BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus
Liberibacter asiaticus str. psy62]
         (551 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|91774720|ref|YP_544476.1| chaperonin GroEL [Methylobacillus flagellatus KT]
 gi|118597118|sp|Q1H4F2|CH60_METFK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|91708707|gb|ABE48635.1| chaperonin GroEL [Methylobacillus flagellatus KT]
          Length = 544

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 306/550 (55%), Positives = 402/550 (73%), Gaps = 7/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  I  GVN LA AVK TLGPKGR V++  SFG+P VTKDGV+VAK I
Sbjct: 1   MAAKQVIFGDDARAKIVNGVNILANAVKVTLGPKGRNVVLERSFGSPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG NP D+KRGI
Sbjct: 61  ELSDKLENMGAQLVKEVASKTNDNAGDGTTTATVLAQAIVREGFKYVAAGFNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV E+V  +KA  K   + +EI QV +ISAN D +IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAEIVNEIKAIAKPTTTSKEIAQVGSISANSDADIGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + ER  A +ENP++L+YDKKIS ++ LLP LE  
Sbjct: 181 SGLQNELDVVEGMQFDRGYLSPYFINNPERQIALLENPFVLLYDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKAVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ +LG AK+V + K++TTI+ G G    I+ RI++I+K IED  SDY
Sbjct: 301 IAEEVGLSLEKVTLENLGQAKRVEIGKENTTIIDGAGSENNIKVRIDQIKKQIEDATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  ++   KGDN DQ AGI+IV +A+  P RQI+ NAGDE  ++V+K+ E  T NYGYN
Sbjct: 421 RARSSIKELKGDNPDQDAGIKIVLRAIEEPLRQIVANAGDEPSVVVNKVLEG-TGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    +GD+ E+G++DP KV R+ALQ+A S+A ++L T+A+V + PK+E A+P MP    
Sbjct: 480 ASNGTYGDLVELGVLDPAKVTRSALQNAASVASLILTTDALVAELPKEE-AAPAMPDA-- 536

Query: 540 MGGGMGGMDM 549
             GGMGGM  
Sbjct: 537 --GGMGGMGF 544


>gi|114328844|ref|YP_746001.1| chaperonin GroEL [Granulibacter bethesdensis CGDNIH1]
 gi|122326206|sp|Q0BQ24|CH60_GRABC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|114317018|gb|ABI63078.1| 60 kDa chaperonin GROEL [Granulibacter bethesdensis CGDNIH1]
          Length = 544

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 315/550 (57%), Positives = 410/550 (74%), Gaps = 7/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDKAGDGTTTATVLTQAIVREGAKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LKAN +K+ +  E  QV TISANG+ EIG  I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEDLKANSRKITNPSETAQVGTISANGESEIGRMISEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYF+T+ E+M AE++NPYILI++KK++ LQPLLP+LES 
Sbjct: 181 KGIQTELDVVEGMQFDRGYVSPYFITNPEKMIAELDNPYILIHEKKLAQLQPLLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V++ K++TTIV G G  + I+GR ++I+   E+T SDY
Sbjct: 301 ISEDLGIKLETVTLQQLGTAKRVLIEKENTTIVEGAGSPDDIKGRCSQIRAQAEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG+AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALA 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L+  G DN DQ  GIEI+R+AL  P RQI +NAG++  +I  K+ E+ T N+G++
Sbjct: 421 RASLKLADLGYDNGDQKVGIEIIRRALQSPLRQISENAGEDGAVIAGKVLENGTYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   F D+   GIIDP KVVR ALQ A S+A +++ TEA++ + P+ +  +   P    
Sbjct: 481 AQTGEFKDLVSAGIIDPAKVVRTALQDAASVAALLITTEAMIAEKPEKKAPAGAPP---- 536

Query: 540 MGGGMGGMDM 549
             GGMG MD 
Sbjct: 537 --GGMGDMDF 544


>gi|291278672|ref|YP_003495507.1| chaperonin GroEL [Deferribacter desulfuricans SSM1]
 gi|290753374|dbj|BAI79751.1| chaperonin GroEL [Deferribacter desulfuricans SSM1]
          Length = 543

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 300/530 (56%), Positives = 388/530 (73%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I     AR AI  GV+ LA AVK TLGPKGR V+I   FG+P VTKDGVTVAK I 
Sbjct: 1   MAKAITFSEEARQAILRGVDKLANAVKVTLGPKGRNVVIEKKFGSPLVTKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            K+    +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM+IKRGID
Sbjct: 61  LKDPLENLGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGMKNVVAGANPMEIKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ VV  L+   K +  ++EI QV TISAN D EIG  IA AME++G  G+ITI++ K
Sbjct: 121 KAVEAVVNKLQEISKPIQDKKEIAQVGTISANNDPEIGNIIADAMEKVGKDGVITIEENK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + VV+GMQ DRGY+SPYFVT  + M A +EN YILI++KKIS ++ LLPILE   
Sbjct: 181 STETVLEVVEGMQFDRGYLSPYFVTDPDNMEAVLENAYILIHEKKISNMKELLPILEQLA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +   P  IIAEDVEG+ALATLVVN++R  L   AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 241 KQNAPFLIIAEDVEGEALATLVVNKLRGTLNCCAVKAPGFGDRRKEMLKDIAILTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++GLKLE   ++DLG AKKVV+ K++TTIV G G +E I+ R+N+I+K IE+T SDYD
Sbjct: 301 SEDLGLKLENVKLSDLGRAKKVVIDKENTTIVEGAGKTEDIQARVNQIKKQIEETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L+AT+AA +EGIVPGGG+AL+R
Sbjct: 361 REKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALNATKAAVEEGIVPGGGVALIR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL       DQ  G+EI+RKAL YP RQI +NAG E  ++V+ ++E+K   YG+NA 
Sbjct: 421 ALAALDDLKLEGDQQIGVEIIRKALEYPLRQIAENAGYEGSVVVNAVKENKEITYGFNAA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           K  + DM + G+IDP KV R+ALQ+A S+A +ML TEA++ + P+++  +
Sbjct: 481 KEEYTDMIKAGVIDPTKVTRSALQNAASVASLMLTTEALITEIPEEKKDN 530


>gi|212638061|ref|YP_002314581.1| chaperonin GroEL [Anoxybacillus flavithermus WK1]
 gi|226704081|sp|B7GFR6|CH60_ANOFW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|212559541|gb|ACJ32596.1| Chaperonin GroEL (HSP60 family) [Anoxybacillus flavithermus WK1]
          Length = 538

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 286/540 (52%), Positives = 386/540 (71%), Gaps = 2/540 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  ++ I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIEGKDSIAQVAAISAA-DEEVGQLIAEAMERVGKDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T +++M A +ENPYILI DKK+S++Q LLP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDSDKMEAVLENPYILITDKKVSSIQELLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G +L+  TIA LG A KVV++K+ TTIV G G +E I+ RIN+I+  +E+T S++D
Sbjct: 300 TEELGRELKSTTIASLGRAAKVVVTKEHTTIVDGAGRAEDIQARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKTEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M L TEAVV D P++   +P MP  GGM 
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKNTPGMPDMGGMM 538


>gi|295694915|ref|YP_003588153.1| chaperonin GroEL [Bacillus tusciae DSM 2912]
 gi|295410517|gb|ADG05009.1| chaperonin GroEL [Bacillus tusciae DSM 2912]
          Length = 539

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 287/549 (52%), Positives = 386/549 (70%), Gaps = 10/549 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDI     AR A+  GV+ LA+AV+ TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIIFREDARRAMLRGVDALADAVRVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            +N F  +GA+++++VAT T D +GDGTTTAT LAQAI  EG K VTAG NPM +KRGI+
Sbjct: 61  LENPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIQEGLKNVTAGANPMALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V+ +    K +  RE I QVA ISA  D  IG  IA AME++G  G+IT++++K
Sbjct: 121 KAVKAAVDEIARVAKPIEGRESIAQVAAISAGDDE-IGALIADAMEKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ +V+GMQ DRGYISPY +T T++M A +E PY+LI DKK+S +Q +LP+LE   
Sbjct: 180 GFGTELEIVEGMQFDRGYISPYMITDTDKMEAVLEEPYLLITDKKVSNIQEILPVLERVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSGRPL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 240 QSGRPLLLIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL+L+  ++  LG A++V ++K++T IV G G  + I+GRIN+I+  +E+T SD+D
Sbjct: 300 SEELGLELKNTSLQQLGRARQVRVTKENTIIVDGAGDKKEIDGRINQIKVQLEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L++TRAA +EGIVPGGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETEMKEKKLRIEDALNSTRAAVEEGIVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              AL       D+  G+ IVR+AL  P RQI  NAG E  ++V +++  ++A  G+NA 
Sbjct: 420 VIPALDALTVEGDELTGVNIVRRALEAPVRQIADNAGLEGSVVVERLK-KESAGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM + GI+DP KV R+ALQ+A S+A M+L TEA+V D P+ E  +P M       
Sbjct: 479 TGEWVDMIKAGIVDPAKVTRSALQNAASVAAMVLTTEALVADKPEKEKPAPNM------- 531

Query: 542 GGMGGMDMM 550
            G  GMDMM
Sbjct: 532 -GGAGMDMM 539


>gi|261418572|ref|YP_003252254.1| chaperonin GroEL [Geobacillus sp. Y412MC61]
 gi|297528600|ref|YP_003669875.1| chaperonin GroEL [Geobacillus sp. C56-T3]
 gi|319765386|ref|YP_004130887.1| chaperonin GroEL [Geobacillus sp. Y412MC52]
 gi|261375029|gb|ACX77772.1| chaperonin GroEL [Geobacillus sp. Y412MC61]
 gi|297251852|gb|ADI25298.1| chaperonin GroEL [Geobacillus sp. C56-T3]
 gi|317110252|gb|ADU92744.1| chaperonin GroEL [Geobacillus sp. Y412MC52]
          Length = 538

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 292/540 (54%), Positives = 384/540 (71%), Gaps = 2/540 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K V AG NPM I+RGI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKK+S++Q LLPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQELLPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K+ TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKETTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 IYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSIIVERLKNEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++   +  MP  GGM 
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEAVVADKPEENKGNNNMPDMGGMM 538


>gi|138893899|ref|YP_001124352.1| chaperonin GroEL [Geobacillus thermodenitrificans NG80-2]
 gi|196251098|ref|ZP_03149778.1| chaperonin GroEL [Geobacillus sp. G11MC16]
 gi|166198462|sp|A4IJV3|CH60_GEOTN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|134265412|gb|ABO65607.1| GroEL [Geobacillus thermodenitrificans NG80-2]
 gi|196209392|gb|EDY04171.1| chaperonin GroEL [Geobacillus sp. G11MC16]
          Length = 540

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 292/550 (53%), Positives = 385/550 (70%), Gaps = 10/550 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K V AG NPM I+RGI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKK+S +Q LLP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSNIQELLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  T+A LG A KVV++K+ TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTVASLGRASKVVVTKETTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSIIVERLKNEKA-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++          GG  
Sbjct: 479 TGEWVDMIEEGIVDPTKVTRSALQNAASVAAMVLTTEAVVADKPEENK--------GGAN 530

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 531 PGMPDMGGMM 540


>gi|239825804|ref|YP_002948428.1| chaperonin GroEL [Geobacillus sp. WCH70]
 gi|259585908|sp|C5D4F4|CH60_GEOSW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|239806097|gb|ACS23162.1| chaperonin GroEL [Geobacillus sp. WCH70]
          Length = 539

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 292/541 (53%), Positives = 386/541 (71%), Gaps = 3/541 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKKIS +Q +LPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G  L+  TIA LG A KVV++K++TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRDLKSTTIASLGRASKVVVTKENTTIVDGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKTEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQMPAGGGM 540
              + DM E GI+DP KV R+ALQ+A S+A M L TEAVV D P++ +  +P MP  GGM
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNPGMPDMGGM 538

Query: 541 G 541
            
Sbjct: 539 M 539


>gi|260466933|ref|ZP_05813116.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|259029329|gb|EEW30622.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
          Length = 543

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 323/541 (59%), Positives = 415/541 (76%), Gaps = 1/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHTEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  LKAN + V   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAVVAELKANARNVTRNDEIAQVGTISANGDAEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E++ PY+LI++KK+S LQ LLP LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELDEPYVLIHEKKLSNLQALLPALEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVVEKENTTIVDGVGRKEEIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL  V+ DN DQ  G+EIVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAARALDAVQTDNPDQKTGVEIVRRAIETPVRQIAENAGAEGSIIVGKLREKSEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + FGD++  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK E ASP MPAG G
Sbjct: 481 AQTNEFGDLYGQGVIDPAKVVRTALQDAASVAGLLVTTEAMVAEKPKKEAASPAMPAGAG 540

Query: 540 M 540
           M
Sbjct: 541 M 541


>gi|56418784|ref|YP_146102.1| chaperonin GroEL [Geobacillus kaustophilus HTA426]
 gi|68566258|sp|Q5L3E6|CH60_GEOKA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|56378626|dbj|BAD74534.1| chaperonin (GroEL protein) [Geobacillus kaustophilus HTA426]
          Length = 538

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 291/540 (53%), Positives = 384/540 (71%), Gaps = 2/540 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K V AG NPM I+RGI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKK+S++Q LLP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQELLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K+ TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRAAKVVVTKETTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 IYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSIIVERLKNEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++   +  MP  GGM 
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEAVVADKPEENKGNNNMPDMGGMM 538


>gi|83945762|ref|ZP_00958106.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633]
 gi|83850852|gb|EAP88713.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633]
          Length = 546

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 315/536 (58%), Positives = 414/536 (77%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKDVKFGASAREKMLKGVDILADAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK+    +    E+ QV TISANG++EIGE IA AME++G  G+IT+++A
Sbjct: 121 DKAVALVIEQLKSTATPIKGSSEVAQVGTISANGEKEIGEMIANAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT +E+M A++E+PYIL+++KK+S+LQP+LP+LE+ 
Sbjct: 181 KSLATELDVVEGMQFDRGYLSPYFVTDSEKMIADLEDPYILLFEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSNRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG+AKKV ++KDDTTIV G G  E IEGR+N+I++ IEDT SDY
Sbjct: 301 VSEDLGIKLENVTLDMLGTAKKVSITKDDTTIVDGAGEKEAIEGRVNQIRRQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIKVGGASEIEVKERKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  V GDNEDQ  GI IV +AL  P RQI++NAG E  ++V K+ E+K  N+GYN
Sbjct: 421 KATKALDGVTGDNEDQNQGIAIVARALQAPIRQIVENAGSEGSIVVGKVLENKDPNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+ + G+IDPVKV R ALQ A S+A +++ TEA + + PK +  +P  P
Sbjct: 481 AQTGEYEDLVKSGVIDPVKVSRIALQDAASVASLLITTEAAIAEKPKKDGGAPAAP 536


>gi|227818822|ref|YP_002822793.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|75519418|sp|Q6W163|CH601_RHISN RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|36959080|gb|AAQ87505.1| 60 kDa chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227337821|gb|ACP22040.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 315/550 (57%), Positives = 414/550 (75%), Gaps = 9/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAAKEVRFHTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK N ++V   +EI QV TISANGD EIG  +A A+E++G  G+IT+++A
Sbjct: 121 DKAVDAIVEELKTNARRVTKNDEIAQVGTISANGDIEIGRFLAEAVEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PY+LI++KK+S LQ LLP+LES 
Sbjct: 181 KTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYLLIHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALAT VVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATPVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVVVEKENTTIVDGAGSKSEIQGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S++ +N DQ  GIEIVR+AL  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAVKALDSIRTENADQKHGIEIVRRALEAPVRQIAENAGAEGSIIVGKLREKTEFGFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + FGD+++ G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK +   P MP    
Sbjct: 481 AQTNEFGDLYDQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKKDAPLPPMPG--- 537

Query: 540 MGGGMGGMDM 549
                GGMD 
Sbjct: 538 -----GGMDF 542


>gi|312115563|ref|YP_004013159.1| chaperonin GroEL [Rhodomicrobium vannielii ATCC 17100]
 gi|311220692|gb|ADP72060.1| chaperonin GroEL [Rhodomicrobium vannielii ATCC 17100]
          Length = 542

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 315/541 (58%), Positives = 410/541 (75%), Gaps = 1/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G  AR+ +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFGQDARERMIRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVKEGAKSVAAGANPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ L++  KKV S  E+ QV TISANGD E+G KIA AME++G  G+IT++++
Sbjct: 121 DIAVAAVVKDLQSKAKKVTSSSEVAQVGTISANGDVEVGAKIAEAMEKVGNEGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGYISPYF+T  E+M  ++++PYILIY+KK+S LQPLLP+LE+ 
Sbjct: 181 KSLDFELEVVEGMQFDRGYISPYFITDAEKMRVDLDDPYILIYEKKLSNLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL II+EDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G  +
Sbjct: 241 VQSARPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAVLTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   I  LG AKK+ ++KDDTTIV G+G  + IE RIN+I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENVNITMLGRAKKITITKDDTTIVDGSGDQKEIEARINQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EG +PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGFLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG+NEDQ AGI IVR+A+  P R I  NAG++  +I  K+ E+   N+GYN
Sbjct: 421 RAISALEGLKGENEDQKAGINIVRRAIQTPIRTIAANAGEDGAVIAGKVLENGDYNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+   G+IDPVKVVR ALQ A S+AG+++ TEA++ + PK ++  P MP GG 
Sbjct: 481 AATGEYSDLVAAGVIDPVKVVRIALQDAASVAGLLITTEAMIAEKPKKDSPMPAMPGGGM 540

Query: 540 M 540
            
Sbjct: 541 D 541


>gi|110635424|ref|YP_675632.1| chaperonin GroEL [Mesorhizobium sp. BNC1]
 gi|118597097|sp|Q11DQ8|CH602_MESSB RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|110286408|gb|ABG64467.1| chaperonin GroEL [Chelativorans sp. BNC1]
          Length = 542

 Score =  505 bits (1300), Expect = e-141,   Method: Composition-based stats.
 Identities = 325/541 (60%), Positives = 424/541 (78%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D++GDGTTTAT L QAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDAAGDGTTTATVLTQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +VE LK N +KV   +EI QV TISANGD+EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVEELKKNARKVTKNDEIAQVGTISANGDQEIGRFLAQAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  E++ PY+LI++KK+++LQPLLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQEKMRVELDEPYLLIHEKKLASLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + I+GR+N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGLLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL  V G+NEDQ  GI IVR+A+  P RQI +NAG E  +IV +++E     YG+N
Sbjct: 421 RAAKALDNVTGENEDQKVGISIVRRAIEAPIRQIAENAGAEGSIIVGRVREKPDFGYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD+++MG+IDPVKVVR ALQ A S+AG+++ TEA+V D PK ETA P MPAG G
Sbjct: 481 AQTGEYGDLYQMGVIDPVKVVRAALQDAASVAGLLITTEAMVADRPKKETA-PAMPAGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|312112501|ref|YP_003990817.1| chaperonin GroEL [Geobacillus sp. Y4.1MC1]
 gi|311217602|gb|ADP76206.1| chaperonin GroEL [Geobacillus sp. Y4.1MC1]
          Length = 539

 Score =  505 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 291/550 (52%), Positives = 384/550 (69%), Gaps = 11/550 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKESITQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T TE+M A +ENPYILI DKKIS +Q +LPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K++TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKSEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++           G  
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENK---------GGN 529

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 530 SGMPDMGGMM 539


>gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040526|gb|ACT57322.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62]
          Length = 551

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 551/551 (100%), Positives = 551/551 (100%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI
Sbjct: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI
Sbjct: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA
Sbjct: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA
Sbjct: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV
Sbjct: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY
Sbjct: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV
Sbjct: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA
Sbjct: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM
Sbjct: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540

Query: 541 GGGMGGMDMMM 551
           GGGMGGMDMMM
Sbjct: 541 GGGMGGMDMMM 551


>gi|13472184|ref|NP_103751.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452874|sp|Q98IH9|CH602_RHILO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|14022929|dbj|BAB49537.1| heat shock protein GroEL [Mesorhizobium loti MAFF303099]
          Length = 542

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 321/550 (58%), Positives = 421/550 (76%), Gaps = 9/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V+ LK N +KV   +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E PY+LI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + I+GR+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL SV+ +NEDQ  GIEIVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAAKALDSVQAENEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + FGD++  G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK E A P MPA   
Sbjct: 481 AQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKKEPAVPAMPA--- 537

Query: 540 MGGGMGGMDM 549
                GGMD 
Sbjct: 538 -----GGMDF 542


>gi|295402756|ref|ZP_06812696.1| chaperonin GroEL [Geobacillus thermoglucosidasius C56-YS93]
 gi|294975220|gb|EFG50858.1| chaperonin GroEL [Geobacillus thermoglucosidasius C56-YS93]
          Length = 539

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 291/550 (52%), Positives = 384/550 (69%), Gaps = 11/550 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T TE+M A +ENPYILI DKKIS +Q +LPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K++TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKSEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++           G  
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENK---------GGN 529

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 530 SGMPDMGGMM 539


>gi|25452855|sp|Q8VV84|CH60_BACTR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|18250941|dbj|BAB83940.1| GroEL [Geobacillus thermoglucosidasius]
          Length = 539

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 291/550 (52%), Positives = 383/550 (69%), Gaps = 11/550 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T TE+M A +ENPYILI DKKIS +Q +LPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K++TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 RGKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKSEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++           G  
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENK---------GGN 529

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 530 SGMPDMGGMM 539


>gi|258510394|ref|YP_003183828.1| chaperonin GroEL [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477120|gb|ACV57439.1| chaperonin GroEL [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 538

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 285/543 (52%), Positives = 380/543 (69%), Gaps = 5/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+I+ G  AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIRFGEEARRAMMRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K V AG NPM ++RGI+
Sbjct: 61  LEDPYENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVAAGANPMVLRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K V  R+ I +VA ISA  +  IGE IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAVEELKKIAKPVQGRKNIAEVAAISAGSNE-IGELIADAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGYISPY VT  ++M A ++ P ILI DKK+S++Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYISPYMVTDADKMEAVLDEPLILITDKKVSSIQEILPVLERVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+GR L +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 240 QAGRSLLLIAEDVEGEALATLVVNKIRGTFNAVAVKAPGFGDRRKAMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL+L   T+  LG A++V +SK++T IV G G    I+ RIN+I+  IE+T SD+D
Sbjct: 300 SEELGLELRNTTLDQLGRARQVRVSKENTIIVDGAGDKSAIQARINQIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L EKK R +D+L++TRAA +EGIVPGGG+ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALNSTRAAVEEGIVPGGGVALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +AL       D+  G+ +VRKAL  P RQI +NAG E  +IV +++  +    G+NA 
Sbjct: 420 VIKALDNVQAEGDELTGVNLVRKALEAPVRQIAENAGVEGSIIVERLKTEQ-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +MFE GI+DP KV R+ALQ+A S+A   L TEA V D P+ E A      G GMG
Sbjct: 479 TGEWVNMFEAGIVDPAKVTRSALQNAASVAATFLTTEAAVADKPEKEKAPA---PGAGMG 535

Query: 542 GGM 544
             M
Sbjct: 536 DMM 538


>gi|6526961|dbj|BAA88110.1| Cpn60 [Bacillus sp. MS]
          Length = 539

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 290/550 (52%), Positives = 384/550 (69%), Gaps = 11/550 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKKIS +Q +LPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAED+EG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDIEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+ ATIA LG A KVV++K++TTIV G G SERI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSATIASLGRASKVVVTKENTTIVDGAGDSERIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGV V++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKTEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M L TEAVV D P++              
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNA-------- 530

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 531 -GMPDMGGMM 539


>gi|12006268|gb|AAG44815.1|AF274871_2 GroEL [Geobacillus stearothermophilus]
          Length = 539

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 291/550 (52%), Positives = 383/550 (69%), Gaps = 11/550 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVVEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T TE+M A +ENPYILI DKKIS +Q LLPILE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDLLPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K++TTIV G G S+RI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSDRIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+LD+TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALDSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSVIVERLKTEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++              
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNN-------- 530

Query: 542 GGMGGMDMMM 551
            GM  M  MM
Sbjct: 531 -GMPDMGGMM 539


>gi|313680634|ref|YP_004058373.1| chaperonin groel [Oceanithermus profundus DSM 14977]
 gi|313153349|gb|ADR37200.1| chaperonin GroEL [Oceanithermus profundus DSM 14977]
          Length = 543

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 288/550 (52%), Positives = 390/550 (70%), Gaps = 9/550 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +     AR A+  GVN +A AV+ TLGP+GR V++   FG+P +TKDGV+VAK I 
Sbjct: 1   MAKILVFDEEARRALERGVNAVANAVRVTLGPRGRNVVLEKKFGSPTITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGID
Sbjct: 61  IEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLSLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +    + V  R+ I +VATISAN    +G+ IA AM+++G  GIIT++++K
Sbjct: 121 KAVEAAVEQIHKMAQPVEDRKAIEEVATISANDPE-VGQLIADAMDKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+G Q D+GY+SPYFV + E M  ++E+PYILI +KK+S ++ LLP+LE   
Sbjct: 180 GLETELEVVEGYQFDKGYLSPYFVNNPEAMEVQLEDPYILIVEKKVSNIRELLPVLEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G  VI
Sbjct: 240 QTGKPLMIIAEDVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKEMLKDIAAVTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GLKLE  T++ LG A+ V ++KD+TTI+GG G  E IE RIN+I+  +E T S+Y 
Sbjct: 300 SEELGLKLENVTLSMLGQAELVRITKDETTIIGGKGKKEDIEARINQIKAELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV+ VG  TE  L E+K R++D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLSGGVAVIRVGAATETELKERKHRFEDALSATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSVK--GDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             +A+         D+  G +IVR++L  P RQI +NAG E  +IV++I + K  NYG+N
Sbjct: 420 ITEAVDKVLAKLEGDEATGAKIVRRSLEEPTRQIAENAGFEGSVIVNEILQKKDPNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGDM + GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + A+P       
Sbjct: 480 AQSGEFGDMLKFGIVDPAKVTRSALQNAASIGSLVLTTEAVVAEKPEKKEAAPAG----- 534

Query: 540 MGGGMGGMDM 549
             GGM  MD 
Sbjct: 535 -AGGMPDMDF 543


>gi|83591502|ref|YP_425254.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170]
 gi|119366187|sp|Q2RY28|CH601_RHORT RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|83574416|gb|ABC20967.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170]
          Length = 543

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 317/550 (57%), Positives = 412/550 (74%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSSDARDRLLRGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKSADVAGDGTTTATVLAQAIVREGSKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ +K   +K+ + +EI QV TISANGD E+G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAAVVKDVKTRSRKIATNDEIAQVGTISANGDEEVGKIIARAMDKVGHEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ E+M A++ENPYILI++KK+S LQPLLP+LE+ 
Sbjct: 181 KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILIHEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V +VKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVASVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK V ++KD+TTIV G G    I+ R  +I+  IEDT SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGTAKTVTITKDNTTIVDGAGVKADIDARCAQIRATIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ VG  +E  + EKKDR  D++ ATRAA +EGI+ GGG+AL+
Sbjct: 361 DREKLQERLAKLSGGVAVIRVGGASEVEVKEKKDRVDDAMHATRAAVEEGIIAGGGVALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+AL      N DQ  GIEIVR+AL  P RQI +NAG +  ++  K+ ES  A++GYN
Sbjct: 421 HAAKALDALSPANADQKVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLESSDADFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ  V+ ++ ++G+IDP KVVR ALQ A S+A +++ TEA+V + P+ + A P       
Sbjct: 481 AQTGVYENLVKVGVIDPTKVVRTALQGAASVASLLITTEAMVAEIPEKKPALPA------ 534

