rls With Atp Length = 513
>gi|321159694|pdb|3IZI|P Chain P, Mm-Cpn Rls With Atp Length = 513
>gi|321159695|pdb|3IZJ|A Chain A, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159696|pdb|3IZJ|B Chain B, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159697|pdb|3IZJ|C Chain C, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159698|pdb|3IZJ|D Chain D, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159699|pdb|3IZJ|E Chain E, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159700|pdb|3IZJ|F Chain F, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159701|pdb|3IZJ|G Chain G, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159702|pdb|3IZJ|H Chain H, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159703|pdb|3IZJ|I Chain I, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159704|pdb|3IZJ|J Chain J, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159705|pdb|3IZJ|K Chain K, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159706|pdb|3IZJ|L Chain L, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159707|pdb|3IZJ|M Chain M, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159708|pdb|3IZJ|N Chain N, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159709|pdb|3IZJ|O Chain O, Mm-Cpn Rls With Atp And Alfx Length = 513
>gi|321159710|pdb|3IZJ|P Chain P, Mm-Cpn Rls With Atp And Alfx Length = 513
 Score =  287 bits (733), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 97/523 (18%), Positives = 189/523 (36%), Gaps = 29/523 (5%)

Query: 9   GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHE 68
           G  A+         +AE V+ TLGPKG   ++ +  G   VT DGVT+ + +S ++    
Sbjct: 11  GRDAQRMNILAGRIIAETVRSTLGPKGMDKMLVDDLGDVVVTNDGVTILREMSVEHP--- 67

Query: 69  VGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVV 128
             A+M+ +VA   E   GDGTTTA  +A  +  +  + +   ++P  + +G   A Q+  
Sbjct: 68  -AAKMLIEVAKTQEKEVGDGTTTAVVVAGELLRKAEELLDQNVHPTIVVKGYQAAAQKAQ 126

Query: 129 EYLKANHKKV-GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEV 187
           E LK    +V    +EI+    +++   +   +      E I       +D       ++
Sbjct: 127 ELLKTIACEVGAQDKEILTKIAMTSITGKGAEKAKEKLAEIIVEAVSAVVDDEGKVDKDL 186

Query: 188 RVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPL 247
             ++         +                    + D KI+ L   + I E+ T +   +
Sbjct: 187 IKIEKKSGASIDDTELIKGVLVDKERVSAQMPKKVTDAKIALLNCAIEIKETETDAEIRI 246

Query: 248 CIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGL 307
              A+ +E       ++  +   +            +  + L          V +  +  
Sbjct: 247 TDPAKLMEFIEQEEKMLKDMVAEIKASGANVLFCQ-KGIDDLAQHYLAKEGIVAARRVKK 305

Query: 308 KLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKE 367
              +      G+     ++      +G  G  E  +   + +    E             
Sbjct: 306 SDMEKLAKATGANVIAAIAALSAQDLGDAGLVEERKISGDSMIFVEE------------- 352

Query: 368 RLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQAL 426
                      + +   TE  + E      D++       ++G IV GGG   V  +  L
Sbjct: 353 ---CKHPKAVTMLIRGTTEHVIEEVARAVDDAVGVVGCTIEDGRIVSGGGSTEVELSMKL 409

Query: 427 SVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTAN----YGYNA 480
               +  +  +   +     AL    R + +NAG ++  I+ K++ +  +N     G N 
Sbjct: 410 REYAEGISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKVRAAHASNGNKCAGLNV 469

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
                 DM E G+++P++V   A+QSA     M+L  + V+  
Sbjct: 470 FTGAVEDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAA 512