PSIBLAST alignment of GI: 254780849 and protein with PDB id: 3izn

>gi|321159759|pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159760|pdb|3IZN|B Chain B, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159761|pdb|3IZN|C Chain C, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159762|pdb|3IZN|D Chain D, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159763|pdb|3IZN|E Chain E, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159764|pdb|3IZN|F Chain F, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159765|pdb|3IZN|G Chain G, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159766|pdb|3IZN|H Chain H, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159767|pdb|3IZN|I Chain I, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159768|pdb|3IZN|J Chain J, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159769|pdb|3IZN|K Chain K, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159770|pdb|3IZN|L Chain L, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159771|pdb|3IZN|M Chain M, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159772|pdb|3IZN|N Chain N, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159773|pdb|3IZN|O Chain O, Mm-Cpn Deltalid With Atp Length = 491
>gi|321159774|pdb|3IZN|P Chain P, Mm-Cpn Deltalid With Atp Length = 491
 Score =  282 bits (722), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 99/522 (18%), Positives = 182/522 (34%), Gaps = 49/522 (9%)

Query: 9   GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHE 68
           G  A+         +AE V+ TLGPKG   ++ +  G   VT DGVT+ + +S ++    
Sbjct: 11  GRDAQRMNILAGRIIAETVRSTLGPKGMDKMLVDDLGDVVVTNDGVTILREMSVEHP--- 67

Query: 69  VGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVV 128
             A+M+ +VA   E   GDGTTTA  +A  +  +  + +   ++P  + +G   A Q+  
Sbjct: 68  -AAKMLIEVAKTQEKEVGDGTTTAVVVAGELLRKAEELLDQNVHPTIVVKGYQAAAQKAQ 126

Query: 129 EYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVR 188
           E                 + TI+     +  E +                + K A   V 
Sbjct: 127 E----------------LLKTIACEVGAQDKEILTKIAMTSITGKGAEKAKEKLAEIIVE 170

Query: 189 VVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLC 248
            V  +  D G +    +   ++  A +++  ++                +        L 
Sbjct: 171 AVSAVVDDEGKVDKDLIKIEKKSGASIDDTELIKGVLVDKERVSAQMPKKVTDAKIALLN 230

Query: 249 IIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLK 308
              E+   + L  +V      G  V         D  +  L     V    V   ++   
Sbjct: 231 CAIEETASEMLKDMVAEIKASGANV-LFCQKGIDDLAQHYLAKEGIVAARRVKKSDM--- 286

Query: 309 LEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKER 368
                +A    A  +   KD +    G+           +    +E+             
Sbjct: 287 ---EKLAKATGANVITNIKDLSAQDLGDAGLVEERKISGDSMIFVEE------------- 330

Query: 369 LAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG-IVPGGGIALVRAAQALS 427
                     + +   TE  + E      D++       ++G IV GGG   V  +  L 
Sbjct: 331 --CKHPKAVTMLIRGTTEHVIEEVARAVDDAVGVVGCTIEDGRIVSGGGSTEVELSMKLR 388

Query: 428 VKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTAN----YGYNAQ 481
              +  +  +   +     AL    R + +NAG ++  I+ K++ +  +N     G N  
Sbjct: 389 EYAEGISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKVRAAHASNGNKCAGLNVF 448

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVD 523
                DM E G+++P++V   A+QSA     M+L  + V+  
Sbjct: 449 TGAVEDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAA 490