Query: 540 MGGGMGGMDM 549
            GGGMG MD 
Sbjct: 535 -GGGMGDMDF 543


>gi|86361060|ref|YP_472947.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|123508568|sp|Q2JYW6|CH604_RHIEC RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|86285162|gb|ABC94220.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 542

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 319/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSVEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +VE LKAN +K+ +  EI QV TISANGD EIG  +A A++++G  G+IT+++A
Sbjct: 121 DLAVSAIVEELKANARKISNNAEIAQVGTISANGDAEIGRFLAEAVQKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK+ + K++TTI+ G G  E I GRI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKITVEKENTTIIDGVGSKEEISGRIAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N+DQ  G+EIVR+AL  P RQI +NAG E  ++V K++E    +YG+N
Sbjct: 421 RAVKALDNIKTANDDQRVGVEIVRRALEAPARQIAENAGAEGSVVVGKLREKSDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK + A P MPAG G
Sbjct: 481 AQTGEFGDLYAQGVIDPAKVVRTALQDASSIAGLLVTTEAMIAEKPKKD-APPAMPAGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|85373658|ref|YP_457720.1| chaperonin GroEL [Erythrobacter litoralis HTCC2594]
 gi|123409666|sp|Q2NBL8|CH601_ERYLH RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|84786741|gb|ABC62923.1| heat shock protein [Erythrobacter litoralis HTCC2594]
          Length = 539

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 309/550 (56%), Positives = 407/550 (74%), Gaps = 12/550 (2%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NP+D+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPIDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ L+++ KKV +  EI QVATISANGD  +G  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVGTVVKDLESHAKKVSANSEIAQVATISANGDETVGRFLAEAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+  V+GMQ DRGY+SPYFVT+TE++  E+E+PYILI++KK+S LQ L+P+LE  
Sbjct: 181 KSLETELETVEGMQFDRGYLSPYFVTNTEKLKVELEDPYILIHEKKLSNLQALIPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDVAILTAGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G KLE  TI  LG AKKV++ KD+TTIV G G    I+ R+++I+  IE T SDY
Sbjct: 301 VSEELGTKLENVTIGMLGRAKKVIIDKDNTTIVDGAGNKADIDARVSQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA ++L  +K  N+DQ +GI+IVR+AL  P RQI +NAG++   IV K+ E    N+G+N
Sbjct: 421 RALKSLDGLKAANDDQQSGIDIVRRALRAPARQIAENAGEDGAYIVGKLLEGDDYNHGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V + PK++T +P       
Sbjct: 481 AATGEYEDLVKSGVIDPAKVVRTALQDAASVASLLITTEALVAELPKEDTPAP------- 533

Query: 540 MGGGMGGMDM 549
               M  MD 
Sbjct: 534 ----MPAMDF 539


>gi|189220187|ref|YP_001940827.1| chaperonin GroEL [Methylacidiphilum infernorum V4]
 gi|226704149|sp|B3DZP5|CH60_METI4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189187045|gb|ACD84230.1| Chaperonin GroEL (HSP60 family) [Methylacidiphilum infernorum V4]
          Length = 544

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 295/548 (53%), Positives = 396/548 (72%), Gaps = 5/548 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +    +AR A+  GV  L++AVKCTLGP GR VI+   FG+P +TKDGVTVAK +
Sbjct: 1   MAAKQLIFDESARHALLRGVEKLSKAVKCTLGPAGRNVILDKKFGSPTITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+++++VA+ T D +GDGTTTAT LA++IY EG K VTAG NPMD+KRG+
Sbjct: 61  ELEDPWENMGAQLVKEVASKTSDVAGDGTTTATVLAESIYKEGLKNVTAGANPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AVQ VV+ LK     V  +EEI QVAT+SAN D  IGE IA A++++G  G +T+++A
Sbjct: 121 DKAVQAVVKQLKEISHIVKGKEEIKQVATVSANWDTSIGEIIADALDKVGKDGTVTVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGYISPYFVT+ E + A +EN YILI++KKIS L+ LLP+LE  
Sbjct: 181 KHIETTLEVVEGMQFDRGYISPYFVTNAEELEAVLENAYILIHEKKISNLKDLLPLLEKI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNKLRGTLQVCAVKAPGFGDRRKAMLEDIAILTGGRC 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++E++G+KLE   + DLG AK++++ K++TTI+ G+G    I+GRIN+I++ IE+T SDY
Sbjct: 301 LTEDLGIKLENVQLEDLGRAKRIIVEKENTTIIEGSGSRSEIQGRINQIRRQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIHVGAATETELKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  +A+       D+  G  IV KAL YP + +  NAG E  +IV++++  K  N G++ 
Sbjct: 421 RCQKAIEGLSLKGDEQIGANIVYKALEYPLKTLADNAGLEGSVIVNEVKAKK-GNEGFDV 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
            K  + DMFE GI+DP KV R AL++A S+AG++L TEA+V + P+ E   P  PAG   
Sbjct: 480 AKRSYVDMFEAGIVDPTKVTRTALENAASIAGLLLTTEAMVTEIPEKEKK-PATPAGA-- 536

Query: 541 GGGMGGMD 548
            GGMG M+
Sbjct: 537 -GGMGDME 543


>gi|75676299|ref|YP_318720.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255]
 gi|119366180|sp|Q3SQS3|CH601_NITWN RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|74421169|gb|ABA05368.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255]
          Length = 542

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 315/541 (58%), Positives = 411/541 (75%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  + AR+ +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFSSDAREKMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELDDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV+ L  N KK+ S  EI QVATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVKDLTKNAKKITSNSEIAQVATISANGDTEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT  E+M  E E+PY+LI++KK+S LQ ++P+LES 
Sbjct: 181 KSLETELEVVEGMQFDRGYVSPYFVTDAEKMRVEFEDPYVLIHEKKLSGLQAMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL +IAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLVIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVVIDKENTTIVDGAGRKKDIEARVTQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL     DN DQ AG++IVR+A+  P RQII+NAG++  L+V K+ E  T N+G+N
Sbjct: 421 RALKALDAVKPDNPDQKAGVDIVRRAIQVPARQIIQNAGEDGSLVVGKLLEKNTYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+  +G+IDP KVVR ALQ A S+A +++ TEA+V + PK + A P +P GGG
Sbjct: 481 AATGEYQDLVGVGVIDPAKVVRTALQDAASVASLLITTEALVAEKPKKDVA-PALPPGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|190894865|ref|YP_001985158.1| chaperonin GroEL [Rhizobium etli CIAT 652]
 gi|190700526|gb|ACE94608.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|327189040|gb|EGE56226.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CNPAF512]
          Length = 542

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 319/541 (58%), Positives = 412/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNVEAREKLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN + + +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVAAIVAELKANARNISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGRI +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSVEKENTTIVDGSGAKSDIEGRIAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  V+  N DQ  G++IVR+AL  P RQI +NAG E  ++V K++E    +YG+N
Sbjct: 421 RAVKALENVQTANSDQRVGVDIVRRALEAPARQIAENAGAEGSVVVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD++  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK + A+P +P G G
Sbjct: 481 AQTGEFGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMVAEKPKKD-AAPPLPPGAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|218288237|ref|ZP_03492536.1| chaperonin GroEL [Alicyclobacillus acidocaldarius LAA1]
 gi|218241596|gb|EED08769.1| chaperonin GroEL [Alicyclobacillus acidocaldarius LAA1]
          Length = 538

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 284/543 (52%), Positives = 379/543 (69%), Gaps = 5/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+I+ G  AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIRFGEEARRAMMRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K V AG NPM ++RGI+
Sbjct: 61  LEDPYENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVAAGANPMVLRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K V  R+ I +VA ISA  +  IGE IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAVEELKKIAKPVQGRKNIAEVAAISAGSNE-IGELIADAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGYISPY VT  ++M A ++ P ILI DKK+S++Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYISPYMVTDADKMEAVLDEPLILITDKKVSSIQEILPVLERVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+GR L +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 240 QAGRSLLLIAEDVEGEALATLVVNKIRGTFNAVAVKAPGFGDRRKAMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL+L   T+  LG A++V +SK++T IV G G    I+ RIN+I+  IE+T SD+D
Sbjct: 300 SEELGLELRNTTLDQLGRARQVRVSKENTIIVDGAGDKSAIQARINQIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L EKK R +D+L++TRAA +EGIVPGGG+ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALNSTRAAVEEGIVPGGGVALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +AL       D+  G+ +VRKAL  P RQI +NAG E  +IV +++  +    G+NA 
Sbjct: 420 VIKALDNVQAEGDELTGVNLVRKALEAPVRQIAENAGVEGSIIVERLKTEQ-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +MFE GI+DP KV R+ALQ+A S+A   L TEA V D P+ E A      G GM 
Sbjct: 479 TGEWVNMFEAGIVDPAKVTRSALQNAASVAATFLTTEAAVADKPEKEKAPA---PGAGMS 535

Query: 542 GGM 544
             M
Sbjct: 536 DMM 538


>gi|150396499|ref|YP_001326966.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470755|sp|A6U901|CH603_SINMW RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|150028014|gb|ABR60131.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 542

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 319/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQADARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K + +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAIASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK+N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKSNARKISQNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT+ TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTSDTELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+ LE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIMLENVTLEMLGRAKKVSIEKENTTIIDGAGSKTEIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +K  N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVNALDGLKTANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKVEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDPVKVVR ALQ A S+AG+++ TEA++ + PK E+ +P +PAGGG
Sbjct: 481 AQTNEYGDLYTMGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKES-TPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|171911500|ref|ZP_02926970.1| chaperonin GroEL [Verrucomicrobium spinosum DSM 4136]
          Length = 539

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 284/543 (52%), Positives = 383/543 (70%), Gaps = 4/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    +AR A+  GV  +A AVK TLGP GR VI+   FG+P +TKDGVTVAK I 
Sbjct: 1   MAKQLNFDESARQALLRGVQKIARAVKATLGPSGRNVILEKKFGSPTITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + +  +GA+++++V++ T D +GDGTTTAT LA+AIY+EG + VTAG NP  ++RGI 
Sbjct: 61  LSDPYENMGAQLVKEVSSKTSDVAGDGTTTATVLAEAIYSEGLRNVTAGANPTSLQRGIL 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A + +V  LK   + V +  EI QVAT+SAN D EIG  IA AM+++G  G IT+++AK
Sbjct: 121 KATEAIVAKLKEISQPVTNATEIAQVATVSANWDTEIGNIIADAMDKVGKDGTITVEEAK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + VV+GMQ D+GY+SPYFVT  E M A +EN  ILI++KKIS L+ LLP+LE   
Sbjct: 181 SIETSLDVVEGMQFDKGYLSPYFVTDAESMEAVLENALILIHEKKISNLKDLLPLLEKVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++GRPL IIAEDVEG+ALATLVVNR+R  L + AVKAP FGDRRK +L DIA + G   I
Sbjct: 241 RTGRPLLIIAEDVEGEALATLVVNRLRGTLNICAVKAPGFGDRRKAMLEDIAILTGGRCI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GLKLE   + DLG AK+V + K++TTIV G G SE I GR+N+I++ I++T SDYD
Sbjct: 301 TEDLGLKLENLELTDLGRAKRVTIDKENTTIVEGEGGSEAIAGRVNQIRRQIDETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+R
Sbjct: 361 REKLQERLAKLAGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALIR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL+      D+  G +IVR+A+  P RQ+  NAG E  LIV++++   + N GYN  
Sbjct: 421 AQAALAELQLTGDEATGADIVRRAIEAPLRQLAANAGLEGALIVAEVK-KGSGNSGYNVA 479

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + D+ + G++DP KV R+ALQ+A S++G++L TE ++ D PK+E A P    G   G
Sbjct: 480 TGEYVDLIKAGVVDPTKVTRSALQNAASISGLLLTTECLISDIPKEEKAEPAHDHG---G 536

Query: 542 GGM 544
            GM
Sbjct: 537 MGM 539


>gi|116249307|ref|YP_765148.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841]
 gi|118597102|sp|Q1M3H2|CH603_RHIL3 RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|115253957|emb|CAK12352.1| putative 60 kDa chaperonin [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 542

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 318/541 (58%), Positives = 413/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  V+  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDNVETANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + P+ + A P MPAG G
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPRKD-APPPMPAGHG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|332982795|ref|YP_004464236.1| chaperonin GroEL [Mahella australiensis 50-1 BON]
 gi|332700473|gb|AEE97414.1| chaperonin GroEL [Mahella australiensis 50-1 BON]
          Length = 540

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 288/541 (53%), Positives = 375/541 (69%), Gaps = 4/541 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I     AR A+  GVN LA+ VK TLGPKGR V++   FGAP VT DGVT+AK I 
Sbjct: 1   MAKQIIYDEEARKALERGVNALADTVKITLGPKGRNVVLDKKFGAPTVTNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQAI  EG + V AG NPM +KRGI+
Sbjct: 61  LEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIVREGLRNVAAGANPMLVKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K V S+E I QVA+ISAN D  IGE +A AM+++G  G+IT++++K
Sbjct: 121 KAVDVAVEELKKISKPVESKEAIAQVASISAN-DTTIGEMVAEAMDKVGRDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE+ VV+GMQ DRGYISPY VT TE+M A +E+PYILI DKK+S +Q LLP+LE   
Sbjct: 180 SMLTELEVVEGMQFDRGYISPYMVTDTEKMEAVLEDPYILITDKKLSNVQDLLPLLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GR L IIA+DVEG+ALATLVVN++R     +AVKAP FGDRRKE+LRDIA + G  VI
Sbjct: 240 QQGRRLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLRDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           S+E+G  L++  +  LG A+ V + K++TTIV G G    I+ RI  I+  IE+T SD+D
Sbjct: 300 SDELGFDLKEVKLNQLGRARLVRVDKENTTIVDGAGHPSEIKARIASIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATEVEMKEKKMRMEDALSATRAAVEEGIVPGGGVALIN 419

Query: 422 AAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
              AL    D  + D+  G+ IV++AL  P RQI  NAG E  +IV K++ S  A  G+N
Sbjct: 420 VLPALDKLIDQTSGDEKTGVTIVKRALEEPVRQIATNAGLEGSVIVEKVKNS-AAGIGFN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
                + DM + GI+DP KV R+ALQ+A S+A M+L TE++V D P+ +   P  P    
Sbjct: 479 VLTEEYVDMIKAGIVDPTKVTRSALQNAASIAAMILTTESLVTDIPEKQPPVPAAPNPDM 538

Query: 540 M 540
           M
Sbjct: 539 M 539


>gi|584920|sp|Q07201|CH60_BACST RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|289300|gb|AAA22752.1| GroEL [Geobacillus stearothermophilus]
          Length = 539

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 290/541 (53%), Positives = 387/541 (71%), Gaps = 3/541 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+SPY +T TE+M A +ENPYILI DKK+S++Q +LPILE   
Sbjct: 180 GFATELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQEILPILEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+ ATIA LG A KVV++K++TTIV G G S+RI+ RIN+I+  +E+T S++D
Sbjct: 300 SEELGRELKSATIASLGRASKVVVTKENTTIVEGAGDSKRIKARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI + AG E  +IV +++  K    G+NA 
Sbjct: 420 VYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQTAGLEGSIIVERLKTEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQMPAGGGM 540
              + DM E GI+DP KV R+ALQ+A S+A M L TEAVV D P++ +  +P MP  GGM
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNPGMPDMGGM 538

Query: 541 G 541
            
Sbjct: 539 M 539


>gi|239834971|ref|ZP_04683299.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
 gi|239823034|gb|EEQ94603.1| chaperonin GroEL [Ochrobactrum intermedium LMG 3301]
          Length = 542

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 317/541 (58%), Positives = 415/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+ S  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKTNARKITSNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + K++TTI+ G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKRVAIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  G+EIVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALEGLPIANDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   +GD++  G+IDPVKVVR ALQ A S+AG+++ TEA++ + PK E A+P +PA  G
Sbjct: 481 AQTGEYGDLYAQGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-ATPALPASAG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|222102161|ref|YP_002546751.1| chaperonin GroL [Agrobacterium radiobacter K84]
 gi|221728278|gb|ACM31287.1| chaperonin GroL [Agrobacterium radiobacter K84]
          Length = 542

 Score =  500 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 304/539 (56%), Positives = 405/539 (75%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARQRLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNP D+KRGI
Sbjct: 61  ELEDKFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGLNPQDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E +  +K   +KV S EE+ QV TISANG+ EIG+ IA A++++G  G+IT+++A
Sbjct: 121 DLAATEAIRSIKERSRKVASSEEVAQVGTISANGESEIGKLIAEAVQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+G+Q DRGY+SPYFVT+ E++  E E+ YIL+++KK++ LQPLLP+LE+ 
Sbjct: 181 KSFETELDVVEGLQFDRGYLSPYFVTNAEKLIVEFEDAYILLHEKKLATLQPLLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA V G  V
Sbjct: 241 VQTGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKALLEDIAIVTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE+IG+KLE  T+  LG AKK+ + K+ TT+V G G    I  R+ +I+  IEDT SDY
Sbjct: 301 VSEDIGIKLENVTLDQLGRAKKIRIDKETTTVVDGAGEKAEIAARVQQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGSTEIEVKEKKDRVDDALNATRAAIEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ ++K DN D  AGI I++KAL  P RQI +NAG E  ++V K+ ES +  +G+N
Sbjct: 421 RAKTAVNALKNDNPDIQAGIHILQKALEAPIRQIAENAGVEGSIVVGKVLESNSPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           AQ   + D+ + GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++T +P  P GG
Sbjct: 481 AQTEKYVDLLQEGIVDPTKVVRTALQDAASVAGLLVTTEALIAEVPKEKTPTPAAPGGG 539


>gi|332188320|ref|ZP_08390046.1| chaperonin GroL [Sphingomonas sp. S17]
 gi|332011633|gb|EGI53712.1| chaperonin GroL [Sphingomonas sp. S17]
          Length = 539

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 317/539 (58%), Positives = 409/539 (75%), Gaps = 2/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFSTDARDRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++IR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQLIREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LKA+ +++ +  EI QVATISANGD E+G+ +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAVVDDLKAHARRISANSEIAQVATISANGDTEVGQILAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T+ E++  E+E+PYILI++KK+S LQ L+P+LE  
Sbjct: 181 KSLATELEVVEGMQFDRGYLSPYFITNPEKLRVELEDPYILIHEKKLSNLQALVPLLEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEGDALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 IQSGRPLLIIAEDVEGDALATLVVNKLRGGLQVAAVKAPGFGDRRKAMLEDIAVLTGGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKVV+ KDDTTI+ G G    I+GR  +I++ IE T SDY
Sbjct: 301 VSEDLGIKLENVTVNMLGRAKKVVIDKDDTTIIDGAGQKSDIDGRAAQIRQQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+  ATRAA +EGI+PGGGI L+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAFHATRAAVEEGILPGGGIPLL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S+   N+DQ AGIEIVR+AL  P RQI+ NAG++   +V K+ E    N+G+N
Sbjct: 421 RAVKALESLSAANDDQKAGIEIVRRALKAPARQIVDNAGEDGAYVVGKLGEGSDYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           A    + D+   G+IDP KVVR ALQ A S+AG+++ TEA+V + PKDE  +P +PA  
Sbjct: 481 AATGEYEDLVRAGVIDPAKVVRTALQDAASVAGLLITTEALVAELPKDEKPAP-VPAMD 538


>gi|83589410|ref|YP_429419.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073]
 gi|119366178|sp|Q2RL13|CH601_MOOTA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|83572324|gb|ABC18876.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073]
          Length = 539

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 294/540 (54%), Positives = 386/540 (71%), Gaps = 3/540 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +     AR A+  GV+T+A+AVK TLGPKGR V++   FG+P +TKDGVTVAK I
Sbjct: 1   MAAKQLAFDVEARRALEKGVSTVAQAVKVTLGPKGRNVVLERKFGSPVITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ +  +GA++ R+VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +K+GI
Sbjct: 61  ELKDPYENMGAQLCREVASKTNDVAGDGTTTATVLAQAIMLEGLKNVAAGANPIFVKKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV+ +K     V S+E I  VA+I+AN    IGE IA AME++G  G+IT++++
Sbjct: 121 DRAVETVVDEIKKISIPVESKESIAHVASIAANERE-IGELIADAMEKVGKDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GM+ DRGY+SPYFVT+TE M AE E PYILI++KKISA+  LLP+LE  
Sbjct: 180 KGTATTVEVVEGMEFDRGYVSPYFVTNTEAMEAEFEEPYILIHEKKISAINDLLPLLEKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN++R  L   AVKAP FGDRRK ++ DIA + G T 
Sbjct: 240 VRTGKPLVIIAEDIEGEALATLVVNKLRGTLNCAAVKAPGFGDRRKAMMEDIAILTGGTF 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE   +  LG AKKV ++K+ TTIV G G  E ++GRI +I+K IE+T SDY
Sbjct: 300 LSEDLGVKLENVDLNMLGRAKKVKIAKEKTTIVEGYGKKEAVDGRIAQIKKQIEETDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L ATRAA +EGIVPGGG  LV
Sbjct: 360 DREKLQERLAKLAGGVAVIRVGAATETELKEKKHRVEDALAATRAAVEEGIVPGGGATLV 419

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
            A  A+       D+  G+ IVR+AL  P RQI  NAG E  +IV +++  +    G++A
Sbjct: 420 HAIPAVEKIQAEGDEAVGVRIVRRALEEPLRQIAANAGLEGSVIVERVRSEQ-PGIGFDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
            K  + DM + GI+DP KV R+ALQ+A S+A M+L TEA++ + PK+E A P MP GGGM
Sbjct: 479 VKEEYVDMIKAGIVDPAKVTRSALQNAASIASMLLTTEAIIAEIPKEEKA-PAMPPGGGM 537


>gi|259419033|ref|ZP_05742950.1| chaperonin GroL [Silicibacter sp. TrichCH4B]
 gi|259345255|gb|EEW57109.1| chaperonin GroL [Silicibacter sp. TrichCH4B]
          Length = 547

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 304/534 (56%), Positives = 408/534 (76%), Gaps = 1/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES+  N+G+N
Sbjct: 421 QAGKSLDGLTGVNADQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESEDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+P 
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPAKEGAAPA 534


>gi|99080438|ref|YP_612592.1| chaperonin GroEL [Ruegeria sp. TM1040]
 gi|118597124|sp|Q1GJ36|CH60_SILST RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|99036718|gb|ABF63330.1| chaperonin GroEL [Ruegeria sp. TM1040]
          Length = 547

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 304/534 (56%), Positives = 408/534 (76%), Gaps = 1/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES+  N+G+N
Sbjct: 421 QAGKSLEGLTGVNADQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESEDKNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+P 
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPAKEGAAPA 534


>gi|146278225|ref|YP_001168384.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025]
 gi|25452866|sp|Q93MH1|CH60_RHOPA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166201745|sp|A4WUL5|CH60_RHOS5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15290745|gb|AAK94943.1| GroEL [Rhodopseudomonas palustris]
 gi|145556466|gb|ABP71079.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17025]
          Length = 546

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 303/533 (56%), Positives = 406/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V  + E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVESIKAASRPVNDQHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+E+ +IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELEDVFILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQAQRPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KD+TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKVLDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESDDKAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+ ++A  
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPEPKSAPA 533


>gi|196233177|ref|ZP_03132024.1| chaperonin GroEL [Chthoniobacter flavus Ellin428]
 gi|196222821|gb|EDY17344.1| chaperonin GroEL [Chthoniobacter flavus Ellin428]
          Length = 544

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 291/548 (53%), Positives = 396/548 (72%), Gaps = 5/548 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK ++   AAR A+  GV  LA+AVK TLGP GR VI+   FG+P +TKDGVTVAK I
Sbjct: 1   MAAKQLQFDEAARQALLRGVEKLAKAVKATLGPAGRNVILDKKFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + +  +GA+++R+VA+ T D +GDGTTTAT LA+AIY EG K VTAG NPM ++RGI
Sbjct: 61  ELDDPYENMGAQLVREVASKTSDMAGDGTTTATVLAEAIYKEGLKNVTAGANPMSLQRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ +V  +    KKV  R EI QVAT+SAN D  IGE IA AM+++G  G IT+++A
Sbjct: 121 NKAVEALVNEISRISKKVKDRTEIAQVATVSANWDTTIGEIIADAMDKVGKDGTITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T + VV+GMQ D+GYISPYFVT+ E +   ++NPYILI++KKIS+L+ LLP+LE  
Sbjct: 181 KSIETTLDVVEGMQFDKGYISPYFVTNAESLEVILDNPYILIHEKKISSLKDLLPVLEKT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN++R  + V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNKLRGTIQVAAVKAPGFGDRRKAILEDIAILTGGRL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+ DLG AK++ + K++TTIV G+G +  I+GR+ +I++ IE+T SDY
Sbjct: 301 LSEDLGIKLENITLEDLGKAKRITIDKENTTIVEGSGKNTDIQGRVGQIRRQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVINVGAATETELKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA +AL       D+  G+ I+++A+  P RQ+  NAG E  LIVS++++ K  N GYN 
Sbjct: 421 RAQKALEAVKLEGDEAIGLAIIKRAIEAPLRQLADNAGQEGALIVSEVKKRK-GNEGYNV 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
               + D+ + G++DP KV R+ALQ A S++G++L TEAV+ + P+ E  +     G   
Sbjct: 480 ATGEYTDLIKAGVVDPAKVTRSALQHAASISGLLLTTEAVITELPEKEKPA----GGDAH 535

Query: 541 GGGMGGMD 548
           G G GGMD
Sbjct: 536 GHGPGGMD 543


>gi|320449187|ref|YP_004201283.1| chaperonin GroL [Thermus scotoductus SA-01]
 gi|320149356|gb|ADW20734.1| chaperonin GroL [Thermus scotoductus SA-01]
          Length = 542

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 291/542 (53%), Positives = 392/542 (72%), Gaps = 5/542 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A+AVK TLGP+GR V++   FG+P +TKDGVTVAK I 
Sbjct: 1   MAKILVFDEAARRALERGVNAVADAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            +NH   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LENHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +++    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIRSLAIPVEDRKAIEEVATISANDPD-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYF+T+ + M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFITNPDAMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL +IAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLLIAEDVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVKITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+AL+R
Sbjct: 360 KEKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVALLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  ++V +I    K    G+
Sbjct: 420 AISAVDELLKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVVVQRILSETKNLRLGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    + DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P  P GG
Sbjct: 480 NAATGEYVDMVEAGIVDPAKVTRSALQNAASIGSLILTTEAVVAEKPEKKESTPA-PTGG 538

Query: 539 GM 540
            M
Sbjct: 539 DM 540


>gi|307313307|ref|ZP_07592931.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|306899320|gb|EFN29955.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 542

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 318/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANHDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|307320760|ref|ZP_07600171.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|306893578|gb|EFN24353.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
          Length = 542

 Score =  498 bits (1282), Expect = e-139,   Method: Composition-based stats.
 Identities = 317/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + +++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIDEENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANHDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|154248184|ref|YP_001419142.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
 gi|154162269|gb|ABS69485.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
          Length = 543

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 321/550 (58%), Positives = 412/550 (74%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V+ L +N +KV S +EI QV TISANGD E+G+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E PYILI +KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 VQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KL+   ++ LG AKKVV+ K++TTIV G+G    IE RI +I+  IE T SDY
Sbjct: 301 ISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K +ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R+ +AL  +K DN DQ  GIEIVR+A+  P RQI+ NAGD+  ++V KI ES   ++GYN
Sbjct: 421 RSIKALEGLKVDNADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + DM + GIIDP KVVR ALQ A S++G+++ TEA++ + PK    +P  PA  G
Sbjct: 481 AQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKK--NAPAAPAMPG 538

Query: 540 MGGGMGGMDM 549
                GGMD 
Sbjct: 539 -----GGMDF 543


>gi|16264754|ref|NP_437546.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|17380427|sp|P35471|CH605_RHIME RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|15140892|emb|CAC49406.1| putative heat shock protein groEL [Sinorhizobium meliloti 1021]
          Length = 542

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 318/541 (58%), Positives = 416/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E A+P +PAGGG
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE-AAPALPAGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|58040332|ref|YP_192296.1| chaperonin GroEL [Gluconobacter oxydans 621H]
 gi|68566253|sp|Q5FPQ6|CH60_GLUOX RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|58002746|gb|AAW61640.1| Chaperonin GroEL [Gluconobacter oxydans 621H]
 gi|77539353|dbj|BAE46549.1| GroEL [Gluconobacter oxydans]
          Length = 543

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 321/550 (58%), Positives = 412/550 (74%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ LK+N KK+ S EEI QV TISANG+ EIGE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++++PYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IG+KLE  T+  LG AKK+ + K++TTIV G G S+ I+GR N+I+  IE+T SDY
Sbjct: 301 ISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ AL  +  DN+DQ  G EIVRKAL  P RQI  NAG++  +I  K+ E++   +G++
Sbjct: 421 RASSALKGLTFDNDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQK  + D+   GIIDP KVVR ALQ A S+ G+++ TEA+V + P+ +  +        
Sbjct: 481 AQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAMVAERPEKKAPAAA------ 534

Query: 540 MGGGMGGMDM 549
             GGMG MD 
Sbjct: 535 -PGGMGDMDF 543


>gi|46200016|ref|YP_005683.1| chaperonin GroEL [Thermus thermophilus HB27]
 gi|55980240|ref|YP_143537.1| chaperonin GroEL [Thermus thermophilus HB8]
 gi|47606738|sp|P61490|CH60_THET2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|66773877|sp|Q5SLM2|CH60_THET8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|50514033|pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514034|pdb|1WE3|B Chain B, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514035|pdb|1WE3|C Chain C, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514036|pdb|1WE3|D Chain D, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514037|pdb|1WE3|E Chain E, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514038|pdb|1WE3|F Chain F, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514039|pdb|1WE3|G Chain G, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514040|pdb|1WE3|H Chain H, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514041|pdb|1WE3|I Chain I, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514042|pdb|1WE3|J Chain J, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514043|pdb|1WE3|K Chain K, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514044|pdb|1WE3|L Chain L, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514045|pdb|1WE3|M Chain M, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514046|pdb|1WE3|N Chain N, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514054|pdb|1WF4|AA Chain a, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514055|pdb|1WF4|BB Chain b, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514056|pdb|1WF4|CC Chain c, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514057|pdb|1WF4|DD Chain d, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514058|pdb|1WF4|EE Chain e, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514059|pdb|1WF4|FF Chain f, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514060|pdb|1WF4|GG Chain g, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514061|pdb|1WF4|HH Chain h, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514062|pdb|1WF4|II Chain i, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514063|pdb|1WF4|JJ Chain j, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514064|pdb|1WF4|KK Chain k, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514065|pdb|1WF4|LL Chain l, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514066|pdb|1WF4|MM Chain m, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514067|pdb|1WF4|NN Chain n, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|1066158|dbj|BAA08299.1| chaperonin-60 [Thermus thermophilus]
 gi|46197643|gb|AAS82056.1| 60 kDa chaperonin groEL [Thermus thermophilus HB27]
 gi|55771653|dbj|BAD70094.1| 60 kDa chaperonin (Protein Cpn60) (GroEL protein) [Thermus
           thermophilus HB8]
 gi|1581936|prf||2117332B chaperonin 60
          Length = 543

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 297/551 (53%), Positives = 391/551 (70%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIKALAIPVEDRKAIEEVATISANDPE-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  +IV +I    K   YG+
Sbjct: 420 AISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --SAGAGDMDF 543


>gi|229542562|ref|ZP_04431622.1| chaperonin GroEL [Bacillus coagulans 36D1]
 gi|229326982|gb|EEN92657.1| chaperonin GroEL [Bacillus coagulans 36D1]
          Length = 541

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 283/543 (52%), Positives = 378/543 (69%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK G  AR  +  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFGEEARRGMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ I++GI+
Sbjct: 61  LEDAFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +  I QVA IS+  D E+GE IA AME++G  G+ITI+++K
Sbjct: 121 KAVAAAVEELKAISKPIEGKASIAQVAAISSA-DEEVGELIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             +TE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFSTELDVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIATLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ ATI  LG A KVV++K+ TTIV G G S  I  R+N+I+  +E+T S++D
Sbjct: 300 TEELGLDLKSATIDQLGRAGKVVVTKETTTIVEGAGDSAAISARVNQIRMQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + ++      D   GI IV +AL  P RQI +NAG E  +IV +++  +    GYNA 
Sbjct: 420 VIKKVASIQAEGDVQTGINIVARALEEPVRQIAENAGLEGSVIVERLK-KEDVGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P+    +       GMG
Sbjct: 479 NGEWVNMIEAGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEPPAPAGGGAPDMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|268317470|ref|YP_003291189.1| chaperonin GroEL [Rhodothermus marinus DSM 4252]
 gi|25452896|sp|Q9XCA9|CH60_RHOMR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|5020010|gb|AAD37976.1|AF145252_2 heat shock protein GroEL [Rhodothermus marinus]
 gi|262335004|gb|ACY48801.1| chaperonin GroEL [Rhodothermus marinus DSM 4252]
          Length = 540

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 310/550 (56%), Positives = 401/550 (72%), Gaps = 11/550 (2%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR A+  GV+ LA+AVK TLGPKGR VII   FGAP VTKDGVTVAK I
Sbjct: 1   MAAKQITFNADARMALKRGVDKLADAVKVTLGPKGRNVIIEKKFGAPTVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++    VGA+M+++VA+ T D +GDGTTTAT LAQAI   G K VTAG NPMD+KRGI
Sbjct: 61  ELEDKLENVGAQMVKEVASKTSDVAGDGTTTATVLAQAILTAGLKSVTAGANPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L+   ++V  +  I QVATISANGD+ IG+ IA A E++G  G+IT+++A
Sbjct: 121 DKAVEVVVAELRKMSQEVQDKNRIAQVATISANGDKAIGQLIADAFEKVGKDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT+ + M A +E+ YILI+DKKISA++ LLPILE  
Sbjct: 181 KGTETTLEVVEGMQFDRGYLSPYFVTNPDTMEAVLEDAYILIHDKKISAMKDLLPILEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGRPLLIIAEDVEGEALATLVVNKLRGVLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LE AT+  LG A+++++ KD+TTIVGG G   +I+ R N+I++ IE+T SDY
Sbjct: 301 ISEEKGYRLENATLDYLGQAERIIVDKDNTTIVGGKGDPAQIKARANQIRQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAVL++G  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLAGGVAVLKIGAATEPEMKEKKARVEDALHATRAAVEEGIVPGGGVAYI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  V+ +NEDQ  G++IV++AL  P RQI  NAG E  ++V +++E +  ++G+N
Sbjct: 421 RAIAALDKVEVENEDQKIGVQIVQRALEEPLRQIAANAGWEGSIVVQRVKEGQ-GDFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FG++ E G+IDP KV R AL++A S+AG++L TEAVV + P+ E A+   P    
Sbjct: 480 AQTEEFGNLLEQGVIDPTKVARTALENAASVAGLLLTTEAVVAEKPEKEKAAAPSP---- 535

Query: 540 MGGGMGGMDM 549
                G MD 
Sbjct: 536 -----GDMDF 540


>gi|251773431|gb|EES53980.1| chaperonin GroEL [Leptospirillum ferrodiazotrophum]
          Length = 542

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 289/543 (53%), Positives = 386/543 (71%), Gaps = 1/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +     AR A+  GV  LA+AVK TLGPKGR  +I   FGAP +TKDGVTVAK + 
Sbjct: 1   MAKQMVYSDEARSAVLRGVTALADAVKVTLGPKGRNAVIDKKFGAPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            K+ +  +GA+++++VA+ T D +GDGTTTAT LA AIY EG K VTAG N MDIKRGID
Sbjct: 61  LKDPYENMGAQLVKEVASKTSDIAGDGTTTATVLAHAIYREGVKNVTAGANSMDIKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LAV  V+E LK   K    ++EI Q+ATISAN D EIG  IA AM+++G  G+IT+++AK
Sbjct: 121 LAVAAVIEELKKLSKPCQDKKEIAQIATISANNDAEIGRLIADAMDKVGKDGVITVEEAK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           + +T + VV+GMQ DRGY+SPYFVT  ERM   ++NPYILI++KKIS ++ LLPILE   
Sbjct: 181 SMSTSLDVVEGMQFDRGYVSPYFVTDQERMEVVLDNPYILIHEKKISNMKDLLPILEQIA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           + GRPL IIAE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA +   T+I
Sbjct: 241 KMGRPLLIIAEEVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKAMLEDIAVLTSGTMI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GLKLE   ++DLG AK+V + KD+TTIV G G   +I+ R+ +I+  IE++ SDYD
Sbjct: 301 AEDLGLKLENVKLSDLGRAKRVSIDKDNTTIVEGAGEHAKIQARVKQIKAQIEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAK+ GGVAV+ VG  TE  + EKK R +D+L AT+AA +EGIVPGGG+AL+R
Sbjct: 361 REKLQERLAKIVGGVAVINVGAATETEMKEKKARVEDALHATKAAVEEGIVPGGGVALLR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           ++  L       DQ  G+ I+++AL  P RQI  NAG E  +++ K++  K  + G++A 
Sbjct: 421 SSAVLDHLKAEGDQKIGVNIIKRALEEPLRQISHNAGLEGSVVLQKVRSEK-GSMGFDAA 479

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM + GIIDP KV R+ALQ+A S++G++L TE ++ D P+ E   P MP  GGMG
Sbjct: 480 TETYVDMIQAGIIDPTKVTRSALQNAASVSGLLLTTEVMICDIPEKEAKGPAMPGAGGMG 539

Query: 542 GGM 544
              
Sbjct: 540 DMY 542


>gi|313673978|ref|YP_004052089.1| chaperonin groel [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940734|gb|ADR19926.1| chaperonin GroEL [Calditerrivibrio nitroreducens DSM 19672]
          Length = 541

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 312/549 (56%), Positives = 396/549 (72%), Gaps = 9/549 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I     AR AI  GV+ LA AVK TLGPKGR V+I   FG+P VTKDGVTVAK I 
Sbjct: 1   MAKAITFSEEARQAILRGVDKLANAVKVTLGPKGRNVVIEKKFGSPLVTKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            K+    +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGID
Sbjct: 61  LKDALENLGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGIKNVVAGSNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ VV  LK   K +  ++EI QV TISAN D EIG  IA AME++G  G+ITI++ K
Sbjct: 121 KAVEAVVAELKKMSKPIQGKKEIAQVGTISANNDPEIGNIIADAMERVGKDGVITIEENK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + VV+GMQ DRGY+SPYFVT  E M A +ENPY+LI DKKIS ++ LLPILE   
Sbjct: 181 STDTVLDVVEGMQFDRGYLSPYFVTDPENMEAILENPYLLICDKKISNMKELLPILEQLA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +   P  IIAED+EG+ALATLVVN++R  L   AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 241 KQNAPFLIIAEDIEGEALATLVVNKLRGTLNCCAVKAPGFGDRRKEMLKDIAILTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GLKLE A ++DLG AKKVV+ K++TTIV G G +E I+ R+N I+K IE+T SDYD
Sbjct: 301 SEELGLKLENAKLSDLGRAKKVVVEKENTTIVEGAGKTEDIQARVNVIKKQIEETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L AT+AA +EGIVPGGG+AL+R
Sbjct: 361 REKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATKAAVEEGIVPGGGVALLR 420

Query: 422 AAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A++A++   D   DQ  G +IVR+AL YP RQI  NAG E  ++V+KI E++   +G++A
Sbjct: 421 ASRAIANLKDLTPDQKVGADIVRRALEYPVRQIASNAGFEGSIVVNKILEAEKDTFGFDA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
              ++ DM E GIIDP KV R+ALQ+A S+AG+ML TEA++ + P+ +   P MP  G  
Sbjct: 481 HAEIYTDMIEAGIIDPTKVTRSALQNAASVAGLMLTTEAMITEIPEKKE--PAMPNPGM- 537

Query: 541 GGGMGGMDM 549
                GMDM
Sbjct: 538 -----GMDM 541


>gi|163793752|ref|ZP_02187726.1| feruloyl-CoA synthase [alpha proteobacterium BAL199]
 gi|159180863|gb|EDP65380.1| feruloyl-CoA synthase [alpha proteobacterium BAL199]
          Length = 547

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 300/529 (56%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGIDARNKMLRGVDILADAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+   D++GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVREGGKAVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L+   KK+ + +++ QV TISANG+REIG  IA AME++G  G+IT+++A
Sbjct: 121 DAAVEAVVADLEKRSKKISTSDQVAQVGTISANGEREIGAMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYIL+++KK+S LQ +LP+LE  
Sbjct: 181 KSLHTELDVVEGMQFDRGYLSPYFVTNADKMVCELESPYILLHEKKVSNLQAMLPVLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G++LE  T+  LG+ K++ ++KD+TTIV G G  + IE R  +I+  +EDT SDY
Sbjct: 301 VSEDLGIQLENVTLDMLGTTKRISITKDETTIVDGAGKKKDIEARCAQIRAQVEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGILPGGGAALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A ++L  +K  N+DQ  G+ IVR+AL  P RQI  NAG +  +IV K+ ESK  N+G++
Sbjct: 421 YAIRSLEKLKAVNDDQRMGMNIVRRALEAPARQIATNAGHDGSVIVGKLLESKDPNWGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   F D+ + GIIDP KVVR+ALQ+A S+AG+++ TEA+V D P+ +
Sbjct: 481 AQNGEFVDLIKAGIIDPTKVVRSALQNAASIAGLLVTTEAMVADKPEPK 529


>gi|103487560|ref|YP_617121.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
 gi|118597101|sp|Q1GRD4|CH602_SPHAL RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|98977637|gb|ABF53788.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256]
          Length = 539

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 313/550 (56%), Positives = 409/550 (74%), Gaps = 12/550 (2%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGSKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV+ L+ + KKV +  EI QVATISANGD E+G  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVKAVVKDLETHAKKVSANSEIAQVATISANGDEEVGRILAEAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+  V+GMQ DRGY+SPYF+T+ E++  E+++PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLATELETVEGMQFDRGYLSPYFITNAEKLKVELDDPYILIHEKKLSNLQAMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGNV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKVV+ KD+TTIV G G    I+ RI +I++ I+ T SDY
Sbjct: 301 VSEDLGIKLENVTVNMLGRAKKVVIDKDNTTIVDGVGARTDIDARIAQIRQQIDTTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N+DQ +GI+IVR+AL  P RQI  NAG++   IV K+ ES   N+G+N
Sbjct: 421 RALKALDGLKAANDDQQSGIDIVRRALRAPARQIADNAGEDGAWIVGKLLESSDYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V + PK+E A+P       
Sbjct: 481 AATGEYEDLVKAGVIDPAKVVRTALQDAASVAALLITTEALVAELPKEEKAAP------- 533

Query: 540 MGGGMGGMDM 549
               M  MD 
Sbjct: 534 ----MPAMDF 539


>gi|126461754|ref|YP_001042868.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17029]
 gi|166201744|sp|A3PID0|CH60_RHOS1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|126103418|gb|ABN76096.1| chaperonin GroEL [Rhodobacter sphaeroides ATCC 17029]
          Length = 547

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 301/532 (56%), Positives = 406/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+++ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKK+ ++KD+TTIV GNG    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKISINKDNTTIVDGNGDKAEIDARVAQIRNQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QGGKALDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESNEKSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+ ++ +
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPEPKSPA 532


>gi|77462862|ref|YP_352366.1| chaperonin GroEL [Rhodobacter sphaeroides 2.4.1]
 gi|221638732|ref|YP_002524994.1| chaperonin GroEL [Rhodobacter sphaeroides KD131]
 gi|332557753|ref|ZP_08412075.1| chaperonin GroEL [Rhodobacter sphaeroides WS8N]
 gi|2506273|sp|P20110|CH601_RHOSH RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|119366188|sp|Q3J419|CH601_RHOS4 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|1208543|gb|AAB41336.1| chaperonin 60 [Rhodobacter sphaeroides]
 gi|77387280|gb|ABA78465.1| Chaperonin Cpn60 (GroEL) [Rhodobacter sphaeroides 2.4.1]
 gi|221159513|gb|ACM00493.1| 60 kDa chaperonin 1 [Rhodobacter sphaeroides KD131]
 gi|332275465|gb|EGJ20780.1| chaperonin GroEL [Rhodobacter sphaeroides WS8N]
          Length = 547

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 301/532 (56%), Positives = 406/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++MTAE+++ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKK+ ++KD+TTIV GNG    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKISINKDNTTIVDGNGDKAEIDARVAQIRNQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G+N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QGGKALDGLTGENPDQNAGITIVRRALEAPLRQIAQNAGVDGSVVAGKVRESNEKSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+ ++ +
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLITTEAMIADKPEPKSPA 532


>gi|6689422|emb|CAB65482.1| chaperonin-60 [Thermus thermophilus HB27]
          Length = 543

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 297/551 (53%), Positives = 390/551 (70%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIKAPAIPVEDRKAIEEVATISANDPE-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI  KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVKKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  +IV +I    K   YG+
Sbjct: 420 AISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --SAGAGDMDF 543


>gi|227818754|ref|YP_002822725.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|75519427|sp|Q6W1D5|CH602_RHISN RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|36959008|gb|AAQ87433.1| 60 kDa chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227337753|gb|ACP21972.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 316/530 (59%), Positives = 407/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++  T AR+ +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVRFHTEAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE L+ N +KV   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVDAVVEELRRNARKVTKNDEIAQVGTISANGDTEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PY+LI++KK+S LQ LLP+LES 
Sbjct: 181 KTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYVLIHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKKVVVEKENTTIVDGAGSKTEIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  V+ +N DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E     YG+N
Sbjct: 421 RAVKALDRVQTENPDQRHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFGYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ + FGD+FE G+IDPVKVVR ALQ A S+AG+++ TEA+V + PK E 
Sbjct: 481 AQTNEFGDLFEQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKKEA 530


>gi|116250|sp|P26209|CH60_BACP3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock 61 kDa protein; AltName:
           Full=Protein Cpn60
          Length = 538

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 284/540 (52%), Positives = 378/540 (70%), Gaps = 2/540 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K V AG NPM I+RGI+
Sbjct: 61  LEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  +E I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIKGKESIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY+SP  +T TE+M A +ENPYILI DKK+S++Q LLP LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYVSPNMITDTEKMEAVLENPYILITDKKVSSIQELLPALEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIAEDVEG+ALATLVVN++R     + VKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVRVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +L+  TIA LG A KVV++K+ TTIV G G S+RI+  IN+I+  +++T S++D
Sbjct: 300 SEELGRELKSTTIASLGRASKVVVTKETTTIVEGAGDSKRIKAAINQIRAQLKETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGI  GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIGAGGGTALMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G++IV +A+  P RQI +NAG E  +IV +++  K    G+NA 
Sbjct: 420 IHNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLEGSIIVERLKNEK-PGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GI+DP KV R+ALQ+A S+A M+L TEA V D P++   +  MP  GGM 
Sbjct: 479 TGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEACVADKPEENKGNNNMPDMGGMM 538


>gi|329114548|ref|ZP_08243307.1| 60 kDa chaperonin 1 [Acetobacter pomorum DM001]
 gi|326696028|gb|EGE47710.1| 60 kDa chaperonin 1 [Acetobacter pomorum DM001]
          Length = 546

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 308/533 (57%), Positives = 403/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENNDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A  
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAAPA 533


>gi|315186519|gb|EFU20278.1| chaperonin GroEL [Spirochaeta thermophila DSM 6578]
          Length = 542

 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 292/542 (53%), Positives = 374/542 (69%), Gaps = 4/542 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +K    AR  +  GV  LA AVK TLGP+GR V++   FGAP VTKDGV+VAK I 
Sbjct: 1   MAKQLKFDEEARRKLLSGVEKLANAVKVTLGPRGRNVLLDKKFGAPTVTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++++VAT T D +GDGTTTAT LA +I  EG K V AG NPM +KRGID
Sbjct: 61  LPDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSIVKEGLKAVAAGANPMALKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
             V  VVE ++ N K++  R+EI  VA ISAN D EIGE+IA AME++G  G+IT++++K
Sbjct: 121 KTVDLVVEEIRKNAKEIKDRDEIAHVAAISANNDMEIGEEIANAMEKVGKDGVITVEESK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T    V+GMQ DRGY+S YFV + E MT  + +PYILI+DKKIS ++ LLPILE   
Sbjct: 181 TIETTTEFVEGMQFDRGYVSAYFVNNRETMTCVLNDPYILIHDKKISNMKDLLPILEKVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+P+ IIAEDVEG+ALATLVVN VR  L   AVKAP FGDRRK +L DIA + G  VI
Sbjct: 241 QQGKPILIIAEDVEGEALATLVVNTVRGTLQACAVKAPGFGDRRKAMLEDIAILTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GLKLE   ++ LG A  V ++KDDTTIV G G S+ I+ RI +I+  IE+T SDYD
Sbjct: 301 SEELGLKLENVELSQLGRAGSVKVTKDDTTIVSGAGDSKAIKDRIAQIKAQIEETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+  + 
Sbjct: 361 REKLQERLAKLAGGVAVINVGAATEVELKEKKHRVEDALSATRAAIEEGIVPGGGLTYII 420

Query: 422 AAQAL---SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           A +AL    +    ED+  G +IV++AL  P RQI  NAG +  +IV + +E K    G+
Sbjct: 421 ATKALDQVDLSSWEEDEKIGFKIVKRALEEPMRQIAANAGLDGSIIVQRAREEK-KGVGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A K  + DM + GIIDP KV R+ALQ+A S+AG++L TE  V D P++E  +P  P  G
Sbjct: 480 DAAKMEWVDMMKAGIIDPAKVTRSALQNAASVAGLLLTTECAVTDIPEEEKKTPGTPDMG 539

Query: 539 GM 540
             
Sbjct: 540 MD 541


>gi|258542859|ref|YP_003188292.1| chaperonin GroEL [Acetobacter pasteurianus IFO 3283-01]
 gi|262527536|sp|Q8GBD2|CH60_ACEP3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|256633937|dbj|BAH99912.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-01]
 gi|256636996|dbj|BAI02965.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-03]
 gi|256640049|dbj|BAI06011.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-07]
 gi|256643105|dbj|BAI09060.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-22]
 gi|256646160|dbj|BAI12108.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-26]
 gi|256649213|dbj|BAI15154.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-32]
 gi|256652200|dbj|BAI18134.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655257|dbj|BAI21184.1| heat shock protein GroEL [Acetobacter pasteurianus IFO 3283-12]
          Length = 546

 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 308/533 (57%), Positives = 403/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A  
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAAPA 533


>gi|167038116|ref|YP_001665694.1| chaperonin GroEL [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039172|ref|YP_001662157.1| chaperonin GroEL [Thermoanaerobacter sp. X514]
 gi|256750856|ref|ZP_05491740.1| chaperonin GroEL [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913233|ref|ZP_07130550.1| chaperonin GroEL [Thermoanaerobacter sp. X561]
 gi|307723753|ref|YP_003903504.1| chaperonin GroEL [Thermoanaerobacter sp. X513]
 gi|320116522|ref|YP_004186681.1| chaperonin GroEL [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|226704183|sp|B0KBR3|CH60_THEP3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704184|sp|B0K3P6|CH60_THEPX RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166853412|gb|ABY91821.1| chaperonin GroEL [Thermoanaerobacter sp. X514]
 gi|166856950|gb|ABY95358.1| chaperonin GroEL [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750191|gb|EEU63211.1| chaperonin GroEL [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889918|gb|EFK85063.1| chaperonin GroEL [Thermoanaerobacter sp. X561]
 gi|307580814|gb|ADN54213.1| chaperonin GroEL [Thermoanaerobacter sp. X513]
 gi|319929613|gb|ADV80298.1| chaperonin GroEL [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 541

 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 290/551 (52%), Positives = 381/551 (69%), Gaps = 12/551 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK G  AR A+  GVN +A+ VK TLGP+GR V++   +G+P VT DGVT+A+ I 
Sbjct: 1   MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F   GA+++++VAT T D +GDGTTTAT LAQA+  EG K + AG NPM ++RGI 
Sbjct: 61  LEDPFENQGAQLLKEVATKTNDVAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K + ++E I  VA+ISA  D EIG  IA AM+++G  G+IT++++K
Sbjct: 121 KAVDAAVEGLKRISKPIDNKESIAHVASISAA-DEEIGNLIAEAMDKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GMQ DRGYISPY VT  E+M A +E P ILI DKK+S +Q LLP+LE   
Sbjct: 180 TLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSNIQDLLPLLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIA+DVEG+ALATLVVN++R     +AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QHGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G  L+   +  LG A++V ++K++TTIVGG G +  I+ R+N+I+  IE+T SDYD
Sbjct: 300 SEELGYDLKDVRLDMLGRARQVKVTKENTTIVGGAGDAAEIKKRVNQIKAQIEETTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++ G  TE  L EKK R +D+L AT+AA +EGIVPGGGIAL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLN 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             + +    D+   D   G +IV +AL  P RQI  NAG +  +IV KI+ +K  N+GY+
Sbjct: 420 VIEDVQKVVDSLDGDFKTGAKIVLRALEEPVRQIAANAGVDGSVIVEKIKAAKDPNFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A K  F DMF+ GI+DP KV R ALQ+A S+A M+L TEAVVVD P+  TA P   A   
Sbjct: 480 AYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAVVVDVPEKNTAMPNPGA--- 536

Query: 540 MGGGMGGMDMM 550
                 GMDMM
Sbjct: 537 ------GMDMM 541


>gi|53803988|ref|YP_114145.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath]
 gi|68566273|sp|Q607Q3|CH602_METCA RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|53757749|gb|AAU92040.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath]
          Length = 542

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 310/545 (56%), Positives = 399/545 (73%), Gaps = 4/545 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++    AR  +  GVN LA+AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVRFSDDARHRMLAGVNILADAVKQTLGPKGRNVVLEKSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMDIKRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGLKSVAAGANPMDIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK   K     + I QV TISAN D  IG+ IA AM+ +G  G+IT+++ 
Sbjct: 121 DQAVGVVVEELKKLSKPCTDSKAIAQVGTISANSDESIGQIIAQAMDTVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   + M  E+ENPY+L++DKKIS+++ LLP+LE  
Sbjct: 181 SGLQNELDVVEGMQFDRGYLSPYFINKQDTMGVELENPYVLLHDKKISSIRDLLPVLEKT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GR L IIAEDV+G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRSLLIIAEDVDGEALATLVVNNMRGILKVCAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEK  + DLG AKK+ ++K+ TTIV G G ++ I+ R+ +I+K IEDT SDY
Sbjct: 301 ISEELGLSLEKVELTDLGQAKKIQINKETTTIVDGAGSADAIKARVEQIRKQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QAL  ++G N DQ  GI I+R+A+  P RQI+ NAG+E  ++++K+QE  T  +GYN
Sbjct: 421 RAQQALKTLEGKNHDQTVGIAILRRAIEEPLRQIVANAGEEPSVVLAKVQEG-TGTFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A  + +GDM EMGI+DP KV R+ALQ+A S+AG+ML TEA+V + PK E     MPAGGG
Sbjct: 480 AGTAEYGDMIEMGILDPTKVTRSALQNAASVAGLMLTTEAMVAEMPKKEKGG--MPAGGG 537

Query: 540 MGGGM 544
           M   M
Sbjct: 538 MDDMM 542


>gi|15643272|ref|NP_228316.1| chaperonin GroEL [Thermotoga maritima MSB8]
 gi|14916540|sp|Q9WYX6|CH60_THEMA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|4981018|gb|AAD35591.1|AE001727_3 groEL protein [Thermotoga maritima MSB8]
          Length = 538

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 272/536 (50%), Positives = 379/536 (70%), Gaps = 3/536 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K +K    AR A+  GV+ +A AVK TLGPKGR V+I  S+G+P +T DGV++AK I 
Sbjct: 1   MPKILKFNEEARRALERGVDKVANAVKVTLGPKGRNVVIEKSWGSPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQA+  EG K V AG NP+ +KRGID
Sbjct: 61  LEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV++ VE +K   KK+  RE+I  VA ISAN    IGE IA AM+++G  G+IT++ +K
Sbjct: 121 KAVEKAVEEIKKVSKKLSGREDIAHVAAISANSAE-IGELIAEAMDKVGEDGVITVEDSK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V   +GMQ DRGYISPYFVT  E+M   ++ P+ILI D+K+SA++PL+PILE   
Sbjct: 180 TLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPFILITDRKLSAVKPLIPILEKVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL +IAEDVEG+ L TLV+N+++  L   AVKAP FG+RRK +L+DIA + G  V 
Sbjct: 240 QTGKPLLVIAEDVEGEVLTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVA 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ LE  T+ DLG A  V + KD+T I+GG G  E I+ RI +I+  IE+T S+Y+
Sbjct: 300 SEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++ L+ER+AKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 KETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A +A+    +    D+  G +IV KALS P +QI +NAG +  +I+ KI  +    YG++
Sbjct: 420 ARKAVEKVIEELEGDEKIGAQIVYKALSAPIKQIAENAGYDGAVIIEKILSNDDPAYGFD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A +  + +MFE GIIDP KV R+ALQ+A S+AGM+L TE ++V+ P+++  +P MP
Sbjct: 480 ALRGEYCNMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLIVEKPEEKKETPSMP 535


>gi|153006553|ref|YP_001380878.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5]
 gi|187470681|sp|A7HGP8|CH602_ANADF RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|152030126|gb|ABS27894.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5]
          Length = 547

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 299/533 (56%), Positives = 393/533 (73%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MASKEIIFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQA+Y EG K V AG NPM+IKRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQALYREGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK   K    ++EI QV  ISANGD  IG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVEIIVGELKKLSKPTKDQKEIAQVGIISANGDETIGNIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM A +E+ YILI++KKIS ++ LLP+LE  
Sbjct: 181 KGLETTLEVVEGMQFDRGYLSPYFVTDAERMVANLEDAYILIHEKKISNMKDLLPLLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 ARSGKPLLIVAEEVEGEALATLVVNKLRGTLHVAAVKAPGFGDRRKAMLEDIAILTGGRM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE+ ++ DLG AK++ + KD+TTIV G G    IE R+  I+  IE+T SDY
Sbjct: 301 IAEELGLKLEQVSLKDLGRAKRISIDKDNTTIVDGAGQKADIEARVKTIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA +AL     +E +  G++IVR+AL  P RQI  N G E+ ++V+K++ESK  N+G+NA
Sbjct: 421 RAVKALEGVKVSEGEKFGLDIVRRALEEPLRQIAGNGGYEASIVVNKVKESKDTNFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
               + D+ + G+IDP KV R+ALQ+A S+A +ML T A+V + PK+E+A+P 
Sbjct: 481 ATGDYEDLVKSGVIDPTKVSRSALQNASSVASLMLTTMALVAEKPKEESAAPA 533


>gi|159045459|ref|YP_001534253.1| chaperonin GroEL [Dinoroseobacter shibae DFL 12]
 gi|189082351|sp|A8LJP9|CH60_DINSH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157913219|gb|ABV94652.1| 60 kDa chaperonin [Dinoroseobacter shibae DFL 12]
          Length = 547

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 305/529 (57%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDIDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKSAARPVNDSAEVAQVGTISANGESEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDAIILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTIDMLGSAKRVSITKDETTIVDGAGAKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L  ++G N DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAAKHLDGLEGANNDQNIGINIVRKALEAPLRQIAENAGVDGSVVAGKIRESSDLAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADKPAKE 529


>gi|83854816|ref|ZP_00948346.1| chaperonin GroEL [Sulfitobacter sp. NAS-14.1]
 gi|83941339|ref|ZP_00953801.1| chaperonin GroEL [Sulfitobacter sp. EE-36]
 gi|83842659|gb|EAP81826.1| chaperonin GroEL [Sulfitobacter sp. NAS-14.1]
 gi|83847159|gb|EAP85034.1| chaperonin GroEL [Sulfitobacter sp. EE-36]
          Length = 549

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 300/533 (56%), Positives = 404/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K GT AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFGTDARNKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A   VVE +KA  + V   +E+ QV TISANG++EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATTTVVEAIKAAARPVNDSDEVAQVGTISANGEKEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDAIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVTITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKKLEGLTGDNADQNVGIGIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  +  + 
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPSKDGGAA 533


>gi|307267548|ref|ZP_07549026.1| chaperonin GroEL [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390926|ref|ZP_08212477.1| chaperonin GroEL [Thermoanaerobacter ethanolicus JW 200]
 gi|2493642|sp|Q60024|CH60_THEBR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|1326191|gb|AAB00559.1| chaperonin 60 [Thermoanaerobacter brockii]
 gi|306917427|gb|EFN47723.1| chaperonin GroEL [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993074|gb|EGD51515.1| chaperonin GroEL [Thermoanaerobacter ethanolicus JW 200]
          Length = 541

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 287/551 (52%), Positives = 378/551 (68%), Gaps = 12/551 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK G  AR A+  GVN +A+ VK TLGP+GR V++   +G+P VT DGVT+A+ I 
Sbjct: 1   MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F   GA+++++ AT T D +GDGTTTAT LAQA+  EG K + AG NPM ++RGI 
Sbjct: 61  LEDPFENQGAQLLKEAATKTNDIAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K + ++E I  VA+ISA  D EIG+ IA AM+++G  G+IT++++K
Sbjct: 121 KAVDAAVEGLKRISKPIDNKESIAHVASISAA-DEEIGKLIAEAMDKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GMQ DRGYISPY VT  E+M A +E P ILI DKKIS +Q LLP+LE   
Sbjct: 180 TLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKISNIQDLLPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIA+DVEG+ALATL+VN++R     +AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QQGKKLLIIADDVEGEALATLIVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G  L+   +  LG A++V ++K+ TTIVGG G    I+ R+N+I+  IE+T SDYD
Sbjct: 300 SEELGYDLKDVRLDMLGRARQVKVTKEYTTIVGGAGDPSEIKKRVNQIKAQIEETTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++ G  TE  L EKK R +D+L AT+AA +EGIVPGGGIAL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLN 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             + +    D+   D   G +IV +AL  P RQI  NAG +  +IV KI+ +K  N+GY+
Sbjct: 420 VIEDVQKVVDSLEGDFKTGAKIVLRALEEPVRQIATNAGVDGSVIVEKIKAAKDPNFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A K  F DMF+ GI+DP KV R ALQ+A S+A M+L TEA+VVD P+  T  P   A   
Sbjct: 480 AYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAIVVDIPEKNTGMPNPGA--- 536

Query: 540 MGGGMGGMDMM 550
                 GMDMM
Sbjct: 537 ------GMDMM 541


>gi|218297029|ref|ZP_03497706.1| chaperonin GroEL [Thermus aquaticus Y51MC23]
 gi|218242584|gb|EED09121.1| chaperonin GroEL [Thermus aquaticus Y51MC23]
          Length = 543

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 298/551 (54%), Positives = 392/551 (71%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A+AVK TLGP+GR V++   FG+P +TKDGVTVAK I 
Sbjct: 1   MAKILVFDEAARRALERGVNAVADAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            +NH   +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LENHLENIGAQLLREVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVDAAVEKIKALAIPVEDRKAIEEVATISANDPD-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPEAMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL +IAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLLIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+AL+R
Sbjct: 360 KEKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVALLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K  + D+  G +IVR+AL  P RQI +NAG E  +IV +I    K    G+
Sbjct: 420 AIGAVEELLKKLDGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILSETKNLRLGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --PAGAGDMDF 543


>gi|225849492|ref|YP_002729657.1| chaperonin GroEL [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644051|gb|ACN99101.1| chaperonin GroL [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 543

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 301/550 (54%), Positives = 394/550 (71%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  +  GV+ LA AVK TLGP+GR VI+   +G+P VTKDGV+VAK I
Sbjct: 1   MAAKRLVYGDEARAKLKAGVDKLANAVKVTLGPRGREVILEKKWGSPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + +  + A+++++VA+ T D +GDGTTTAT L QAIY EG K + +G NP+ +KRGI
Sbjct: 61  ELADPYENMAAQLVKEVASKTADVAGDGTTTATILTQAIYEEGLKAIASGANPVYVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ ++E LK   K V  R+EI QVATISAN D EIG+ IA AME++G  G+IT++++
Sbjct: 121 DEAVKIIIEELKKISKPVSGRKEIEQVATISANNDPEIGKIIADAMEKVGKDGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+A T + V +GMQ DRGY+SPYFVT+ E+M A +ENPYILIY+KKIS ++ LLP+LE  
Sbjct: 181 KSAETVLEVTEGMQFDRGYLSPYFVTNPEKMEAVLENPYILIYEKKISNIRELLPVLEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL IIAEDVEG+ALATLVVN ++  L V AVKAP FG+RRK +L+DIA + G T 
Sbjct: 241 VQTNRPLLIIAEDVEGEALATLVVNHIKGVLKVCAVKAPGFGERRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   +  LG A KVV+ KD TTI+GG G  E I+ RI +I+K IE T S+Y
Sbjct: 301 ITEDLGIKLESVDLDMLGKADKVVVDKDSTTIIGGKGNPEDIKARIEQIKKQIETTTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVA+++VG  TEA L EKKDR  D++ AT+AA +EGIVPGGG+AL 
Sbjct: 361 DKEKLQERLAKLAGGVAIIKVGAATEAELKEKKDRVDDAVHATKAAVEEGIVPGGGVALY 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++AL ++  +N D+  GI+IVR A   P +QI  NAG E  +IV KI++S+  NYG+N
Sbjct: 421 RASRALCNINEENPDKAWGIKIVRNACKVPIKQIAYNAGFEGSVIVEKIKDSENVNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    F DM E GIIDP KVVR ALQ+A S+AG ML  E +V +  + E   P       
Sbjct: 481 AATGEFVDMVEAGIIDPTKVVRTALQNAASIAGTMLTAECLVAEIKEKEEKLPNA----- 535

Query: 540 MGGGMGGMDM 549
             GGMG MD 
Sbjct: 536 --GGMGDMDF 543


>gi|27380338|ref|NP_771867.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110]
 gi|2829663|sp|P77829|CH601_BRAJA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|1613782|gb|AAC44753.1| heat shock protein GroEL1 [Bradyrhizobium japonicum]
 gi|27353502|dbj|BAC50492.1| heat shock protein [Bradyrhizobium japonicum USDA 110]
          Length = 540

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 309/539 (57%), Positives = 408/539 (75%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARDRVLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LKA+ KKV + EEI Q+ATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVNDLKAHAKKVTTNEEIAQIATISANGDIEIGRFLADAMQKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY SPYFVT+ E+M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYASPYFVTNAEKMRVEFEDPYILIHEKKLSTLQSMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL ++AEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 VQSGKPLLVVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLKMLGRAKKVVIDKENTTIVNGAGSKKDIEARVTQIKMQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  +AL  +K  N DQ AG++IVR+A+  P RQI++NAG++  L+V K+ E+ + N+G+N
Sbjct: 421 RGLKALDAIKTVNADQKAGVDIVRRAIQVPARQIVQNAGEDGSLVVGKLLENSSYNWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA++ + PK    +P  P   
Sbjct: 481 AASGEYQDLAKAGVIDPAKVVRTALQDAASVAALLITTEALIAEKPKKSEPAPAAPPMD 539


>gi|253998114|ref|YP_003050177.1| chaperonin GroEL [Methylovorus sp. SIP3-4]
 gi|313200180|ref|YP_004038838.1| chaperonin groel [Methylovorus sp. MP688]
 gi|253984793|gb|ACT49650.1| chaperonin GroEL [Methylovorus sp. SIP3-4]
 gi|312439496|gb|ADQ83602.1| chaperonin GroEL [Methylovorus sp. MP688]
          Length = 547

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 296/532 (55%), Positives = 393/532 (73%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  I  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKQVIFGDEARAKIVNGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG NP D+KRGI
Sbjct: 61  ELKDKLENMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGFKYVAAGFNPADLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE +KA  K   + +EI QV +ISAN D +IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVVAIVEEIKAISKPTTTSKEIAQVGSISANSDADIGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + ER  A +ENP++L++DKKIS ++ LLP LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNPERQIALLENPFVLLHDKKISNIRDLLPALEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKSGRPLLIIAEDIEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE  T+ DLG AK++ + K++TTI+ G G  + I+ RI++I+K IED  SDY
Sbjct: 301 IAEEVGLKLESVTLNDLGQAKRIEVGKENTTIIDGAGVEDTIKSRIDQIKKQIEDATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+   KGDN DQ AGI+IV +A+  P RQI+ NAGDE  ++V+K+ E K  NYGYN
Sbjct: 421 RARAAIKELKGDNADQDAGIKIVLRAIEEPLRQIVANAGDEPSVVVNKVLEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GD+ E+G++DP KV R+ALQ+A S+A ++L T+A+V + PK++  +
Sbjct: 480 AANGTYGDLVELGVLDPAKVTRSALQNAASVASLILTTDALVAELPKEDAPA 531


>gi|110678132|ref|YP_681139.1| chaperonin GroEL [Roseobacter denitrificans OCh 114]
 gi|118597092|sp|Q16C40|CH601_ROSDO RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|109454248|gb|ABG30453.1| chaperonin GroEL protein, putative [Roseobacter denitrificans OCh
           114]
          Length = 543

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 315/543 (58%), Positives = 418/543 (76%), Gaps = 2/543 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  TAAR  +  GVNTLA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFDTAARSRMLRGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTT+T LAQAI NEG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDQAGDGTTTSTVLAQAIVNEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAAARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MTAE+E+P+ILI++KK+S+LQPL+P+LES 
Sbjct: 181 KGLETETEVVEGMQFDRGYLSPYFVTNPDKMTAELEDPFILIHEKKLSSLQPLVPLLESI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL +IAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQAGKPLLVIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AKKV ++KD+TT+V G G    I+ R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTIDMLGTAKKVAITKDETTVVNGAGEKAEIDARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL  ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES  A +G+N
Sbjct: 421 QGAKALDGLQGANPDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESDDATFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS-PQMPAGG 538
           AQ   +GD+F  G+IDP KVVR AL+ A S+AG+++ TEA+V   P  + A+ P MP  G
Sbjct: 481 AQTEEYGDLFSFGVIDPAKVVRTALEDASSVAGLLITTEAMVAVKPAGKGAASPAMPDMG 540

Query: 539 GMG 541
           GM 
Sbjct: 541 GMM 543


>gi|228995629|ref|ZP_04155294.1| 60 kDa chaperonin 2 [Bacillus mycoides Rock3-17]
 gi|229003257|ref|ZP_04161090.1| 60 kDa chaperonin 2 [Bacillus mycoides Rock1-4]
 gi|228757991|gb|EEM07203.1| 60 kDa chaperonin 2 [Bacillus mycoides Rock1-4]
 gi|228764125|gb|EEM13007.1| 60 kDa chaperonin 2 [Bacillus mycoides Rock3-17]
          Length = 544

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVTAIEELKTISKPIEGKSSIAQVAAISSA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+A LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVASLGRAGKVVVTKENTTVVEGVGNTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASISAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|256370747|ref|YP_003108572.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri SMDSEM]
 gi|256009539|gb|ACU52899.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri SMDSEM]
          Length = 542

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 303/543 (55%), Positives = 398/543 (73%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    ARD +  GV+ LA AVK TLGPKGR V+   SFG P+VTKDGV+VAK I 
Sbjct: 1   MAKNIKFDIEARDKLKKGVDALANAVKVTLGPKGRNVVFQKSFGGPQVTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++    +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRGID
Sbjct: 61  LEDPIENLGAQMVKEVASKTNDIAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ VV  LK   KKVG+ + I QVA+ISAN D  IG+ I+ A E++G  G+IT+++AK
Sbjct: 121 KAVEAVVNDLKKQSKKVGNEK-IKQVASISANNDEAIGKLISVAFEKVGKEGVITVEEAK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T V VV+GMQ DRGY SPYFVT++E+M  E +NPYIL+ DKKIS+++ +LPILE   
Sbjct: 180 GIETTVDVVEGMQFDRGYQSPYFVTNSEKMITEFDNPYILLSDKKISSMKDILPILEPVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSG+PL II+E+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSGKPLLIISEEVEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE G K+E   +  LG A++++++K++TTIV G+G  + I+ R+N+I+  IE T SDYD
Sbjct: 300 SEETGSKIEDTKLEFLGKAERIIINKENTTIVNGSGNKKEIDSRVNQIKNQIEITTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAVL VG  +E  + EKKDR  D+L ATRAA +EGIV GGG+ALVR
Sbjct: 360 KEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVR 419

Query: 422 AAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A ++L S+K DN DQ  GI+IV+++L  P RQI+ NAG+E  +IV+K+ E K   +GY+A
Sbjct: 420 AIKSLSSLKVDNVDQNTGIKIVKRSLQEPLRQIVANAGEEGSVIVAKVAEGK-KEFGYDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           +   + +M   GIIDP KV R AL++A S+AGM+L T+ V+ +  K+E A P MP   GM
Sbjct: 479 KLGEYKNMISEGIIDPTKVTRVALENAASVAGMLLTTDCVITEIKKEEPAMPAMPGNSGM 538

Query: 541 GGG 543
           GG 
Sbjct: 539 GGM 541


>gi|228989433|ref|ZP_04149421.1| 60 kDa chaperonin 2 [Bacillus pseudomycoides DSM 12442]
 gi|228770304|gb|EEM18880.1| 60 kDa chaperonin 2 [Bacillus pseudomycoides DSM 12442]
          Length = 544

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVTAIEELKIISKPIEGKSSIAQVAAISSA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+A LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVASLGRAGKVVVTKENTTVVEGVGNTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASISAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|94502301|ref|ZP_01308779.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|161833791|ref|YP_001597987.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS]
 gi|293977902|ref|YP_003543332.1| chaperonin GroL [Candidatus Sulcia muelleri DMIN]
 gi|189082373|sp|A8Z640|CH60_SULMW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|94451140|gb|EAT14087.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|152206281|gb|ABS30591.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS]
 gi|292667833|gb|ADE35468.1| chaperonin GroL [Candidatus Sulcia muelleri DMIN]
          Length = 543

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 303/545 (55%), Positives = 394/545 (72%), Gaps = 4/545 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+I+    ARD +  GV+ LA AVK TLGPKGR V++  SFG P+VTKDGV+VAK I 
Sbjct: 1   MAKNIQFDIEARDKLKKGVDALANAVKVTLGPKGRNVVLQKSFGGPQVTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++    +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRGID
Sbjct: 61  LEDPIENLGAQMVKEVASKTNDIAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATI-SANGDREIGEKIAYAMEQIGPHGIITIDQA 180
            AV+ VV  LK   ++VG   E I+     SAN D  IGE I+ A +++G  G+IT+++A
Sbjct: 121 KAVEAVVNDLKKQSREVGGSNEKIKQVASISANNDEAIGELISVAFDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GMQ DRGY SPYFVT++++M  E +NPYIL+ DKKIS+++ LLPILE  
Sbjct: 181 KGIETTVDVVEGMQFDRGYQSPYFVTNSDKMITEFDNPYILLSDKKISSMKDLLPILEPV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+E+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AQSGKPLLIISEEVEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G KLE   ++ LG A++V + KD+TTIV GNG    IE R+N+I+  IE T SDY
Sbjct: 301 ISEETGSKLEDTKLSFLGKAERVTIDKDNTTIVNGNGKKSDIESRVNQIKAQIEKTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAVL VG  +E  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA ++L+ +K DN DQ  GI+IV+++L  P RQI+ NAG+E  +IV+K+ E K   +GY+
Sbjct: 421 RAIKSLNGLKVDNVDQDTGIKIVKRSLQEPLRQIVANAGEEGSVIVAKVAEGKNE-FGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A+   + +M   GIIDP KV R AL++A S++GM+L TE V+ +  K+E A PQMP   G
Sbjct: 480 AKLGEYKNMISEGIIDPTKVTRVALENAASVSGMLLTTECVITEIKKEEPAMPQMPNS-G 538

Query: 540 MGGGM 544
           MGG M
Sbjct: 539 MGGMM 543


>gi|163852749|ref|YP_001640792.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|163664354|gb|ABY31721.1| chaperonin GroEL [Methylobacterium extorquens PA1]
          Length = 540

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 306/541 (56%), Positives = 404/541 (74%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ +    +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITGRARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+E+PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELEDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA A  L++K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVLALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++  +P +P GG 
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEK--APPLPPGGP 538

Query: 540 M 540
            
Sbjct: 539 D 539


>gi|34499469|ref|NP_903684.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472]
 gi|68566281|sp|Q7NQX1|CH602_CHRVO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|34105321|gb|AAQ61676.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472]
          Length = 546

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 297/532 (55%), Positives = 399/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARSKMVAGVNILADAVKVTLGPKGRNVVLDRSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVQEGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  +    K   + +EI QV +ISAN D +IGE IA AME++G  G+IT++  
Sbjct: 121 DKAVVSLVGEIAKIAKPCATSKEIAQVGSISANSDSDIGEIIANAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A ++NP+IL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNQDKQIAALDNPFILLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLTDIAVLTGGEV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+  LG AK+V + K++TTI+ G G +  I+ R+ EI+K IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLDQLGQAKRVEVGKENTTIIDGAGEAATIQARVGEIRKQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +K DN +Q AG++IV +A+  P RQI+KNAGDE  ++V+K+ E K  N+GYN
Sbjct: 421 RARATLENLKTDNAEQEAGVKIVLRAIEAPLRQIVKNAGDEPSVVVNKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ + P+D+ A+
Sbjct: 480 AASGEYGDMLEMGVLDPAKVTRSALQHAASVAGLMLTTDCMIAELPEDKPAA 531


>gi|307719673|ref|YP_003875205.1| 60 kDa chaperonin [Spirochaeta thermophila DSM 6192]
 gi|306533398|gb|ADN02932.1| 60 kDa chaperonin [Spirochaeta thermophila DSM 6192]
          Length = 542

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 291/542 (53%), Positives = 376/542 (69%), Gaps = 4/542 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +K    AR  +  GV  LA AVK TLGP+GR V++   FGAP VTKDGV+VAK I 
Sbjct: 1   MAKQLKFDEEARRKLLSGVEKLANAVKVTLGPRGRNVLLDKKFGAPTVTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++++VAT T D +GDGTTTAT LA +I  EG K V AG NPM +KRGID
Sbjct: 61  LPDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSIVKEGLKAVAAGANPMALKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
             V  VVE ++ N K++  R+EI  VA ISAN D EIGE+IA AME++G  G+IT++++K
Sbjct: 121 KTVDLVVEEIRKNAKEIKDRDEIAHVAAISANNDMEIGEEIANAMEKVGKDGVITVEESK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T    V+GMQ DRGY+S YFV + + MT  + +PYILI+DKKIS+++ LLPILE   
Sbjct: 181 TIETTTEFVEGMQFDRGYVSAYFVNNRDTMTCVLNDPYILIHDKKISSMKDLLPILEKVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+P+ IIAEDVEG+ALATLVVN VR  L   AVKAP FGDRRK +L DIA + G  VI
Sbjct: 241 QQGKPILIIAEDVEGEALATLVVNTVRGTLQACAVKAPGFGDRRKAMLEDIAILTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GLKLE   ++ LG A  V ++KDDTTIV G G S+ I+ RI +I+  IE+T SDYD
Sbjct: 301 SEELGLKLENVELSQLGRAGSVKVTKDDTTIVSGAGDSKAIKDRIAQIKAQIEETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+  + 
Sbjct: 361 REKLQERLAKLAGGVAVINVGAATEVELKEKKHRVEDALSATRAAIEEGIVPGGGLTYIL 420

Query: 422 AAQAL---SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           A +AL    +    ED+  G +IV++AL  P RQI  NAG +  +IV + +E K    G+
Sbjct: 421 ATKALDQVDLSSWEEDEKIGFKIVKRALEEPMRQIAANAGLDGSIIVQRAREEK-KGVGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A K  + DM ++GIIDP KV R+ALQ+A S+AG++L TE  V D P++E  +P  P  G
Sbjct: 480 DAAKMEWVDMMKVGIIDPAKVTRSALQNAASVAGLLLTTECAVTDIPEEEKKTPGTPDMG 539

Query: 539 GM 540
             
Sbjct: 540 MD 541


>gi|150378066|ref|YP_001314661.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470758|sp|A6UM48|CH605_SINMW RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|150032613|gb|ABR64728.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 545

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 315/531 (59%), Positives = 416/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  K + + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKTINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVDGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|86160012|ref|YP_466797.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C]
 gi|119366196|sp|Q2IFK0|CH602_ANADE RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|85776523|gb|ABC83360.1| chaperonin Cpn60, GroEL [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 547

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 302/533 (56%), Positives = 390/533 (73%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MAAKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK   K     +EI QV  ISANGD  IG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM A +E+ YILI +KKIS ++ LLP+LE  
Sbjct: 181 KGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 ARSGKPLIIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE+ T+ DLG AK+V + KD+TTIV G G  E IE R+  I+  IE+T SDY
Sbjct: 301 IAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  +AL     NE +  G++IVR+A+  P RQI  N G E  ++V+K++E+K A +G+NA
Sbjct: 421 RCVKALEGVKVNEGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
               + D+ + G+IDP KV R+ALQ+A S+A +ML T A+V + PK+E+A+P 
Sbjct: 481 ATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMVAEKPKEESAAPA 533


>gi|38422329|emb|CAE45331.1| unnamed protein product [Magnetospirillum gryphiswaldense]
 gi|144898661|emb|CAM75525.1| 60 kDa chaperonin 5 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 547

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 310/529 (58%), Positives = 400/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTEARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D  GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVREVASKTADLVGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  +K+  KKV + EEI QV TISANG+R+IG KIA AM ++G  G+IT+++A
Sbjct: 121 DLAVEAVVADVKSRAKKVSTNEEIAQVGTISANGERDIGAKIAEAMSKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E+++PYIL+++KK+S LQPLLP+LE+ 
Sbjct: 181 KGFETELDVVEGMQFDRGYSSPYFVTNAEKMTCELDSPYILLFEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V ++K+DTTIV G G    IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLEMLGTAKRVTITKEDTTIVDGAGARGDIEARCKQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            + +AL      N DQ  GI+IVR+AL  P RQI +NAG +  ++  K+ E+   N+G++
Sbjct: 421 YSVRALDGIAVANNDQKVGIDIVRRALQSPVRQIAENAGHDGAVVAGKLLEATDTNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + DM + GIIDPVKVVR ALQ A S+AG+++ TEA++ + PK +
Sbjct: 481 AQTGTYVDMIKAGIIDPVKVVRTALQDAASVAGLLITTEAMIAEKPKKD 529


>gi|16262848|ref|NP_435641.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|20137878|sp|Q92ZQ4|CH604_RHIME RecName: Full=60 kDa chaperonin 4; AltName: Full=GroEL protein 4;
           AltName: Full=Protein Cpn60 4
 gi|14523485|gb|AAK65053.1| groEL2 chaperonin [Sinorhizobium meliloti 1021]
          Length = 545

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 315/531 (59%), Positives = 418/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|312953660|ref|ZP_07772497.1| chaperonin GroL [Enterococcus faecalis TX0102]
 gi|310628498|gb|EFQ11781.1| chaperonin GroL [Enterococcus faecalis TX0102]
 gi|315151927|gb|EFT95943.1| chaperonin GroL [Enterococcus faecalis TX0031]
          Length = 541

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 274/543 (50%), Positives = 372/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKTAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LG+A KVV+ KD+TT+V G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGNASKVVVDKDNTTLVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|323703384|ref|ZP_08115033.1| chaperonin GroEL [Desulfotomaculum nigrificans DSM 574]
 gi|323531653|gb|EGB21543.1| chaperonin GroEL [Desulfotomaculum nigrificans DSM 574]
          Length = 540

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 293/545 (53%), Positives = 387/545 (71%), Gaps = 6/545 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR A+  GVN LAEAVK TLGPKGR V+I   FGAP +T DGVT+A+ I
Sbjct: 1   MAAKEIIFSEDARKALERGVNALAEAVKVTLGPKGRNVVIDKKFGAPTITNDGVTIAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +HF  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K V AG NPM IKRGI
Sbjct: 61  ELPDHFENMGAQLVKEVATKTNDVAGDGTTTATVLAQALVREGLKNVAAGANPMIIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV++ VE +K+  K + S+E I QVATISAN D  IG  IA AME++G  G+IT++++
Sbjct: 121 EKAVEKAVEEIKSMAKTIESKEAIAQVATISAN-DESIGNLIAEAMEKVGKDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +   T + VV+GM  DRGYISPY +T T++M A + +PYILI DKKIS++Q +LP+LE  
Sbjct: 180 QGIGTTLEVVEGMNFDRGYISPYMITDTDKMEASLSDPYILITDKKISSVQDILPVLEKV 239

Query: 241 TQSGR-PLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
            Q+G  P+ +I ED+EG+ALATLV+N++R  L V+AVKAP FGDRRK +L DIA + G T
Sbjct: 240 VQTGNKPVLLICEDLEGEALATLVLNKLRGTLNVVAVKAPGFGDRRKAMLEDIAILTGGT 299

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VI+EE+GLKL+KAT+  +G+A++V + K++T IVGG G   +IE RI +I+K IE+T SD
Sbjct: 300 VITEEVGLKLDKATLDMMGTARQVRVKKEETIIVGGAGEQSKIEARIAQIKKQIEETTSD 359

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           +DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R  D+L+ATRAA +EGIVPGGG A 
Sbjct: 360 FDREKLQERLAKLAGGVAVIQVGAATEVEMKEKKLRIDDALNATRAAVEEGIVPGGGTAY 419

Query: 420 VRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           V    AL       D   G+EIV+KAL  P RQI  NAG E  ++V K++ ++    G+N
Sbjct: 420 VDIIAALDSIKLEGDAKTGVEIVKKALEEPLRQIANNAGLEGSVVVEKVKATE-KGIGFN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + DM   GI+DP KV R+ALQ+A S+A M+L TE +V + P+ E A   M    G
Sbjct: 479 AVTEQYVDMIAAGIVDPAKVTRSALQNAASIAAMILTTETLVSEKPEKEAAPNPM---AG 535

Query: 540 MGGGM 544
           MGG M
Sbjct: 536 MGGMM 540


>gi|89069034|ref|ZP_01156415.1| chaperonin GroEL [Oceanicola granulosus HTCC2516]
 gi|89045403|gb|EAR51468.1| chaperonin GroEL [Oceanicola granulosus HTCC2516]
          Length = 548

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 305/536 (56%), Positives = 410/536 (76%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFETDARNRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +KA  + V + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVAQIKAAARTVENSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+TE+M AE+++  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNTEKMVAELDDCMILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK+V ++KD+TTIV G+G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTMDMLGTAKRVSITKDETTIVDGHGDKAEIEARVSQIRGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A++L  +  +N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QGAKSLEGLTAENSDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ E A+   P
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMVADKPQKEGAAAGAP 536


>gi|30018515|ref|NP_830146.1| chaperonin GroEL [Bacillus cereus ATCC 14579]
 gi|41016863|sp|Q814B0|CH60_BACCR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|29894055|gb|AAP07347.1| 60 kDa chaperonin GROEL [Bacillus cereus ATCC 14579]
          Length = 544

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 375/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGV V++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVPVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|148269555|ref|YP_001244015.1| chaperonin GroEL [Thermotoga petrophila RKU-1]
 gi|170288231|ref|YP_001738469.1| chaperonin GroEL [Thermotoga sp. RQ2]
 gi|281411726|ref|YP_003345805.1| chaperonin GroEL [Thermotoga naphthophila RKU-10]
 gi|166201760|sp|A5IJR6|CH60_THEP1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704185|sp|B1L8Y8|CH60_THESQ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|147735099|gb|ABQ46439.1| chaperonin GroEL [Thermotoga petrophila RKU-1]
 gi|170175734|gb|ACB08786.1| chaperonin GroEL [Thermotoga sp. RQ2]
 gi|281372829|gb|ADA66391.1| chaperonin GroEL [Thermotoga naphthophila RKU-10]
          Length = 538

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 272/536 (50%), Positives = 379/536 (70%), Gaps = 3/536 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K +K    AR A+  GV+ +A AVK TLGPKGR V+I  S+G+P +T DGV++AK I 
Sbjct: 1   MPKILKFNEEARRALERGVDKVANAVKVTLGPKGRNVVIEKSWGSPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQA+  EG K V AG NP+ +KRGID
Sbjct: 61  LEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV++ VE +K   KK+  RE+I  VA ISAN    IGE IA AM+++G  G+IT++ +K
Sbjct: 121 KAVEKAVEEIKKVSKKLSGREDIAHVAAISANSAE-IGELIAEAMDKVGEDGVITVEDSK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V   +GMQ DRGYISPYFVT  E+M   ++ P+ILI D+K+SA++PL+PILE   
Sbjct: 180 TLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPFILITDRKLSAVKPLIPILEKVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+GRPL +IAEDVEG+ L TLV+N+++  L   AVKAP FG+RRK +L+DIA + G  V 
Sbjct: 240 QTGRPLLVIAEDVEGEVLTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVA 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ LE  T+ DLG A  V + KD+T I+GG G  E I+ RI +I+  IE+T S+Y+
Sbjct: 300 SEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++ L+ER+AKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 KETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A +A+    +    D+  G +IV KALS P +QI +NAG +  +I+ KI  +    YG++
Sbjct: 420 ARKAVEKVIEELEGDEKIGAQIVYKALSAPIKQIAENAGYDGAVIIEKILSNDDPAYGFD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A +  + +MFE GIIDP KV R+ALQ+A S+AGM+L TE ++V+ P+++  +P +P
Sbjct: 480 ALRGEYCNMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLIVEKPEEKKETPSIP 535


>gi|152974096|ref|YP_001373613.1| chaperonin GroEL [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|189044128|sp|A7GKG0|CH60_BACCN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|152022848|gb|ABS20618.1| chaperonin GroEL [Bacillus cytotoxicus NVH 391-98]
          Length = 542

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 278/534 (52%), Positives = 375/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVATAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA +    VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTDGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ ATI  LG A KVV++K++TTIV G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATIESLGRAGKVVVTKENTTIVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYAKVASIAAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++    P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPEENK--PAMP 530


>gi|1122942|gb|AAA83441.1| GroEL-like chaperonin [Thermus aquaticus]
          Length = 543

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 297/551 (53%), Positives = 390/551 (70%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIKALAIPVEDRKAIEEVATISANDPE-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVR 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+    EIVR+AL  P RQI +NAG E  +IV +I    K   YG+
Sbjct: 420 AISAVEELIKKLEGDEARAPEIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --SAGAGDMDF 543


>gi|149185484|ref|ZP_01863800.1| chaperonin GroEL [Erythrobacter sp. SD-21]
 gi|148830704|gb|EDL49139.1| chaperonin GroEL [Erythrobacter sp. SD-21]
          Length = 549

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 311/536 (58%), Positives = 412/536 (76%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ I  GV+TLA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFGRDAREGIQRGVDTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ + D++GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLKEVASKSNDAAGDGTTTATVLAQSIVTEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV++VVE LK+  K V    EI QV  ISANGDRE+GEKIA AME++G  G+IT+D++
Sbjct: 121 DLAVEKVVENLKSRSKDVSGSSEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+  V+GMQ DRGY+SPYF+T+ E+MT E+ENPYILI++KK+S LQ +LP+LE+A
Sbjct: 181 KGLEFELETVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSNLQAMLPVLEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L+DI+ +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDISILTKGEM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V + KD+TTIV G G  + I+ R++EI+  I++T SDY
Sbjct: 301 ISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVSEIRTQIDNTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++AL  + G N+DQ  GI+IVR+AL+ P RQI  NAG +  ++  K+ +S   N G+N
Sbjct: 421 YASKALDGLSGGNDDQTRGIDIVRRALTAPVRQIATNAGHDGAVVSGKLTDSNDENLGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + ++   G+IDP KVVR ALQ+A S+AG+++ TEA VVD P+D++++P MP
Sbjct: 481 AATDTYENLVSAGVIDPTKVVRTALQNAASVAGLLITTEAAVVDKPEDKSSAPAMP 536


>gi|86356474|ref|YP_468366.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|119366183|sp|Q2KBZ7|CH601_RHIEC RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|86280576|gb|ABC89639.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 545

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 319/531 (60%), Positives = 415/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  +S KG N+DQ AGI IVR+AL  P RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSVKISAKGVNDDQEAGINIVRRALQAPARQIAENAGDEASIVVGKILDKDQDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIGMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|90419968|ref|ZP_01227877.1| chaperonin groEL [Aurantimonas manganoxydans SI85-9A1]
 gi|90336009|gb|EAS49757.1| chaperonin groEL [Aurantimonas manganoxydans SI85-9A1]
          Length = 551

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 318/530 (60%), Positives = 417/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV +VVE L    + + + +E+ QV TISANG++EIGE IA AM+++G  G+IT+++A
Sbjct: 121 DAAVLKVVEALGVAARSIDTSDEVAQVGTISANGEKEIGEMIASAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+ YIL+++KK+S LQ LLP+LES 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVAELEDCYILLHEKKLSNLQALLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G   +IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVSITKENTTIVDGAGEKTQIEARVGQIKGQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ A+++KG N DQ AGI IVRKAL  P RQI++NAG E  +IV KI E+++ ++GYNA
Sbjct: 421 RASNAVTIKGINADQDAGIAIVRKALQAPIRQIVQNAGAEGSIIVGKILENESLSFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               +GDM +MGI+DPVKVVR+ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 ATGEYGDMIQMGIVDPVKVVRSALQDAASVAGLLVTTEAMISEAPKKESA 530


>gi|315149988|gb|EFT94004.1| chaperonin GroL [Enterococcus faecalis TX0012]
          Length = 541

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 372/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKTAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LGSA KVV+ KD+TTIV G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGSASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|222085003|ref|YP_002543532.1| Chaperonin GroEL [Agrobacterium radiobacter K84]
 gi|221722451|gb|ACM25607.1| Chaperonin GroEL [Agrobacterium radiobacter K84]
          Length = 546

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 317/529 (59%), Positives = 417/529 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKEKKDRIDDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  PCRQI +NAGDE+ ++V KI +    N+GYNA
Sbjct: 421 RSSVKITVKGENDDQEAGVNIVRRALQAPCRQIAENAGDEASIVVGKILDKNEDNWGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           Q  V+GDM  MGI+DPVKVVR ALQ A S+A +++ TEA++ + PK + 
Sbjct: 481 QTGVYGDMIAMGIVDPVKVVRTALQDAASVASLLITTEAMIAELPKKDA 529


>gi|220918823|ref|YP_002494127.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956677|gb|ACL67061.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 547

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 302/533 (56%), Positives = 389/533 (72%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MAAKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK   K     +EI QV  ISANGD  IG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM A +E+ YILI +KKIS ++ LLP+LE  
Sbjct: 181 KGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 ARSGKPLIIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE+ T+ DLG AK+V + KD+TTIV G G  E IE R+  I+  IE+T SDY
Sbjct: 301 IAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  +AL     NE +  G++IVR+A+  P RQI  N G E  ++V+K++E+K A +G+NA
Sbjct: 421 RCVKALEGVKVNEGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
               + D+ + G+IDP KV R+ALQ+A S+A +ML T A+V + PK+E A+P 
Sbjct: 481 ATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMVAEKPKEEAAAPA 533


>gi|29377118|ref|NP_816272.1| chaperonin, 60 kDa [Enterococcus faecalis V583]
 gi|227519684|ref|ZP_03949733.1| chaperone GroEL protein [Enterococcus faecalis TX0104]
 gi|227554126|ref|ZP_03984173.1| chaperone GroEL [Enterococcus faecalis HH22]
 gi|229545002|ref|ZP_04433727.1| chaperone GroEL protein [Enterococcus faecalis TX1322]
 gi|229549246|ref|ZP_04437971.1| chaperone GroEL [Enterococcus faecalis ATCC 29200]
 gi|256616858|ref|ZP_05473704.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis ATCC 4200]
 gi|256853939|ref|ZP_05559304.1| chaperonin [Enterococcus faecalis T8]
 gi|256957868|ref|ZP_05562039.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis DS5]
 gi|256961134|ref|ZP_05565305.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis Merz96]
 gi|256963747|ref|ZP_05567918.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis HIP11704]
 gi|257079805|ref|ZP_05574166.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis JH1]
 gi|257081849|ref|ZP_05576210.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis E1Sol]
 gi|257084391|ref|ZP_05578752.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis Fly1]
 gi|257087610|ref|ZP_05581971.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis D6]
 gi|257090769|ref|ZP_05585130.1| chaperonin [Enterococcus faecalis CH188]
 gi|257416817|ref|ZP_05593811.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis AR01/DG]
 gi|257420033|ref|ZP_05597027.1| chaperonin [Enterococcus faecalis T11]
 gi|257421788|ref|ZP_05598778.1| chaperonin [Enterococcus faecalis X98]
 gi|293384080|ref|ZP_06629974.1| chaperonin GroL [Enterococcus faecalis R712]
 gi|293386894|ref|ZP_06631464.1| chaperonin GroL [Enterococcus faecalis S613]
 gi|294781372|ref|ZP_06746714.1| chaperonin GroL [Enterococcus faecalis PC1.1]
 gi|300861052|ref|ZP_07107139.1| chaperonin GroL [Enterococcus faecalis TUSoD Ef11]
 gi|307270656|ref|ZP_07551947.1| chaperonin GroL [Enterococcus faecalis TX4248]
 gi|307271694|ref|ZP_07552965.1| chaperonin GroL [Enterococcus faecalis TX0855]
 gi|307276876|ref|ZP_07557987.1| chaperonin GroL [Enterococcus faecalis TX2134]
 gi|307285526|ref|ZP_07565665.1| chaperonin GroL [Enterococcus faecalis TX0860]
 gi|307287547|ref|ZP_07567590.1| chaperonin GroL [Enterococcus faecalis TX0109]
 gi|307290358|ref|ZP_07570273.1| chaperonin GroL [Enterococcus faecalis TX0411]
 gi|312900002|ref|ZP_07759320.1| chaperonin GroL [Enterococcus faecalis TX0470]
 gi|312902400|ref|ZP_07761606.1| chaperonin GroL [Enterococcus faecalis TX0635]
 gi|312907969|ref|ZP_07766952.1| chaperonin GroL [Enterococcus faecalis DAPTO 512]
 gi|312978503|ref|ZP_07790241.1| chaperonin GroL [Enterococcus faecalis DAPTO 516]
 gi|30179852|sp|Q93EU6|CH60_ENTFA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|29344584|gb|AAO82342.1| chaperonin, 60 kDa [Enterococcus faecalis V583]
 gi|227072908|gb|EEI10871.1| chaperone GroEL protein [Enterococcus faecalis TX0104]
 gi|227176752|gb|EEI57724.1| chaperone GroEL [Enterococcus faecalis HH22]
 gi|229305483|gb|EEN71479.1| chaperone GroEL [Enterococcus faecalis ATCC 29200]
 gi|229309894|gb|EEN75881.1| chaperone GroEL protein [Enterococcus faecalis TX1322]
 gi|256596385|gb|EEU15561.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis ATCC 4200]
 gi|256710882|gb|EEU25925.1| chaperonin [Enterococcus faecalis T8]
 gi|256948364|gb|EEU64996.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis DS5]
 gi|256951630|gb|EEU68262.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis Merz96]
 gi|256954243|gb|EEU70875.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis HIP11704]
 gi|256987835|gb|EEU75137.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis JH1]
 gi|256989879|gb|EEU77181.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis E1Sol]
 gi|256992421|gb|EEU79723.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis Fly1]
 gi|256995640|gb|EEU82942.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis D6]
 gi|256999581|gb|EEU86101.1| chaperonin [Enterococcus faecalis CH188]
 gi|257158645|gb|EEU88605.1| chaperonin Cpn60/TCP-1 [Enterococcus faecalis ARO1/DG]
 gi|257161861|gb|EEU91821.1| chaperonin [Enterococcus faecalis T11]
 gi|257163612|gb|EEU93572.1| chaperonin [Enterococcus faecalis X98]
 gi|291078560|gb|EFE15924.1| chaperonin GroL [Enterococcus faecalis R712]
 gi|291083728|gb|EFE20691.1| chaperonin GroL [Enterococcus faecalis S613]
 gi|294451499|gb|EFG19959.1| chaperonin GroL [Enterococcus faecalis PC1.1]
 gi|295113604|emb|CBL32241.1| chaperonin GroL [Enterococcus sp. 7L76]
 gi|300850091|gb|EFK77841.1| chaperonin GroL [Enterococcus faecalis TUSoD Ef11]
 gi|306498551|gb|EFM68053.1| chaperonin GroL [Enterococcus faecalis TX0411]
 gi|306501285|gb|EFM70588.1| chaperonin GroL [Enterococcus faecalis TX0109]
 gi|306502750|gb|EFM72015.1| chaperonin GroL [Enterococcus faecalis TX0860]
 gi|306506513|gb|EFM75672.1| chaperonin GroL [Enterococcus faecalis TX2134]
 gi|306511572|gb|EFM80571.1| chaperonin GroL [Enterococcus faecalis TX0855]
 gi|306512966|gb|EFM81607.1| chaperonin GroL [Enterococcus faecalis TX4248]
 gi|310626060|gb|EFQ09343.1| chaperonin GroL [Enterococcus faecalis DAPTO 512]
 gi|310634070|gb|EFQ17353.1| chaperonin GroL [Enterococcus faecalis TX0635]
 gi|311288652|gb|EFQ67208.1| chaperonin GroL [Enterococcus faecalis DAPTO 516]
 gi|311292998|gb|EFQ71554.1| chaperonin GroL [Enterococcus faecalis TX0470]
 gi|315025232|gb|EFT37164.1| chaperonin GroL [Enterococcus faecalis TX2137]
 gi|315030315|gb|EFT42247.1| chaperonin GroL [Enterococcus faecalis TX4000]
 gi|315032761|gb|EFT44693.1| chaperonin GroL [Enterococcus faecalis TX0017]
 gi|315035780|gb|EFT47712.1| chaperonin GroL [Enterococcus faecalis TX0027]
 gi|315143740|gb|EFT87756.1| chaperonin GroL [Enterococcus faecalis TX2141]
 gi|315148603|gb|EFT92619.1| chaperonin GroL [Enterococcus faecalis TX4244]
 gi|315155510|gb|EFT99526.1| chaperonin GroL [Enterococcus faecalis TX0043]
 gi|315159193|gb|EFU03210.1| chaperonin GroL [Enterococcus faecalis TX0312]
 gi|315168619|gb|EFU12636.1| chaperonin GroL [Enterococcus faecalis TX1341]
 gi|315170122|gb|EFU14139.1| chaperonin GroL [Enterococcus faecalis TX1342]
 gi|315173758|gb|EFU17775.1| chaperonin GroL [Enterococcus faecalis TX1346]
 gi|315576233|gb|EFU88424.1| chaperonin GroL [Enterococcus faecalis TX0309B]
 gi|315579190|gb|EFU91381.1| chaperonin GroL [Enterococcus faecalis TX0630]
 gi|315582949|gb|EFU95140.1| chaperonin GroL [Enterococcus faecalis TX0309A]
 gi|323481564|gb|ADX81003.1| chaperonin GroL [Enterococcus faecalis 62]
 gi|327535859|gb|AEA94693.1| chaperonin GroEL [Enterococcus faecalis OG1RF]
 gi|329577371|gb|EGG58827.1| chaperonin GroL [Enterococcus faecalis TX1467]
          Length = 541

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 372/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKTAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LG+A KVV+ KD+TTIV G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|256425199|ref|YP_003125852.1| chaperonin GroEL [Chitinophaga pinensis DSM 2588]
 gi|256040107|gb|ACU63651.1| chaperonin GroEL [Chitinophaga pinensis DSM 2588]
          Length = 544

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 299/545 (54%), Positives = 396/545 (72%), Gaps = 3/545 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I   T AR+ +  GV+TLA+AVK TLGPKGR V+I   FGAP +TKDGV+VAK I 
Sbjct: 1   MAKQIFFSTDARNKMKKGVDTLADAVKVTLGPKGRNVVIEKKFGAPSLTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++    +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AG NPMD+KRGID
Sbjct: 61  LEDPIENMGAQMVKEVASKTADIAGDGTTTATVLAQSIIGEGLKNVAAGANPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKV-GSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
            AV+ V+E L    + V    ++I QVA ISAN D EIG+ IA AM ++   G+IT+++A
Sbjct: 121 KAVKVVIENLAKQAETVGNDNKKIEQVAAISANNDFEIGKLIAEAMNKVTKDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GMQ DRGY+SPYF+T++E+M AE++NPYILIYDKKIS L+ +L ILE  
Sbjct: 181 KGTDTTVEVVEGMQFDRGYLSPYFITNSEKMHAELQNPYILIYDKKISTLKDILHILEKI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+ L II+ED+EG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIA + G  V
Sbjct: 241 VQNGQQLLIISEDLEGEALATLVVNKLRGQLKVAAVKAPGFGDRRKEMLQDIATLTGGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G KLE A ++ LG A+ V + KD+TT+VGG G  + I+ RIN+I+  IE T SDY
Sbjct: 301 ISEEQGYKLENADLSYLGRAESVTIDKDNTTVVGGRGEKDAIQARINQIKAQIEVTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAVL VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLSGGVAVLYVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVAYI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA ++L  +KGDN D+  G+ IV++A+  P RQI  NAG E  ++V K++E K  ++G+N
Sbjct: 421 RAIESLDTLKGDNADEQTGVAIVKRAIEEPLRQITANAGIEGSIVVQKVKEGK-GDFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A+  V+ ++   G+IDP KV R AL++A S+AGM+L TE V+ D P+ ++A+P    G G
Sbjct: 480 ARTEVYENLLAAGVIDPAKVTRIALENAASIAGMLLTTECVIADKPEPKSAAPAPHGGHG 539

Query: 540 MGGGM 544
           MG   
Sbjct: 540 MGMDY 544


>gi|315162869|gb|EFU06886.1| chaperonin GroL [Enterococcus faecalis TX0645]
          Length = 541

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 372/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKTAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LG+A KVV+ KD+TTIV G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVATLEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|25452880|sp|Q9EZV1|CH60_THENE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|12006275|gb|AAG44819.1|AF275319_2 chaperonin GROEL [Thermotoga neapolitana]
          Length = 538

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/536 (51%), Positives = 379/536 (70%), Gaps = 3/536 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K +K    AR A+  GV+ +A AVK TLGPKGR V+I  S+G+P +T DGV++AK I 
Sbjct: 1   MPKLLKFNEEARRALERGVDKVANAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQA+  EG K V AG NP+ +KRGID
Sbjct: 61  LEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +K   KK+  RE+I  VA ISAN    IGE IA AM+++G  G+IT++ +K
Sbjct: 121 KAVERAVEEIKKLSKKLSGREDIAHVAAISANSPE-IGELIAEAMDKVGEDGVITVEDSK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V   +GMQ DRGYISPYFVT  E+M   ++ P ILI D+K+SA++PL+PILE   
Sbjct: 180 TLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPSILITDRKLSAVKPLIPILEKVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL +IAEDVEG+AL TLV+N+++  L   AVKAP FG+RRK +L+DIA + G  V 
Sbjct: 240 QTGKPLLVIAEDVEGEALTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVA 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ LE  T+ DLG A  V + KD+T I+GG G  E I+ RI +I+  IE+T S+Y+
Sbjct: 300 SEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++ L+ER+AKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 KETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + +A+    +    D+  G +IV KALS P RQI +NAG +  +I+ KI  S    YG++
Sbjct: 420 SRKAVEKLLEELDGDEKIGAQIVYKALSAPIRQIAENAGYDGAVIIEKILASDDPAYGFD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A +  FG+MFE GIIDP KV R+ALQ+A S+AGM+L TE +VV+ P+++  +P +P
Sbjct: 480 ALRGEFGNMFEKGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKETPSLP 535


>gi|209965873|ref|YP_002298788.1| chaperonin GroL, putative [Rhodospirillum centenum SW]
 gi|226704163|sp|B6IU98|CH60_RHOCS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|209959339|gb|ACI99975.1| chaperonin GroL, putative [Rhodospirillum centenum SW]
          Length = 546

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 304/529 (57%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGSDARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA  T D +GDGTTTAT LAQAI  EG K + AG+NPMD+KRG+
Sbjct: 61  ELSDKFENMGAQMVKEVAQKTADLAGDGTTTATVLAQAIVREGAKAIAAGMNPMDVKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AVQ VV+ +K+  +KV + +EI QV TISANG+ EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DVAVQTVVDDIKSRSRKVTTNDEIAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+PYIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KALETELDVVEGMQFDRGYLSPYFVTNADKMVAELESPYILLFEKKLSGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 VQSSRPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDMAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  ++  LG AKKVV++KD+TTIV G G  E I+ RI +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLENVSLEMLGQAKKVVITKDNTTIVDGAGSKEDIQARIVQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +   NEDQ  GI+IVRKAL  P RQI +NAG +  +IV K+ E    N+G+N
Sbjct: 421 YATKALDKLTAVNEDQKFGIDIVRKALQAPVRQIAQNAGFDGSVIVGKLLEKGETNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA++ + P+ +
Sbjct: 481 AQAGEYGDMFKFGVIDPTKVVRAALQDAASVAGLLITTEAMIGEKPEKK 529


>gi|315164944|gb|EFU08961.1| chaperonin GroL [Enterococcus faecalis TX1302]
          Length = 541

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 372/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKIAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LG+A KVV+ KD+TTIV G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|15625350|gb|AAL04033.1|AF335185_2 GroEL [Enterococcus faecalis]
          Length = 541

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 371/543 (68%), Gaps = 2/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L      V   +E I      ++G  ++G+ IA AME++G  G+ITI ++K
Sbjct: 121 LATKTAVEELHNIS-SVVDSKEAIAQVAAVSSGSEKVGQLIADAMEKVGNDGVITIAESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  TI +LG+A KVV+ KD+TTIV G G  E I+ R++ I+  I +T SD+D
Sbjct: 300 TDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI+IV +AL  P RQI +NAG E  +IV K++       G+NA 
Sbjct: 420 VIGKVAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNV-DLGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+    +P M    GMG
Sbjct: 479 NGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAPMMDPSMGMG 538

Query: 542 GGM 544
           G M
Sbjct: 539 GMM 541


>gi|148254475|ref|YP_001239060.1| chaperonin GroEL [Bradyrhizobium sp. BTAi1]
 gi|187470725|sp|A5EG60|CH603_BRASB RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|146406648|gb|ABQ35154.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 540

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 312/539 (57%), Positives = 409/539 (75%), Gaps = 1/539 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKA+ KK+ S +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDAIVADLKAHAKKITSNDEIAQVGTISANGDNEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT++E+M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T++ LG AKKVV+ K++TTIV G G  + IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIKLQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L  VK  N DQ AG++I+R+A+  P RQI++NAG++  L+V K+ E  T ++G+N
Sbjct: 421 RATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGEDGSLVVGKLLEKDTYSWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V D PK   A+   PA  
Sbjct: 481 AATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAEATQAAPAMD 539


>gi|229083546|ref|ZP_04215879.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-44]
 gi|228699763|gb|EEL52415.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-44]
          Length = 544

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAIEELKTISKPIEGKSSIAQVAAISSA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+A LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVASLGRAGKVVVTKENTTVVEGVGNTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVAGIAAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|206972691|ref|ZP_03233630.1| chaperonin GroL [Bacillus cereus AH1134]
 gi|218235093|ref|YP_002365094.1| chaperonin GroEL [Bacillus cereus B4264]
 gi|228919191|ref|ZP_04082564.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228950788|ref|ZP_04112916.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228956690|ref|ZP_04118479.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|229042154|ref|ZP_04189911.1| 60 kDa chaperonin 2 [Bacillus cereus AH676]
 gi|229068011|ref|ZP_04201322.1| 60 kDa chaperonin 2 [Bacillus cereus F65185]
 gi|229107929|ref|ZP_04237559.1| 60 kDa chaperonin 2 [Bacillus cereus Rock1-15]
 gi|229125761|ref|ZP_04254789.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-Cer4]
 gi|229143052|ref|ZP_04271488.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST24]
 gi|229148654|ref|ZP_04276907.1| 60 kDa chaperonin 2 [Bacillus cereus m1550]
 gi|229176848|ref|ZP_04304247.1| 60 kDa chaperonin 2 [Bacillus cereus 172560W]
 gi|229188526|ref|ZP_04315568.1| 60 kDa chaperonin 2 [Bacillus cereus ATCC 10876]
 gi|296501078|ref|YP_003662778.1| chaperonin GroEL [Bacillus thuringiensis BMB171]
 gi|226704085|sp|B7H4Q7|CH60_BACC4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|206732377|gb|EDZ49560.1| chaperonin GroL [Bacillus cereus AH1134]
 gi|218163050|gb|ACK63042.1| chaperonin GroL [Bacillus cereus B4264]
 gi|228594954|gb|EEK52731.1| 60 kDa chaperonin 2 [Bacillus cereus ATCC 10876]
 gi|228606630|gb|EEK64052.1| 60 kDa chaperonin 2 [Bacillus cereus 172560W]
 gi|228634815|gb|EEK91391.1| 60 kDa chaperonin 2 [Bacillus cereus m1550]
 gi|228640417|gb|EEK96811.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST24]
 gi|228657701|gb|EEL13511.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-Cer4]
 gi|228675527|gb|EEL30741.1| 60 kDa chaperonin 2 [Bacillus cereus Rock1-15]
 gi|228715114|gb|EEL66978.1| 60 kDa chaperonin 2 [Bacillus cereus F65185]
 gi|228727189|gb|EEL78389.1| 60 kDa chaperonin 2 [Bacillus cereus AH676]
 gi|228802991|gb|EEM49820.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228808875|gb|EEM55366.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228840469|gb|EEM85737.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|296322130|gb|ADH05058.1| chaperonin GroEL [Bacillus thuringiensis BMB171]
          Length = 544

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|227820987|ref|YP_002824957.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227339986|gb|ACP24204.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 545

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 314/531 (59%), Positives = 415/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKKVSISKENTTIVDGAGQKADIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++ KG+N+DQ AG+ IVR+AL  P RQI +NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITAKGENDDQDAGVNIVRRALQAPARQIAENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|190890943|ref|YP_001977485.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190696222|gb|ACE90307.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
          Length = 542

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 309/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVGELKANARKISNNSEIAQVGTISANGDSEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    ++GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL +    N+DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDIIKTANDDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKNEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK E
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE 529


>gi|323706023|ref|ZP_08117593.1| chaperonin GroEL [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534637|gb|EGB24418.1| chaperonin GroEL [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 541

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 281/551 (50%), Positives = 378/551 (68%), Gaps = 12/551 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I  G  AR A+  GVN +A  VK TLGP+GR V++   +G+P +T DGVT+A+ I 
Sbjct: 1   MAKKILYGEDARKALERGVNAVANTVKVTLGPRGRNVVLDKKYGSPTITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F   GA+++++VAT T D +GDGTTTAT LAQA+  EG + + AG NPM ++RG+ 
Sbjct: 61  LEDPFENQGAQLLKEVATKTNDVAGDGTTTATVLAQAMVLEGLRNLAAGANPMLLRRGMA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K V  ++ I  VA+ISA  D EIG  IA AM+++G  G+IT++++K
Sbjct: 121 KAVDAAVEGLKNISKPVEGKDSIAHVASISAA-DEEIGNLIAEAMDKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + +V+GMQ DRGYIS Y VT T++M A +++P ILI DKK+S +Q LLP+LE   
Sbjct: 180 SMNTTIEIVEGMQFDRGYISQYMVTDTDKMEAVLDDPLILITDKKLSNIQDLLPLLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GR L IIA+DVEG+ALATLVVN++R     +AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QQGRKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL L++A I  LG A++V ++K++TTIV G G +  I+ RIN+I+  IE+T SDYD
Sbjct: 300 SEEVGLDLKEAKIDMLGRARQVKVTKENTTIVDGAGNAADIKNRINQIKVQIEETTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++ G  TE  L EKK R +D+L ATRAA +EGIVPGGG AL+ 
Sbjct: 360 REKLQERLAKLSGGVAVIQAGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGTALLD 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
               +    D+   D   G +IV +AL  P RQI +NAG +  +I+ KI+ESK   +GY+
Sbjct: 420 VIPEVQKVVDSLEGDFRTGAQIVLRALEEPVRQIARNAGVDGSVIIEKIKESKDPAFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A K  F DM + GI+DP KV R+ALQ+A S+A M+L TEAVV D P+    +P   A   
Sbjct: 480 AYKEEFVDMLKAGIVDPTKVTRSALQNAASVASMILTTEAVVADIPEKNPPAPAPGA--- 536

Query: 540 MGGGMGGMDMM 550
                 GMDMM
Sbjct: 537 ------GMDMM 541


>gi|78044694|ref|YP_359661.1| chaperonin GroEL [Carboxydothermus hydrogenoformans Z-2901]
 gi|119366231|sp|Q3ADX3|CH60_CARHZ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|77996809|gb|ABB15708.1| chaperonin, 60 kDa [Carboxydothermus hydrogenoformans Z-2901]
          Length = 540

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 287/542 (52%), Positives = 376/542 (69%), Gaps = 4/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K I     AR A+  GVN LA+AVK TLGPKGR V++   FG+P++  DGV++A+ I
Sbjct: 1   MAGKQILFREDARRALERGVNALADAVKVTLGPKGRNVVLEKKFGSPQIINDGVSIAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VAT T D +GDGTTTAT LAQAI  EG K VTAG NPM +++GI
Sbjct: 61  ELADPVENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVTAGANPMILRKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV + VE +KA  K V + E I QVA ISAN D EIG+ IA AME++G  G+IT++++
Sbjct: 121 EKAVAKAVEEIKAIAKPVETSEAIAQVAAISAN-DEEIGKLIAEAMEKVGKDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +   T + VV+GM  DRGYISPY +T  ++M A + +PYILI DKKISA+  LLPILE  
Sbjct: 180 QGLGTTLEVVEGMSFDRGYISPYMITDPDKMEAILNDPYILITDKKISAIADLLPILEKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R  L  +AVKAP FGDRRK +L DIA +    V
Sbjct: 240 VQTGKPLLIIAEDVEGEALATLVVNKLRGTLTCVAVKAPGFGDRRKAMLEDIAILTNGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G KLE AT++ LG AK+V + K++T IVGG G  E IE RI +I+K IE+T SD+
Sbjct: 300 VSEELGFKLENATLSMLGRAKQVRVKKEETIIVGGQGSPEAIEKRIAQIKKQIEETTSDF 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L+ATRAA +EGIV GGG   +
Sbjct: 360 DREKLQERLAKLAGGVAVIQVGAATETEMKEKKLRIEDALNATRAAVEEGIVAGGGTTYI 419

Query: 421 RAAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
              +AL    K    D+  GI IVRKAL  P +QI  NAG E  +IV K++      +G+
Sbjct: 420 HIIKALEELEKTATGDERTGIAIVRKALEEPLKQIAINAGLEGSVIVEKVKTL-PVGHGF 478

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    + DM   GI+DP KV R+ALQ+A S+A M+L TEA+V + P+ E   P MP   
Sbjct: 479 NALTEEYVDMIAAGIVDPAKVTRSALQNAASVAAMLLTTEALVAEKPEKEKKGPDMPNMD 538

Query: 539 GM 540
            M
Sbjct: 539 MM 540


>gi|162147833|ref|YP_001602294.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542454|ref|YP_002274683.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
 gi|187470746|sp|A9HK37|CH601_GLUDA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|161786410|emb|CAP55992.1| 60 kDa chaperonin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530131|gb|ACI50068.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5]
          Length = 547

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 312/529 (58%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG+ EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVIAVVEELKKNTKKITTPAETAQVGTISANGEHEIGEMISQAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYF+T+ E+M A+++NPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFITNAEKMVADLDNPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+A LG AKKV + K++TTIV G G S+ I+GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLAMLGRAKKVRIEKENTTIVEGAGASDDIKGRCGQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ AL ++   N+DQ  G EI+RKAL  P RQI  NAG++  +I  K+ ES   NYG++
Sbjct: 421 RASTALGNLHFHNDDQRVGAEIIRKALQAPLRQIAHNAGEDGAVIAGKVLESNDYNYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+   GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ +
Sbjct: 481 AQIGDYKDLVAAGIIDPTKVVRTALQDASSVAGLLITTEAMVAEKPEKK 529


>gi|254562511|ref|YP_003069606.1| 60 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|254269789|emb|CAX25762.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens DM4]
          Length = 540

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 306/541 (56%), Positives = 405/541 (74%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITARARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+++PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELDDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++  +P +P GG 
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEK--APPLPPGGP 538

Query: 540 M 540
            
Sbjct: 539 D 539


>gi|157363182|ref|YP_001469949.1| chaperonin GroEL [Thermotoga lettingae TMO]
 gi|167008697|sp|A8F401|CH60_THELT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157313786|gb|ABV32885.1| chaperonin GroEL [Thermotoga lettingae TMO]
          Length = 539

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/538 (51%), Positives = 384/538 (71%), Gaps = 4/538 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K ++    AR ++  GVN +A+AV+ TLGPKGR V+I  S+G+P +T DGV++AK I 
Sbjct: 1   MPKLLRFDEEARRSLEKGVNKVADAVRITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQ++  EG K V AG NP+ +KRGID
Sbjct: 61  LEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQSMIREGLKNVAAGSNPILLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A ++  +Y+K   KK+  RE+I  VA ISAN    IG+ IA AM+++G  G+IT++ +K
Sbjct: 121 KATEKAAKYIKDKAKKLSGREDIAHVAAISANSSE-IGDLIAEAMDKVGEDGVITVEDSK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V   +GMQ DRGYISPYFVT  E+M  E++ P+ILI DKK+SA++PL+P+LE   
Sbjct: 180 TLETYVEFTEGMQFDRGYISPYFVTDAEKMEVELKEPFILITDKKLSAVKPLIPVLEKVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+P+ +IAEDVEG+AL TLV+N+++  L   AVKAP FGDRRK +L+DIA + G TVI
Sbjct: 240 QTGKPILVIAEDVEGEALTTLVLNKLKGTLSACAVKAPGFGDRRKAMLQDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           S+E+G+ LE   I DLG A  V + KDDT I+GG G  E I+ RI +I+  IE T S+Y+
Sbjct: 300 SDELGINLEDVAIEDLGRADIVRVKKDDTIIIGGKGNPEEIKKRIAQIKSQIEQTTSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++ L+ER+AKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 KETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLIR 419

Query: 422 AAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + +A+   +K  + D+  G  IV KAL  P RQI +NAG +  +I+ KI  SK  +YG++
Sbjct: 420 SRKAVEDVLKELDGDEKVGAMIVYKALEAPIRQIAENAGYDGAVIIEKILASKEESYGFD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET-ASPQMPA 536
           A K  + DMF+ GIIDP KV R+ALQ+A S+AGM+L TE +VV+ P+++  A+P MP 
Sbjct: 480 ALKGEYTDMFKAGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKEAAPAMPP 537


>gi|150395633|ref|YP_001326100.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
 gi|187470674|sp|A6U6I5|CH601_SINMW RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|150027148|gb|ABR59265.1| chaperonin GroEL [Sinorhizobium medicae WSM419]
          Length = 545

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 315/531 (59%), Positives = 418/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKDTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|241203263|ref|YP_002974359.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857153|gb|ACS54820.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 547

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 316/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    NYGYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|21715984|dbj|BAC02899.1| chaperonin [Thermus sp. TB1]
          Length = 543

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 291/542 (53%), Positives = 389/542 (71%), Gaps = 4/542 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A+AVK TLGP+GR V++   FG+P +TKDGVTVAK I 
Sbjct: 1   MAKILVFDEAARRALERGVNAVADAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            +NH   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LENHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGPKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +++    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIRSLAIPVEDRKAIEEVATISANDPD-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYF+T+ + M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFITNPDAMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL +IAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLLIAEDVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVKITKDETTIVGGKGKKEDIEARINGIKKELETTDSKYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+AL+R
Sbjct: 360 KEKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVALLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  ++V KI    K    G+
Sbjct: 420 AISAVDELLKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVVVQKILSETKNLRLGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    + DM E GI+DP KV R+ALQ+A S+  ++LITEAVV + P+ +  +P     G
Sbjct: 480 NAATGEYVDMVEAGIVDPAKVTRSALQNAASIGSLILITEAVVAEKPEKKETTPASHGAG 539

Query: 539 GM 540
            M
Sbjct: 540 DM 541


>gi|86748959|ref|YP_485455.1| chaperonin GroEL [Rhodopseudomonas palustris HaA2]
 gi|119366185|sp|Q2IZ16|CH601_RHOP2 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|86571987|gb|ABD06544.1| chaperonin GroEL [Rhodopseudomonas palustris HaA2]
          Length = 550

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 312/536 (58%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G  ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKDVKFGGDARDRMLRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD++RGI
Sbjct: 61  ELDDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AVQ VV+ ++   + V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVQAVVKDIQKRARPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDVYILLHEKKVSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG+KLE  T+  LG AKKVV+ K++TTIVGG G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEEIGIKLESVTLKMLGRAKKVVIDKENTTIVGGAGKKPDIEARVQQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRIHNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK+  A+P MP
Sbjct: 481 AQTEDYVDMLAKGIVDPAKVVRTALQDASSVAALLVTTEAMVAELPKE--AAPAMP 534


>gi|15964545|ref|NP_384898.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|307316014|ref|ZP_07595493.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|7404333|sp|P35469|CH601_RHIME RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|643068|gb|AAA61955.1| GroEL [Sinorhizobium meliloti]
 gi|15073723|emb|CAC45364.1| 60 KD chaperonin A [Sinorhizobium meliloti 1021]
 gi|306898339|gb|EFN29047.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 545

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 314/531 (59%), Positives = 418/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|218531590|ref|YP_002422406.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|218523893|gb|ACK84478.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
          Length = 540

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 307/541 (56%), Positives = 405/541 (74%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D+KRGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKNITARARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+++PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELDDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++T  P +P GG 
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEKT--PPLPPGGP 538

Query: 540 M 540
            
Sbjct: 539 D 539


>gi|197103235|ref|YP_002128613.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
 gi|196480511|gb|ACG80038.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum
           HLK1]
          Length = 539

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 307/537 (57%), Positives = 399/537 (74%), Gaps = 1/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I   T ARD +  GVN LA AV+ TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKEIHFSTDARDRMLRGVNILANAVRVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENLGAQLLREVASKTNDQAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE ++A  KKV S EEI Q+ TISANG+REIG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVAAVVEEIRATSKKVSSNEEIAQIGTISANGEREIGAMIAQAMERVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYFVT+ +RM   +E+  +LI++KK++ LQPL+P+LE  
Sbjct: 181 RGLEMELEVVEGMQFDRGYVSPYFVTNPDRMETVLEDALVLIFEKKLTTLQPLIPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL +IAED+EG+ LATLV+N++R GL V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 VQSGKPLLVIAEDIEGEVLATLVLNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQF 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV+++KDDTTIV G G    I+GRI +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIDQLGRAKKVIITKDDTTIVEGAGDKADIQGRIGQIRRQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  + G N+DQ AGI IVR+AL  P RQI +NAG E  ++V KI E+ +  +G+N
Sbjct: 421 RASKVLEGLNGANDDQNAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENASPTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQ   + D+ + G+IDP KVVR ALQ A S+AG+++ TEA V +APK   A      
Sbjct: 481 AQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAVAEAPKKPEAGANAAM 537


>gi|224823823|ref|ZP_03696932.1| chaperonin GroEL [Lutiella nitroferrum 2002]
 gi|224604278|gb|EEG10452.1| chaperonin GroEL [Lutiella nitroferrum 2002]
          Length = 545

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 292/533 (54%), Positives = 398/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARAKMVNGVNILADAVKVTLGPKGRNVVLDRSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVQEGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  L    K   + +EI QV +ISAN D +IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVVALVGELAKIAKPCTTSKEIAQVGSISANSDLDIGQIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+ + E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLSNELDVVEGMQFDRGYLSPYFINNQEKQIAALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L V+AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLQDIATLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+  LG AK++ + K++T I+ G G    I+ R+ EI++ IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLDMLGQAKRIEVGKENTIIIDGVGEHAAIQARVGEIRRQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+A++
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVAIL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L S+  DN DQ AG++IV KA+  P RQI++NAGDE  ++V+K+ E K  N+GYN
Sbjct: 421 RARATLESLVTDNVDQDAGVKIVLKAIEAPLRQIVQNAGDEPSVVVNKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMG++DP KV R ALQ A S++G+ML T+ ++ + P+D+ A+P
Sbjct: 480 AASGEYGDMIEMGVLDPAKVTRTALQHAASVSGLMLTTDCMIAELPEDKPAAP 532


>gi|116250657|ref|YP_766495.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841]
 gi|118597090|sp|Q1MKX4|CH601_RHIL3 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|115255305|emb|CAK06380.1| putative 60 kda chaperonin (protein cpn60) [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 547

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 315/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|240140086|ref|YP_002964563.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
 gi|240010060|gb|ACS41286.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens AM1]
          Length = 540

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 304/541 (56%), Positives = 403/541 (74%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V A  NP+D++RGI
Sbjct: 61  ELEDRFENLGAQLLREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAANFNPLDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ +    +KV + + I QV TISANGD EIG  IA A+E++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITGRARKVTASDAIAQVGTISANGDAEIGRLIAEAVERVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+G+Q DRGY+SPYFVT+TE++ AE+E+PYILI++KK+S+LQPLLP+LE+ 
Sbjct: 181 KTAETELDVVEGLQFDRGYLSPYFVTNTEKLIAELEDPYILIHEKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAILEDIAILTNGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  ++  LG AK+V + K+ TTIV G G   +I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVSLPLLGQAKRVRIDKESTTIVDGAGDRAQIDARVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S +K +N D  AGI IV KAL  P RQI  NAG E  ++VSK+ E+ +  +G++
Sbjct: 421 RAKAAVSALKSENADVKAGINIVLKALEAPIRQIAANAGVEGSIVVSKVIENGSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   + D+ E GI+DP KVVR ALQ A S+AG+++ TEA++ + PK++  +P +P  G 
Sbjct: 481 AQTETYVDLIEAGIVDPAKVVRTALQDAASVAGLLVTTEALIAERPKEK--APPLPPSGP 538

Query: 540 M 540
            
Sbjct: 539 D 539


>gi|30260443|ref|NP_842820.1| chaperonin GroEL [Bacillus anthracis str. Ames]
 gi|47525527|ref|YP_016876.1| chaperonin GroEL [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183285|ref|YP_026537.1| chaperonin GroEL [Bacillus anthracis str. Sterne]
 gi|167634199|ref|ZP_02392521.1| chaperonin GroL [Bacillus anthracis str. A0442]
 gi|170687790|ref|ZP_02879005.1| chaperonin GroL [Bacillus anthracis str. A0465]
 gi|177655757|ref|ZP_02937032.1| chaperonin GroL [Bacillus anthracis str. A0174]
 gi|190567350|ref|ZP_03020264.1| chaperonin GroL [Bacillus anthracis Tsiankovskii-I]
 gi|227812934|ref|YP_002812943.1| chaperonin GroL [Bacillus anthracis str. CDC 684]
 gi|229602487|ref|YP_002864892.1| chaperonin GroL [Bacillus anthracis str. A0248]
 gi|254735440|ref|ZP_05193148.1| chaperonin GroEL [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744184|ref|ZP_05201866.1| chaperonin GroEL [Bacillus anthracis str. Kruger B]
 gi|254756030|ref|ZP_05208061.1| chaperonin GroEL [Bacillus anthracis str. Vollum]
 gi|254761680|ref|ZP_05213698.1| chaperonin GroEL [Bacillus anthracis str. Australia 94]
 gi|41016866|sp|Q81VE1|CH60_BACAN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813869|sp|C3PAV1|CH60_BACAA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813870|sp|C3L507|CH60_BACAC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|30253764|gb|AAP24306.1| chaperonin, 60 kDa [Bacillus anthracis str. Ames]
 gi|47500675|gb|AAT29351.1| chaperonin GroL [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177212|gb|AAT52588.1| chaperonin, 60 kDa [Bacillus anthracis str. Sterne]
 gi|167530513|gb|EDR93228.1| chaperonin GroL [Bacillus anthracis str. A0442]
 gi|170668317|gb|EDT19065.1| chaperonin GroL [Bacillus anthracis str. A0465]
 gi|172079986|gb|EDT65088.1| chaperonin GroL [Bacillus anthracis str. A0174]
 gi|190561477|gb|EDV15448.1| chaperonin GroL [Bacillus anthracis Tsiankovskii-I]
 gi|227005263|gb|ACP15006.1| chaperonin GroL [Bacillus anthracis str. CDC 684]
 gi|229266895|gb|ACQ48532.1| chaperonin GroL [Bacillus anthracis str. A0248]
          Length = 544

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 375/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLVGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|253999999|ref|YP_003052062.1| chaperonin GroEL [Methylovorus sp. SIP3-4]
 gi|253986678|gb|ACT51535.1| chaperonin GroEL [Methylovorus sp. SIP3-4]
          Length = 540

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 296/540 (54%), Positives = 393/540 (72%), Gaps = 3/540 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFHDHARTRIVQGVNVLADAVKVTLGPKGRNVLIERSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELQDKFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVVAGVNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ L    K + + +EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVNTVVDELHKLSKPITTNKEIAQVGSISANSDHAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+ T E ++P IL+YDKKIS+++ LLP LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINNPEKQTVEFDDPLILLYDKKISSIRDLLPTLENV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIIAEDLEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LEKAT+ DLG AK+V + K++T I+ G G  + IE R+  IQ  IE++ SDY
Sbjct: 301 ISEETGKQLEKATLEDLGRAKRVEVQKENTIIIDGAGEQKAIEARVKAIQAQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKL+GGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLSGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +  +KGDN DQ AGI IV +A+  P R I  NAGDE  ++++K+    + N+GYN
Sbjct: 421 RARSRIADLKGDNADQDAGIRIVLRAIEAPLRAIAANAGDEPSVVINKVLAG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQMPAGG 538
           A    + D+ E G++DP KV R ALQ+A S+A ++L T+A + + PK+ + A+P MP  G
Sbjct: 480 AATGEYADLVETGVVDPTKVTRTALQNAASVASLILTTDASIAELPKEDKAAAPAMPDMG 539


>gi|332286892|ref|YP_004418803.1| chaperonin GroEL [Pusillimonas sp. T7-7]
 gi|330430845|gb|AEC22179.1| chaperonin GroEL [Pusillimonas sp. T7-7]
          Length = 548

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 295/536 (55%), Positives = 390/536 (72%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  I  GVNTLA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKQVLFGDDARVRIVRGVNTLANAVKTTLGPKGRNVVLDRSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENIGAQLVKEVASKTSDNAGDGTTTATVLAQSIVEEGLKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK+  K   + +EI QV +ISAN D  IGE IA AM+++G  G+IT++  
Sbjct: 121 DKAVAVAVEELKSLSKPCTTSKEIAQVGSISANSDASIGEIIANAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  + +E+PY+LI+DKKIS ++ LLP+LE  
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPDKQVSVLEDPYVLIFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S RPL I+AEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSSRPLLIVAEDVEGEALATLVVNNIRGILKTTAVKAPGFGDRRKAMLEDIAILTGGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G+ LEKAT+ DLG AK++ + K++T I+ G G S+ IE R+ +I+  IE+  SDY
Sbjct: 301 ISEETGMSLEKATLEDLGQAKRIEVGKENTIIIDGAGDSKSIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++ +KGDN DQ AGI++V +A+  P R I+ NAGDE  ++V+ +   K  NYGYN
Sbjct: 421 RAKAAIAKLKGDNVDQEAGIKLVLRAVEAPLRTIVANAGDEPSVVVNNVANGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GD+ E G++DP KV R ALQ+A S+A ++L TE  V +  +D+ A P MP
Sbjct: 480 AATGEYGDLVEQGVLDPTKVTRTALQNAASVASLLLTTEVAVAEIVEDKPA-PAMP 534


>gi|313201972|ref|YP_004040630.1| chaperonin groel [Methylovorus sp. MP688]
 gi|312441288|gb|ADQ85394.1| chaperonin GroEL [Methylovorus sp. MP688]
          Length = 540

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 296/540 (54%), Positives = 394/540 (72%), Gaps = 3/540 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKFHDHARTRIVQGVNVLADAVKVTLGPKGRNVLIERSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELQDKFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVVAGVNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV+ L    K + + +EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVNTVVDELHKLSKPITTNKEIAQVGSISANSDHAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+ T E ++P IL+YDKKIS+++ LLP LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINNPEKQTVEFDDPLILLYDKKISSIRDLLPTLENV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIIAEDLEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LEKAT+ DLG AK+V + K++T I+ G G  + IE R+  IQ  IE++ SDY
Sbjct: 301 ISEETGKQLEKATLEDLGRAKRVEVQKENTIIIDGAGEQKAIEARVKAIQAQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +  +KGDN DQ AGI IV +A+  P R I  NAGDE  ++++K+    + N+GYN
Sbjct: 421 RARSRIADLKGDNADQDAGIRIVLRAIEAPLRAIAANAGDEPSVVINKVLAG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQMPAGG 538
           A    + D+ E G++DP KV R ALQ+A S+A ++L T+A + + PK+ + A+P MP  G
Sbjct: 480 AATGEYADLVETGVVDPTKVTRTALQNAASVASLILTTDASIAELPKEDKAAAPAMPDMG 539


>gi|15613125|ref|NP_241428.1| chaperonin GroEL [Bacillus halodurans C-125]
 gi|12643236|sp|O50305|CH60_BACHD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|2119971|pir||JC6063 chaperonin groEL - Bacillus sp
 gi|10173175|dbj|BAB04281.1| class I heat-shock protein (chaperonin) [Bacillus halodurans C-125]
          Length = 544

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 272/526 (51%), Positives = 375/526 (71%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VT+G NPM I++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMVIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A Q  VE L    K +  ++ I QVA IS+  D  +G+ IA AME++G  G+ITI+++K
Sbjct: 121 KATQVAVEELSKISKPIEGKDSIAQVAAISSADDE-VGKIIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             +TE+ VV+GMQ DRGY SPY VT +++M A ++NPY+LI DKKIS +Q +LP+LE   
Sbjct: 180 GFSTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYVLITDKKISNIQEVLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+P+ IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ A I  LG A KVV++K++TTIV G G S++I  R+N+I+  IE+T SD+D
Sbjct: 300 TEDLGLDLKSANITQLGRASKVVVTKENTTIVEGAGESDKIAARVNQIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAVL+VG  TE  + E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A+S  G   D+  G+ IV +AL  P RQI  NAG E  +IV ++++ +   +G+NA 
Sbjct: 420 VIKAVSSIGAEGDEATGVNIVLRALEEPVRQIAHNAGLEGSVIVERLKKEEA-GFGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ A S++ M L TEAV+ D P++
Sbjct: 479 TGEWVNMVEAGIVDPTKVTRSALQHAASVSAMFLTTEAVIADKPEE 524


>gi|86356879|ref|YP_468771.1| chaperonin GroEL [Rhizobium etli CFN 42]
 gi|119366207|sp|Q2KAU2|CH602_RHIEC RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|86280981|gb|ABC90044.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 542

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 309/529 (58%), Positives = 406/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVGELKANARKISNNSEIAQVGTISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    ++GR  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL S+K  N+DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDSIKTANDDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKSDFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK E
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKE 529


>gi|23096062|dbj|BAC16232.1| groEL [Acetobacter aceti]
          Length = 546

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 307/533 (57%), Positives = 402/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGADARQRMRAGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E LK N KKV +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MTA++ENPYILI++KK+S+LQP+LP+LES 
Sbjct: 181 KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRR  +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRNVMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G ++ I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +   N+DQ  G +I+R+AL  P RQI  NAG++  +I +K+ E+   N+G++
Sbjct: 421 RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   + ++ E GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ + A  
Sbjct: 481 AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAAPA 533


>gi|163732278|ref|ZP_02139724.1| chaperonin GroEL [Roseobacter litoralis Och 149]
 gi|161394576|gb|EDQ18899.1| chaperonin GroEL [Roseobacter litoralis Och 149]
          Length = 547

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 302/532 (56%), Positives = 402/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATVKVVAAIKEASREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  +L+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELEDCIVLLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKK+ ++KD+TTIV G G    I+ R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKIQITKDETTIVDGAGEKAEIQARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKHLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF  G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVVRTALQDAASIAGLLITTEAMVADKPAKEGAA 532


>gi|254724730|ref|ZP_05186513.1| chaperonin GroEL [Bacillus anthracis str. A1055]
          Length = 542

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 277/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|49479104|ref|YP_034593.1| chaperonin GroEL [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52144977|ref|YP_081854.1| chaperonin GroEL [Bacillus cereus E33L]
 gi|118476013|ref|YP_893164.1| chaperonin GroEL [Bacillus thuringiensis str. Al Hakam]
 gi|196036857|ref|ZP_03104245.1| chaperonin GroL [Bacillus cereus W]
 gi|196046195|ref|ZP_03113422.1| chaperonin GroL [Bacillus cereus 03BB108]
 gi|206978310|ref|ZP_03239186.1| chaperonin GroL [Bacillus cereus H3081.97]
 gi|217957826|ref|YP_002336370.1| chaperonin GroEL [Bacillus cereus AH187]
 gi|218901459|ref|YP_002449293.1| chaperonin GroL [Bacillus cereus AH820]
 gi|222094025|ref|YP_002528077.1| chaperonin groel [Bacillus cereus Q1]
 gi|225862308|ref|YP_002747686.1| chaperonin GroL [Bacillus cereus 03BB102]
 gi|228912997|ref|ZP_04076639.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228925513|ref|ZP_04088605.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228931759|ref|ZP_04094659.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228944065|ref|ZP_04106447.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|229089390|ref|ZP_04220663.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-42]
 gi|229119923|ref|ZP_04249180.1| 60 kDa chaperonin 2 [Bacillus cereus 95/8201]
 gi|229137097|ref|ZP_04265720.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST26]
 gi|229154026|ref|ZP_04282154.1| 60 kDa chaperonin 2 [Bacillus cereus ATCC 4342]
 gi|229182654|ref|ZP_04309898.1| 60 kDa chaperonin 2 [Bacillus cereus BGSC 6E1]
 gi|229194644|ref|ZP_04321440.1| 60 kDa chaperonin 2 [Bacillus cereus m1293]
 gi|300119511|ref|ZP_07057063.1| chaperonin GroEL [Bacillus cereus SJ1]
 gi|59797687|sp|Q63GV7|CH60_BACCZ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|59797762|sp|Q6HPC7|CH60_BACHK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|68566271|sp|Q73ER9|CH60_BACC1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|166198434|sp|A0R8W4|CH60_BACAH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704083|sp|B7JM60|CH60_BACC0 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704086|sp|B7HS05|CH60_BACC7 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813871|sp|C1EUB1|CH60_BACC3 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813872|sp|B9J1H2|CH60_BACCQ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|49330660|gb|AAT61306.1| 60 kDa chaperonin (Protein Cpn60) (class I heat-shock protein)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51978446|gb|AAU19996.1| 60 kDa chaperonin (Protein Cpn60) (class I heat-shock protein)
           [Bacillus cereus E33L]
 gi|118415238|gb|ABK83657.1| 60 kDa chaperonin [Bacillus thuringiensis str. Al Hakam]
 gi|195990539|gb|EDX54519.1| chaperonin GroL [Bacillus cereus W]
 gi|196022940|gb|EDX61620.1| chaperonin GroL [Bacillus cereus 03BB108]
 gi|206743478|gb|EDZ54909.1| chaperonin GroL [Bacillus cereus H3081.97]
 gi|217065080|gb|ACJ79330.1| chaperonin GroL [Bacillus cereus AH187]
 gi|218534913|gb|ACK87311.1| chaperonin GroL [Bacillus cereus AH820]
 gi|221238075|gb|ACM10785.1| 60 kDa chaperonin (Protein Cpn60) (class I heat-shock protein)
           [Bacillus cereus Q1]
 gi|225789126|gb|ACO29343.1| chaperonin GroL [Bacillus cereus 03BB102]
 gi|228588837|gb|EEK46859.1| 60 kDa chaperonin 2 [Bacillus cereus m1293]
 gi|228600823|gb|EEK58399.1| 60 kDa chaperonin 2 [Bacillus cereus BGSC 6E1]
 gi|228629446|gb|EEK86145.1| 60 kDa chaperonin 2 [Bacillus cereus ATCC 4342]
 gi|228646374|gb|EEL02585.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST26]
 gi|228663537|gb|EEL19120.1| 60 kDa chaperonin 2 [Bacillus cereus 95/8201]
 gi|228693939|gb|EEL47629.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-42]
 gi|228815615|gb|EEM61854.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228827908|gb|EEM73642.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228834151|gb|EEM79696.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228846651|gb|EEM91661.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|298723101|gb|EFI63991.1| chaperonin GroEL [Bacillus cereus SJ1]
 gi|324324268|gb|ADY19528.1| chaperonin GroEL [Bacillus thuringiensis serovar finitimus YBT-020]
          Length = 544

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 277/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|325292065|ref|YP_004277929.1| GroEL chaperonin [Agrobacterium sp. H13-3]
 gi|325059918|gb|ADY63609.1| GroEL chaperonin [Agrobacterium sp. H13-3]
          Length = 544

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 316/530 (59%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRTAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGENDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDRNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+ ++GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIQLGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|172065373|ref|YP_001816085.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
 gi|171997615|gb|ACB68532.1| chaperonin GroEL [Burkholderia ambifaria MC40-6]
          Length = 540

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 301/538 (55%), Positives = 399/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLGSAK+V + K+DT I+ G G  ERIE R+  I+  IE+T SDY
Sbjct: 301 ISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE  + Q PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPA-QAPAP 536


>gi|301051989|ref|YP_003790200.1| chaperonin GroEL [Bacillus anthracis CI]
 gi|300374158|gb|ADK03062.1| chaperonin GroEL [Bacillus cereus biovar anthracis str. CI]
          Length = 544

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+I+ RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIKARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|20804205|emb|CAD31231.1| PROBABLE CHAPERONIN GROEL DF PROTEIN [Mesorhizobium loti R7A]
          Length = 552

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 311/530 (58%), Positives = 410/530 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N KK+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTDVVATLIKNAKKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDVYILLHEKKLSNLQTMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G  E I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASLSINAVGANSDQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|196041107|ref|ZP_03108403.1| chaperonin GroL [Bacillus cereus NVH0597-99]
 gi|196028042|gb|EDX66653.1| chaperonin GroL [Bacillus cereus NVH0597-99]
          Length = 544

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|149203312|ref|ZP_01880282.1| chaperonin GroEL [Roseovarius sp. TM1035]
 gi|149143145|gb|EDM31184.1| chaperonin GroEL [Roseovarius sp. TM1035]
          Length = 546

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 305/531 (57%), Positives = 405/531 (76%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVRFNTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKAASRPVNDSAEVAQVGTISANGEAEIGRQIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMVADLEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV ++KD TTIV G G    IE R+++I++ IEDT SDY
Sbjct: 301 ISEDLGMKLENVGMDMLGRAKKVSITKDATTIVDGAGEKAEIEARVSQIRQQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L+ ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES  A +GYN
Sbjct: 421 QAAKKLAGLEGVNSDQNAGIAIVRRALEAPLRQIAENAGVDGSVVAGKIRESSDAKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ E A
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDASSIAGLLITTEAMVADKPQKENA 531


>gi|218895378|ref|YP_002443789.1| chaperonin GroL [Bacillus cereus G9842]
 gi|228906037|ref|ZP_04069928.1| 60 kDa chaperonin 2 [Bacillus thuringiensis IBL 200]
 gi|228937548|ref|ZP_04100189.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228969270|ref|ZP_04130144.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970435|ref|ZP_04131089.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228977005|ref|ZP_04137412.1| 60 kDa chaperonin 2 [Bacillus thuringiensis Bt407]
 gi|226704084|sp|B7IUT0|CH60_BACC2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|218545562|gb|ACK97956.1| chaperonin GroL [Bacillus cereus G9842]
 gi|228782715|gb|EEM30886.1| 60 kDa chaperonin 2 [Bacillus thuringiensis Bt407]
 gi|228789284|gb|EEM37209.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228790417|gb|EEM38144.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228822122|gb|EEM68109.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228853607|gb|EEM98373.1| 60 kDa chaperonin 2 [Bacillus thuringiensis IBL 200]
 gi|326938038|gb|AEA13934.1| chaperonin GroEL [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 544

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 375/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +E+I  RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGIGNTEQIAARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|281490936|ref|YP_003352916.1| 60 kDa chaperonin GroEL [Lactococcus lactis subsp. lactis KF147]
 gi|281374694|gb|ADA64214.1| 60 kDa chaperonin GroEL [Lactococcus lactis subsp. lactis KF147]
          Length = 542

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 277/546 (50%), Positives = 377/546 (69%), Gaps = 5/546 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +KDIK  + AR A+  G++ LA+ VK TLGPKGR V++  S+G+P +T DGVT+AK I 
Sbjct: 1   MSKDIKFSSDARTAMMRGIDILADTVKTTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V  +K     V  +  I QVAT+S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 LAAETAVSSIKEMAIPVHDKSAIAQVATVSSR-SEKVGEYISDAMERVGSDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y V++TE+M AE++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GMQTELDVVEGMQFDRGYLSQYMVSNTEKMVAELDNPYILITDKKISNIQEILPLLEQIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N+++    V+AVKAP FGDRRK  L D+A + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIKGVFNVVAVKAPGFGDRRKAQLEDLAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ AT+  LG A K  + KD TTIV G G ++ I  R+  I+  IE T SD+D
Sbjct: 300 TEELGLDLKDATLEALGQAAKATVDKDHTTIVEGAGSADAISDRVAIIKAQIEKTTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L   K   +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKAMKLLIEDALNATRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL    +  D   GI IVR+AL  P RQI  NAG E  +I+ K++  +    G+NA 
Sbjct: 420 AIAALDKLSEEGDIQTGINIVRRALEEPVRQIAANAGYEGSVIIDKLRSEEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S+AG++L TEAVV + P+  +A+P MP      
Sbjct: 479 TGQWVNMIEEGIVDPAKVTRSALQNAASVAGLILTTEAVVANKPE--SAAPAMPPMDP-S 535

Query: 542 GGMGGM 547
            GMGGM
Sbjct: 536 MGMGGM 541


>gi|89100205|ref|ZP_01173072.1| chaperonin GroEL [Bacillus sp. NRRL B-14911]
 gi|89085055|gb|EAR64189.1| chaperonin GroEL [Bacillus sp. NRRL B-14911]
          Length = 543

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 281/534 (52%), Positives = 380/534 (71%), Gaps = 3/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV++LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDSLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+  K +  +E I QVA ISA  +  +G+ IA AME++G  G+ITI+++K
Sbjct: 121 KAVTAAVEELKSISKPIEGKESIAQVAAISAADNE-VGQLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYILI DKKI+++Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITSIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL ++AEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLVAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ ATI  LG A KVV+SK++TTIV G+G S +I GR+N+I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATIDSLGRASKVVVSKENTTIVEGSGDSAQIAGRVNQIRVQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG+AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGVALLN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +A+  P R I  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVASLEAEGDEATGINIVLRAMEEPVRTIAHNAGLEGSVIVDRLK-REDVGTGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+AGS+A M L TEAVV D P+ E A P MP
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAGSVAAMFLTTEAVVADKPE-ENAGPAMP 531


>gi|197124051|ref|YP_002136002.1| chaperonin GroEL [Anaeromyxobacter sp. K]
 gi|196173900|gb|ACG74873.1| chaperonin GroEL [Anaeromyxobacter sp. K]
          Length = 547

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 302/532 (56%), Positives = 389/532 (73%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     ARDAI  GVNTLA+AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I
Sbjct: 1   MAAKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPMD+KRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK   K     +EI QV  ISANGD  IG  IA AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM A +E+ YILI +KKIS ++ LLP+LE  
Sbjct: 181 KGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AE+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 ARSGKPLVIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE+ T+ DLG AK+V + KD+TTIV G G  E IE R+  I+  IE+T SDY
Sbjct: 301 IAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  +AL     NE +  G++IVR+A+  P RQI  N G E  ++V+K++E+K A +G+NA
Sbjct: 421 RCVKALDGVKVNEGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
               + D+ + G+IDP KV R+ALQ+A S+A +ML T A+V + PK+E A+P
Sbjct: 481 ATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMVAERPKEEAAAP 532


>gi|313903526|ref|ZP_07836916.1| chaperonin GroEL [Thermaerobacter subterraneus DSM 13965]
 gi|313466079|gb|EFR61603.1| chaperonin GroEL [Thermaerobacter subterraneus DSM 13965]
          Length = 539

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 291/549 (53%), Positives = 386/549 (70%), Gaps = 11/549 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K +     AR ++  G+NT+A AVK TLGPKGR V++   FG+P +T DGVT+A+ I 
Sbjct: 1   MPKQLVFNEQARRSLEKGLNTVANAVKITLGPKGRNVVLEKKFGSPTITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            K+ F  +GA+++ +VAT T D +GDGTTTA  L QA+  EG K V AG NP+ +KRGI+
Sbjct: 61  LKDPFENMGAKLLTEVATKTNDVAGDGTTTAIVLGQAMVREGMKVVAAGANPILVKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV  VVE +K   K V ++    QVA+ISAN D EIG+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAAVVEEIKRIAKPVETKSATQQVASISAN-DEEIGKMIADAMEKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V VV+GMQ DRGY+SPYFVT  E M A +E+P+ILI D+KIS++  LLP+L+   
Sbjct: 180 TLDTTVEVVEGMQFDRGYLSPYFVTDPEAMEAVLEDPFILITDRKISSVNDLLPVLQRVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           + G+PL IIAEDVEG+ALATLVVN++R  L   AVKAP FGDRRK +L DIA + G  V+
Sbjct: 240 ERGKPLLIIAEDVEGEALATLVVNKIRGTLQSCAVKAPGFGDRRKAMLEDIAILTGGQVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++G+KLE  T    G AKKVV+ K++TTIV G G  ++I+ RIN I++ IE+T SD+D
Sbjct: 300 SEDLGIKLENVTPDMFGRAKKVVVEKENTTIVEGAGDPQKIKARINVIKRQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGG  LV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATEVELKEKKYRIEDALSATRAAVEEGIVPGGGSTLVH 419

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A +AL  V+  NED+  GIEIVR+AL  P RQI  NAG E  ++V ++++    N G++A
Sbjct: 420 AIKALDKVEARNEDERMGIEIVRRALEEPLRQIATNAGLEGSVVVERVKQLPD-NEGFDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
               +GDMF  GI+DP KV R+ALQ+A S+A M+L TE++V D P+D+  +         
Sbjct: 479 LTGEYGDMFARGIVDPAKVTRSALQNAASIAAMVLTTESLVADLPEDKKEA--------A 530

Query: 541 GGGMGGMDM 549
           GGGMG MD 
Sbjct: 531 GGGMGDMDF 539


>gi|146339700|ref|YP_001204748.1| chaperonin GroEL [Bradyrhizobium sp. ORS278]
 gi|187470736|sp|A4YRI5|CH601_BRASO RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|146192506|emb|CAL76511.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Bradyrhizobium
           sp. ORS278]
          Length = 539

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 312/537 (58%), Positives = 411/537 (76%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V+ LKA+ KK+ S +EI QV TISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVKDLKAHAKKITSNDEIAQVGTISANGDSEIGRFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT++E+M  E+E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T++ LG AKKVV+ K++TTIV G G  + IE R  +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIRLQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L  VK  N DQ AG++I+R+A+  P RQI++NAGD+  L+V K+ E  + ++G+N
Sbjct: 421 RATKVLDGVKTANADQKAGVDIIRRAIQVPVRQIVQNAGDDGSLVVGKLLEKDSYSWGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE--TASPQM 534
           A    + D+ + G+IDP KVVR ALQ A S+A +++ TEA+V D PK     A+P M
Sbjct: 481 AATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAETAAAPAM 537


>gi|190890535|ref|YP_001977077.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190695814|gb|ACE89899.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
          Length = 545

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 316/531 (59%), Positives = 415/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++ KG N+DQ AG+ IVR+AL  P RQI +NAGDE+ ++V KI +    N+GYNA
Sbjct: 421 RSSVKITAKGINDDQEAGVNIVRRALQAPARQIAENAGDEASIVVGKILDKDQDNWGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIGMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|15888025|ref|NP_353706.1| chaperonin GroEL [Agrobacterium tumefaciens str. C58]
 gi|20141227|sp|P30779|CH60_AGRT5 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15155641|gb|AAK86491.1| GroEL chaperonin [Agrobacterium tumefaciens str. C58]
          Length = 544

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 316/530 (59%), Positives = 417/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  +GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIALGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|209548077|ref|YP_002279994.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226704162|sp|B5ZRD6|CH60_RHILW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|209533833|gb|ACI53768.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 547

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 318/530 (60%), Positives = 418/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    NYGYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q S FGDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKESA 530


>gi|301300454|ref|ZP_07206654.1| chaperonin GroL [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851951|gb|EFK79635.1| chaperonin GroL [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 540

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 280/543 (51%), Positives = 391/543 (72%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR  +  GV+ LA  VK T+GPKGR V++  S+G+P +T DGVT+AK+I 
Sbjct: 1   MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAID 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI NEG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V+ L      V S+ +I QVA+IS+  + E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVDALHEMSHTVESKSDIAQVASISSA-NEEVGKLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ DRGY+S Y VT  ++M A+++NPYIL+ DKKIS +Q +LP+L+S  
Sbjct: 180 GIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L+DIA + GATVI
Sbjct: 240 QQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  T+  LGSA KV ++K++TTIV G G  ++I  R+ +I+K I +T SD+D
Sbjct: 300 TDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EG VPGGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++   +  D   GI IV++AL  P RQI +NAG E  +IV K++E K    G+NA 
Sbjct: 420 VIGKVAALEEEGDVQTGINIVKRALEEPVRQIAENAGLEGSVIVEKLKEQK-PGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
            + + DM E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+ E+ + QMPA  GMG
Sbjct: 479 TNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPESNN-QMPATPGMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|227891191|ref|ZP_04008996.1| chaperonin GroEL [Lactobacillus salivarius ATCC 11741]
 gi|227867065|gb|EEJ74486.1| chaperonin GroEL [Lactobacillus salivarius ATCC 11741]
          Length = 540

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 280/543 (51%), Positives = 390/543 (71%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR  +  GV+ LA  VK T+GPKGR V++  S+G+P +T DGVT+AK+I 
Sbjct: 1   MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAID 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI NEG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V+ L      V S+ +I QVA+IS+  + E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVDALHEMSHTVESKSDIAQVASISSA-NEEVGKLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ DRGY+S Y VT  ++M A ++NPYIL+ DKKIS +Q +LP+L+S  
Sbjct: 180 GIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEANLDNPYILLTDKKISNIQEVLPLLQSIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L+DIA + GATVI
Sbjct: 240 QQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  T+  LGSA KV ++K++TTIV G G  ++I  R+ +I+K I +T SD+D
Sbjct: 300 TDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EG VPGGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++   +  D   GI IV++AL  P RQI +NAG E  +IV K++E K    G+NA 
Sbjct: 420 VIGKVAALEEEGDVQTGINIVKRALEEPVRQIAENAGLEGSVIVEKLKEQK-PGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
            + + DM E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+ E+ + QMPA  GMG
Sbjct: 479 TNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPESNN-QMPATPGMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|163795486|ref|ZP_02189452.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199]
 gi|159179085|gb|EDP63618.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199]
          Length = 552

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 301/531 (56%), Positives = 399/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFNVDARDRMLRGVDILANAVKVTLGPKGRNVVLQKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG + V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGVRAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VV  +K+  KK+ + +EI QV TISANG ++IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLAVEAVVADVKSRTKKIKTSDEIAQVGTISANGAKDIGEMIAKAMDKVGREGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ +V+GMQ DRGY+SPYFVT+ ++M  E+E+P ILI++KK+S LQ +LP+LE  
Sbjct: 181 KSLGTELDIVEGMQFDRGYLSPYFVTNADKMVCELESPLILIHEKKLSGLQAMLPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 ARGQRPLLILAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G++LE  T+  LG+AKKV ++KD TTIV G G  + I+ R  +I+  IEDT SDY
Sbjct: 301 ISEDLGIQLENVTLDMLGTAKKVSLTKDTTTIVDGAGKKKDIQARCAQIRAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+A+      N DQ  G +I+R+AL  P RQI +NAG +  +IV K+ E K+ ++GYN
Sbjct: 421 YAAKAIDKLTPGNADQRTGFDIIRRALQAPARQIAENAGADGSIIVGKLLEQKSTSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ  VF D+ + G+IDP KVVR ALQ A S+AG+++ TEA+V D P+ + A
Sbjct: 481 AQTGVFEDLIKAGVIDPTKVVRTALQDAASIAGLLITTEAMVADKPEPKPA 531


>gi|222153836|ref|YP_002563013.1| chaperonin GroEL [Streptococcus uberis 0140J]
 gi|254813902|sp|B9DW28|CH60_STRU0 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|222114649|emb|CAR43696.1| 60 kDa chaperonin [Streptococcus uberis 0140J]
          Length = 542

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 281/546 (51%), Positives = 376/546 (68%), Gaps = 5/546 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  +FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARAAMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A    VE LKA  + V  +E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 KATSAAVEELKAIAQPVSGKEAIAQVAAVSSR-SEKVGEYISEAMERVGNDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A++ENP+ILI DKK+S +Q +LP+LE   
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQEILPLLEEVL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATIA LG A KV + KD T IV G G +E I  R+  I+  +E T S++D
Sbjct: 300 TEDLGLDLKDATIAALGQAAKVTVDKDSTVIVEGAGSAEAIANRVGLIKSQLETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVT 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G  IV +AL  P RQI  NAG E  +++ K++ S     G+NA 
Sbjct: 420 VIDKVAALELTGDEATGRNIVLRALEEPVRQIAYNAGYEGSVVIDKLKNSPVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+   A+P MP GG   
Sbjct: 479 TGDWVDMIETGIIDPVKVTRSALQNAASVASLILTTEAVVANKPE--PAAPAMP-GGMDP 535

Query: 542 GGMGGM 547
             MGGM
Sbjct: 536 SMMGGM 541


>gi|119386362|ref|YP_917417.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|119387310|ref|YP_918344.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|14916973|sp|Q9Z462|CH60_PARDE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|187470762|sp|A1B877|CH60_PARDP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|15988025|pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988026|pdb|1IOK|B Chain B, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988027|pdb|1IOK|C Chain C, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988028|pdb|1IOK|D Chain D, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988029|pdb|1IOK|E Chain E, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988030|pdb|1IOK|F Chain F, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|15988031|pdb|1IOK|G Chain G, Crystal Structure Of Chaperonin-60 From Paracoccus
           Denitrificans
 gi|9081772|dbj|BAA36516.2| chaperonin 60 [Paracoccus denitrificans]
 gi|119376957|gb|ABL71721.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
 gi|119377885|gb|ABL72648.1| chaperonin GroEL [Paracoccus denitrificans PD1222]
          Length = 545

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 299/532 (56%), Positives = 405/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNSDARDRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELSDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE +K+  + V    E+ QV TISANG+  IG++IA AM+++G  G+IT+++ 
Sbjct: 121 DVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S+LQP++P+LES 
Sbjct: 181 KGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG AKKV ++KD+TTIV G G    IE R+++I++ IE+T SDY
Sbjct: 301 ISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVSQIRQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+ L  + G N DQ AGI I+R+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QGAKVLEGLSGANSDQDAGIAIIRRALEAPMRQIAENAGVDGAVVAGKVRESSDKAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA++ + P+ +  +
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMIAEKPEPKAPA 532


>gi|300214858|gb|ADJ79274.1| 60 kDa chaperonin [Lactobacillus salivarius CECT 5713]
          Length = 540

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 280/543 (51%), Positives = 390/543 (71%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR  +  GV+ LA  VK T+GPKGR V++  S+G+P +T DGVT+AK+I 
Sbjct: 1   MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAID 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI NEG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V+ L      V S+ +I QVA+IS+  + E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVDALHEMSHTVESKSDIAQVASISSA-NEEVGKLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ DRGY+S Y VT  ++M A+++NPYIL+ DKKIS +Q +LP+L+S  
Sbjct: 180 GIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L+DIA + GATVI
Sbjct: 240 QQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  T+  LGSA KV ++K++TTIV G G  ++I  R+ +I+K I +T SD+D
Sbjct: 300 TDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EG VPGGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++   +  D   GI IV++AL  P RQI +NAG E  +IV K++E K    G+NA 
Sbjct: 420 VIGKVAALEEEGDVQTGINIVKRALEEPVRQIAENAGLEGSVIVEKLKEQK-PGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
            + + DM E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+ E+   QMPA  GMG
Sbjct: 479 TNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPESND-QMPATPGMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|115361133|ref|YP_778270.1| chaperonin GroEL [Burkholderia ambifaria AMMD]
 gi|122319442|sp|Q0B1N7|CH603_BURCM RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|115286461|gb|ABI91936.1| chaperonin GroEL [Burkholderia ambifaria AMMD]
          Length = 540

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 301/538 (55%), Positives = 399/538 (74%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLGSAK+V + K+DT I+ G G  ERIE R+  I+  I++T SDY
Sbjct: 301 ISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE  + Q PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPA-QAPAP 536


>gi|294085464|ref|YP_003552224.1| chaperonin cpn60/TcP-1 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665039|gb|ADE40140.1| Chaperonin Cpn60/TCP-1 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 549

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 301/536 (56%), Positives = 400/536 (74%), Gaps = 1/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFGSEARTKMLEGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKDI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+   D +GDGTTTAT LAQ+I  EG K V +G+NPMD+KRGI
Sbjct: 61  ELKDRFQNMGAQMVREVASKANDVAGDGTTTATVLAQSIAQEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE + A  K + + +E+ QV TISANG+ EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DMAVEAVVEKIVAGSKTISTSDEVAQVGTISANGEEEIGKMIAEAMERVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT  E+M A +E PYIL+++KK+S LQ +LPILE  
Sbjct: 181 KSLDTELDVVEGMQFDRGYLSPYFVTDAEKMRAVLEEPYILLHEKKLSNLQDMLPILEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAED+EG+ALATLVVNR+R GL V AVKAP FGDRRK ++ D+A +   TV
Sbjct: 241 VQSSRPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDLAILTNGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+ L+  T+  LGSAK+V ++KD+TTIV G+G    I+ R N+I+   E++ SDY
Sbjct: 301 VSEEVGIALDSLTLEMLGSAKRVEITKDETTIVDGSGDKTEIDARCNQIRAQAEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAV++VG  TE  + E+KDR  D++ ATRAA  EGIVPGGG+ALV
Sbjct: 361 DREKMQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDAMHATRAAVQEGIVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L  +K  N DQ  GI IVR+AL  P R I +NAG E  +IV K+ ES   N GY+
Sbjct: 421 RASVVLDGLKPANRDQEVGINIVRRALQAPARNIAENAGAEGSVIVGKLMESNDPNMGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A+ + + DM + G+IDP KVVR+ALQ+A S+AG+++ TEA+V + P+ +   P  P
Sbjct: 481 AKNNEYTDMIKAGVIDPTKVVRSALQNAASVAGLLVTTEAMVAEKPEPKDPMPAAP 536


>gi|254477792|ref|ZP_05091178.1| chaperonin GroL [Ruegeria sp. R11]
 gi|214032035|gb|EEB72870.1| chaperonin GroL [Ruegeria sp. R11]
          Length = 549

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 302/533 (56%), Positives = 404/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKASARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETTVVEGMQFDRGYLSPYFVTNPDKMIAELDDCMILLHEKKLSSLQAMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIEITKDETTIVDGAGEKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  V+G N DQ AGI IVRKA+  P RQI +NAG +  ++  KI+ES   ++GYN
Sbjct: 421 QAGKALDGVEGANSDQNAGIAIVRKAIEAPLRQIAENAGVDGAVVAGKIRESADTSFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E A+ 
Sbjct: 481 AQTDEYGDMFSFGVIDPAKVTRTALEDAASVAGLLITTEAMVADKPAKEGAAA 533


>gi|301632219|ref|XP_002945187.1| PREDICTED: 60 kDa chaperonin-like [Xenopus (Silurana) tropicalis]
          Length = 754

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 298/536 (55%), Positives = 399/536 (74%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAALVEELKKASKPTTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE+ 
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNPEKQVALLDNPFVLLFDKKISNIRDLLPTLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLSLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+  +K DN DQ AGI+++ KA+  P R+I+ NAG E+ ++V+++   K  N+G+N
Sbjct: 421 RARQAVGQIKSDNADQDAGIKLILKAIEAPLREIVNNAGGEASVVVNEVLNRK-GNHGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TE +V +APKDE A+P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTECMVAEAPKDEAAAPAMP 535


>gi|225851544|ref|YP_002731778.1| chaperonin GroEL [Persephonella marina EX-H1]
 gi|225645323|gb|ACO03509.1| chaperonin GroL [Persephonella marina EX-H1]
          Length = 545

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 296/550 (53%), Positives = 392/550 (71%), Gaps = 6/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K I  G  AR  +  GV+ LA AVK TLGP+GR VI+   +G+P VTKDGV+VAK I
Sbjct: 1   MAGKMIVYGDEARSKLKAGVDKLANAVKVTLGPRGREVILEKKWGSPAVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    + A+++++VA+ T D +GDGTTTAT L QAIY EG K + +G NP+ +KRGI
Sbjct: 61  ELTDPLENMAAQLVKEVASKTADVAGDGTTTATILTQAIYTEGLKAIASGANPVYVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV+ LK   K+V  R EI QVATISAN D EIG+ IA AME++G  G+IT++++
Sbjct: 121 DEAVKLVVDELKKMSKEVSGRTEIEQVATISANNDPEIGKIIADAMEKVGKDGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT+ T + VV+GMQ DRGY+SPYFVT+ E+M A +ENPYILIY+KKIS ++ LLP+LE  
Sbjct: 181 KTSETTLEVVEGMQFDRGYLSPYFVTNPEKMEAVLENPYILIYEKKISNIRELLPVLEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL IIAEDVEG+ALATLVVN ++  L V AVKAP FG+RRK +L+DIA + G   
Sbjct: 241 VQTNRPLLIIAEDVEGEALATLVVNNIKGVLKVCAVKAPGFGERRKAMLQDIAILTGGQA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   I  LG A KVV+ KD+TTI+GG G  E I+ RI +I+  IE T SDY
Sbjct: 301 ITEDLGIKLENVDIDMLGQADKVVVDKDNTTIIGGKGNPEDIKARIEQIKAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVA++ VG  TEA L EKKDR  D++ AT+AA +EGIVPGGG+AL 
Sbjct: 361 DREKLQERLAKLSGGVAIIRVGAATEAELKEKKDRVDDAVHATKAAVEEGIVPGGGVALY 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++ L  +K +N D+  GI+IVR A   P +QI  NAG +  +++ K++ ++  NYG++
Sbjct: 421 RASRVLCDIKEENTDKKWGIDIVRNACKVPLKQIAYNAGFDGSVVLEKVKANEDVNYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + DM + GIIDP KVVR A+Q+A S+AG ML  EA+V + P+ E  +P     GG
Sbjct: 481 AATGEYVDMIKAGIIDPTKVVRIAIQNAASIAGTMLTAEALVAEIPEKEEKTP-----GG 535

Query: 540 MGGGMGGMDM 549
            G GM  M  
Sbjct: 536 AGAGMEEMGF 545


>gi|304317534|ref|YP_003852679.1| chaperonin GroEL [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302779036|gb|ADL69595.1| chaperonin GroEL [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 541

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 279/551 (50%), Positives = 379/551 (68%), Gaps = 12/551 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I  G  AR A+  GVN +A  VK TLGP+GR V++   +G+P +T DGVT+A+ I 
Sbjct: 1   MAKKILYGEDARKALERGVNAVANTVKVTLGPRGRNVVLDKKYGSPTITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F   GA+++++VAT T D +GDGTTTAT LAQA+  EG + + AG NPM ++RG+ 
Sbjct: 61  LEDPFENQGAQLLKEVATKTNDVAGDGTTTATVLAQAMVLEGLRNLAAGANPMLLRRGMA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K V  ++ I  VA+ISA  D EIG  IA AM+++G  G+IT++++K
Sbjct: 121 KAVDAAVEGLKNISKPVEGKDSIAHVASISAA-DEEIGNLIAEAMDKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T + +V+GMQ DRGYIS Y VT T++M A +++P ILI DKK+S +Q LLP+LE   
Sbjct: 180 SMNTTIEIVEGMQFDRGYISQYMVTDTDKMEAVLDDPLILITDKKLSNIQDLLPLLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIA+DVEG+ALATLVVN++R     +AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QQGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL L++A +  LG A++V ++K++TTIV G G +  I+ RIN+I+  IE+T SDYD
Sbjct: 300 SEEVGLDLKEAKLDMLGRARQVKVTKENTTIVDGAGNAADIKNRINQIKVQIEETTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++ G  TE  L EKK R +D+L ATRAA +EGIVPGGG AL+ 
Sbjct: 360 REKLQERLAKLSGGVAVIQAGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGTALLD 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
               +    D+   D   G +IV +AL  P RQI +NAG +  +I+ KI+ESK  ++GY+
Sbjct: 420 VIPDVQKVVDSLEGDFRTGAQIVLRALEEPVRQIARNAGVDGSVIIEKIKESKDTSFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A K  F DM + GI+DP KV R+ALQ+A S+A M+L TEAVV D P+    +P   A   
Sbjct: 480 AYKEDFVDMLKAGIVDPTKVTRSALQNAASVASMILTTEAVVADIPEKNPPAPAPGA--- 536

Query: 540 MGGGMGGMDMM 550
                 GMDMM
Sbjct: 537 ------GMDMM 541


>gi|254487463|ref|ZP_05100668.1| chaperonin GroL [Roseobacter sp. GAI101]
 gi|214044332|gb|EEB84970.1| chaperonin GroL [Roseobacter sp. GAI101]
          Length = 549

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 300/529 (56%), Positives = 403/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K GT AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFGTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE ++A  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATHKVVEAIRAAARDVTDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDVIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVTITKDETTIVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALSVK-GDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA++L    G N DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAAKSLDGMTGMNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESSDLTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  +
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPSKD 529


>gi|167463819|ref|ZP_02328908.1| chaperonin GroEL [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322384759|ref|ZP_08058427.1| chaperonin GroEL-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321150458|gb|EFX43951.1| chaperonin GroEL-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 542

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 374/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GID
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMITEGLKNVTAGANPMVVRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE L+   K +  ++ I QVA ISA  D  +GE IA AME++G  G+IT++++K
Sbjct: 121 KAVRAAVEELQKIAKPIEGKQNIAQVAAISAADDE-VGELIAEAMEKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ +V+GMQ DRGY+SPY +T T++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFATEMEIVEGMQFDRGYVSPYMITDTDKMEAVLENPYILITDKKISNIQEILPVLEKVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIAEDVEG+A ATL+VN++R     +AVKAP FGDRRK +L+DIAA+ G  VI
Sbjct: 240 QQGKALLIIAEDVEGEAQATLIVNKLRGTFTCVAVKAPGFGDRRKAMLQDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+   I  LGSA++V ++K++T IV G G  + IE RIN+I+  +E+T S++D
Sbjct: 300 TEELGLDLKSTAIDQLGSARQVRVTKENTIIVDGAGDKKDIEARINQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGV V++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVGVIKVGAATETELKERKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G+ IV +AL  P R I  NAG E  +IV +++  +    GYNA 
Sbjct: 420 VYNAVAAVKAEGDEKTGVNIVLRALEEPVRTIAANAGQEGSVIVERLK-KEALGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAV+ D P+ E   P MP
Sbjct: 479 TGEWVNMLEQGIVDPAKVTRSALQNAASVAAMFLTTEAVIADKPEKEK--PAMP 530


>gi|148266317|ref|YP_001233023.1| chaperonin GroEL [Geobacter uraniireducens Rf4]
 gi|187470759|sp|A5G9I2|CH60_GEOUR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|146399817|gb|ABQ28450.1| chaperonin GroEL [Geobacter uraniireducens Rf4]
          Length = 549

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 300/534 (56%), Positives = 385/534 (72%), Gaps = 1/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK     R+A   GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I 
Sbjct: 1   MAKIIKFDQEGRNAFLKGVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++++VA+ T D +GDGTTTAT LAQAIY +G K V AG NPM+IKRGID
Sbjct: 61  LDDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ +V  LK   K +   +EI QV TISAN D+ IG+ IA AME++G  G+IT+++AK
Sbjct: 121 KAVETLVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T +  V+GMQ DRGY+SPYFVT  ERM A +EN  ILI+DKKIS ++ LLP+LE   
Sbjct: 181 AMETTLETVEGMQFDRGYLSPYFVTDPERMEATLENANILIHDKKISNMKDLLPVLEQTA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +SGRPL IIAED+EG+ALATLVVN++R  L + AVKAP FGDRRK +L DIA + G  VI
Sbjct: 241 KSGRPLIIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAVLTGGKVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEEIG KLE  T+  LG AKK+ + KD+TTI+ G G    I+GR+  I+  IE+T SDYD
Sbjct: 301 SEEIGFKLENTTMDMLGQAKKITVDKDNTTIIDGAGSEAEIQGRVKMIRAQIEETTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA DEGIVPGGG+A +R
Sbjct: 361 REKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVDEGIVPGGGVAYLR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL     + +Q  G+ ++++AL  P RQI +NAG +  ++V K++  K A +GYNA 
Sbjct: 421 AMSALDSLDLSTEQQFGVNVIKRALEEPIRQIAQNAGVDGSIVVDKVKNGKDA-FGYNAA 479

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + DM + GIIDP KV R+ALQ+A S+AG+ML TEA++ D PK+E + P MP
Sbjct: 480 DDEYVDMIQAGIIDPTKVSRSALQNASSIAGLMLTTEAMIADKPKEEGSMPAMP 533


>gi|254463684|ref|ZP_05077095.1| chaperonin GroL [Rhodobacterales bacterium Y4I]
 gi|206684592|gb|EDZ45074.1| chaperonin GroL [Rhodobacterales bacterium Y4I]
          Length = 548

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 298/529 (56%), Positives = 399/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV+ +K   + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVQGIKDMARPVNDSAEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGMETETDVVEGMQFDRGYLSPYFVTNPDKMVADLEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKISITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  ++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES   N+GYN
Sbjct: 421 QAGKGLDGLEGANADQNAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESSDKNFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTDEYGDMFSFGVIDPAKVTRTALEDAASVAGLLITTEAMVADKPAKE 529


>gi|296115122|ref|ZP_06833763.1| chaperonin GroEL [Gluconacetobacter hansenii ATCC 23769]
 gi|295978223|gb|EFG84960.1| chaperonin GroEL [Gluconacetobacter hansenii ATCC 23769]
          Length = 549

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 311/536 (58%), Positives = 408/536 (76%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDEARRRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG++EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVGAVVEELKKNTKKITTPAETAQVGTISANGEKEIGEMISQAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MT ++++PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNAEKMTVDLDSPYILIHEKKLSSLQPMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G  E I+GR ++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLNMLGTAKKVHIDKENTTIVEGAGEGEAIKGRCSQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L+ +   NEDQ  G +I+RKAL  P RQI  NAG++  +I  K+ E++T  YG++
Sbjct: 421 RASTTLAHLHFHNEDQRVGADIIRKALQAPLRQIAHNAGEDGAVIAGKVLENETYAYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ+  + D+   GIIDP+KVVR ALQ A S+AG+++ TEA+V + P+ +  +P MP
Sbjct: 481 AQEGTYKDLVAAGIIDPMKVVRTALQDAASVAGLLITTEAMVAERPEKK--APAMP 534


>gi|226939589|ref|YP_002794662.1| GroEL1 [Laribacter hongkongensis HLHK9]
 gi|226714515|gb|ACO73653.1| GroEL1 [Laribacter hongkongensis HLHK9]
          Length = 544

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 292/533 (54%), Positives = 389/533 (72%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G +AR  +  GVN LA+AVK TLGPKGR V++  S+GAP +TKDGV+VAK I
Sbjct: 1   MAAKDVKFGDSARSKMVVGVNILADAVKTTLGPKGRNVVLERSYGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQAIVQEGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE +K   K   + +EI QV  ISAN D  IGEKIA AME++G  G+IT++  
Sbjct: 121 DKAVVALVEEIKNIAKPCATTKEIAQVGAISANSDTVIGEKIAAAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+   E+  A+++NPY+L+ DKKIS ++ LLP LE  
Sbjct: 181 SGLEDELDVVEGMQFDRGYLSPYFINQPEKQIAQLDNPYVLLCDKKISNIRELLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNMRGILKTVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK ++  LG AK+V ++K++TT++ G G    I+ R+ +I+  IE   SDY
Sbjct: 301 IAEEVGLTLEKVSLEMLGQAKRVEVAKENTTLIDGAGSEAAIKARVEQIRALIETATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKMQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L      N +Q AG++IV +A+  P RQI+ NAGDE  ++V+K+ E  + N+GYN
Sbjct: 421 RARANLKEVATINAEQAAGVQIVMRAIESPLRQIVANAGDEPSVVVNKVYEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R+ALQ A S+AG+ML T+ +V + P+D+ A+P
Sbjct: 480 AATGEYGDLVEMGVLDPAKVTRSALQHAASVAGLMLTTDCMVAELPEDKPAAP 532


>gi|328545072|ref|YP_004305181.1| 60 kDa chaperonin [polymorphum gilvum SL003B-26A1]
 gi|326414814|gb|ADZ71877.1| 60 kDa chaperonin [Polymorphum gilvum SL003B-26A1]
          Length = 546

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 311/529 (58%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K GT AR+ +  GV+ LA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDVAGDGTTTATVLAQSIVKEGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E V+YL AN K + + EE+ QV TISANGD ++G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAAAEAVKYLVANSKTITTSEEVAQVGTISANGDTQVGKDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E PYIL+++KK+S LQ +LPILES 
Sbjct: 181 KSLETELEVVEGMQFDRGYLSPYFVTNAEKMLAELEKPYILLHEKKLSNLQAMLPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGRPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG A+KV +SK++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGKAEKVSISKENTTIVDGAGAKEDIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +  DN D  AGI+IV +AL  P RQI++NAG E  ++V KIQE+   ++G++
Sbjct: 421 RAKSAVEKLTSDNADIQAGIKIVLRALESPIRQIVENAGVEGSIVVGKIQENNDPSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + +M + GIIDP KVVR ALQ A S+AG+++ T A+V + PK E
Sbjct: 481 AQSETYVNMIQAGIIDPTKVVRTALQDAASVAGLLITTGAMVAELPKKE 529


>gi|228983514|ref|ZP_04143722.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228776221|gb|EEM24579.1| 60 kDa chaperonin 2 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 544

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVVAAVEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|294678000|ref|YP_003578615.1| chaperonin GroL [Rhodobacter capsulatus SB 1003]
 gi|294476820|gb|ADE86208.1| chaperonin GroL [Rhodobacter capsulatus SB 1003]
          Length = 545

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 297/533 (55%), Positives = 400/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA   VVE +KA  + V   +E+ QV TISANG+ +IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKV +SK++TTIV G+G    I  R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAAKKLNDLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TE ++ + P+ + A  
Sbjct: 481 AQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPKAAPA 533


>gi|218682519|ref|ZP_03530120.1| chaperonin GroEL [Rhizobium etli CIAT 894]
          Length = 546

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 315/531 (59%), Positives = 417/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G  AR+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQALVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q S FGDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKDAPA 531


>gi|163938258|ref|YP_001643142.1| chaperonin GroEL [Bacillus weihenstephanensis KBAB4]
 gi|229009758|ref|ZP_04166980.1| 60 kDa chaperonin 2 [Bacillus mycoides DSM 2048]
 gi|229131263|ref|ZP_04260167.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST196]
 gi|226704087|sp|A9VQG8|CH60_BACWK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|163860455|gb|ABY41514.1| chaperonin GroEL [Bacillus weihenstephanensis KBAB4]
 gi|228652201|gb|EEL08134.1| 60 kDa chaperonin 2 [Bacillus cereus BDRD-ST196]
 gi|228751518|gb|EEM01322.1| 60 kDa chaperonin 2 [Bacillus mycoides DSM 2048]
          Length = 544

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LKA  K +  +  I QVA IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKAISKPIEGKSSIAQVAAISSA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A K+V++K++TT+V G G S++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNSQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|170698819|ref|ZP_02889882.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10]
 gi|170136297|gb|EDT04562.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10]
          Length = 540

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 298/538 (55%), Positives = 397/538 (73%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADETIGKIIADAMEKVGNEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   ++  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPDKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLG AK+V + K+DT I+ G G  ERI+ R+  I   IE+T SDY
Sbjct: 301 ISEETGKQLQKASLEDLGRAKRVEVRKEDTIIIDGAGDQERIDARVKSIHTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANNDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKD+  + Q PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDDKPA-QAPAP 536


>gi|148261486|ref|YP_001235613.1| chaperonin GroEL [Acidiphilium cryptum JF-5]
 gi|326404970|ref|YP_004285052.1| 60 kDa chaperonin [Acidiphilium multivorum AIU301]
 gi|166198428|sp|A5G1G2|CH60_ACICJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|146403167|gb|ABQ31694.1| chaperonin GroEL [Acidiphilium cryptum JF-5]
 gi|325051832|dbj|BAJ82170.1| 60 kDa chaperonin [Acidiphilium multivorum AIU301]
          Length = 549

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 302/531 (56%), Positives = 401/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    AR+ +  GV+ LA AVK TLGPKGR V+I  SFG+PR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARERLIRGVDLLANAVKVTLGPKGRNVVIEKSFGSPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V+ LK   KK+ +  E  QV TISANG+ EIG+ I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVNAIVDELKKRTKKITTPSETAQVGTISANGEAEIGKMISEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYF+T+ E+M A+++NPYILI++KK+S LQP+LP+LES 
Sbjct: 181 KGIQTELDVVEGMQFDRGYVSPYFITNPEKMVADLDNPYILIHEKKLSGLQPMLPLLESI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV++ K++TTIV G G    I GR N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLNMLGRAKKVLIEKENTTIVEGAGKKADITGRCNQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGASETEVKERKDRVDDALHATRAAVEEGIVPGGGVALA 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+ A+  +K DN+DQ  GI+I+RKA+  P RQI +NAG++  +I  K+ ++   ++G++
Sbjct: 421 RASLAINKLKADNDDQRFGIDIIRKAVLAPMRQIAENAGEDGAVISGKVLDNDDYSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   F DM + GIIDP KVVR ALQ A S+AG+++ TEA+V + P+ +  
Sbjct: 481 AQSGEFKDMVKAGIIDPTKVVRTALQDAASVAGLLITTEAMVAERPEKKAP 531


>gi|319782610|ref|YP_004142086.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168498|gb|ADV12036.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 543

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 313/529 (59%), Positives = 406/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFHTEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VV  LK N +KV   +EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DKAVDAVVAELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E++ PY+LI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELDEPYVLIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T 
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G  E I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLQMLGRAKKVVIEKENTTIVDGVGRKEEIQGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGVLPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL  V+ DN DQ  G++IVR+A+  P RQI +NAG E  +IV K++E     +G+N
Sbjct: 421 RAAKALDTVQTDNSDQRTGVDIVRRAIETPVRQIAENAGAEGSIIVGKLREKSEFGWGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ + FGD+F  G+IDP KVVR ALQ A S+AG+++ TEA+V + PK E
Sbjct: 481 AQTNEFGDLFGQGVIDPAKVVRTALQDAASVAGLLVTTEAMVAEKPKKE 529


>gi|317121128|ref|YP_004101131.1| chaperonin GroEL [Thermaerobacter marianensis DSM 12885]
 gi|315591108|gb|ADU50404.1| chaperonin GroEL [Thermaerobacter marianensis DSM 12885]
          Length = 539

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 294/549 (53%), Positives = 389/549 (70%), Gaps = 11/549 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             K +     AR ++  G+NT+A AVK TLGPKGR V++   FG+P +T DGVT+A+ I 
Sbjct: 1   MPKQLVFNEQARRSLEKGLNTVANAVKITLGPKGRNVVLEKKFGSPTITNDGVTIARDIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            K+ F  +GA+++ +VAT T D +GDGTTTA  L QA+  EG K V AG NP+ +KRGI+
Sbjct: 61  LKDPFENMGAKLLTEVATKTNDVAGDGTTTAIVLGQAMVREGMKVVAAGANPILVKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV  VVE +K   K V ++E   QVA+ISAN D EIG+ IA AME++G  G+IT+++AK
Sbjct: 121 KAVNAVVEEIKRIAKPVETKEATQQVASISAN-DEEIGKMIADAMEKVGKDGVITVEEAK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V VV+GMQ DRGY+SPYFVT  E M A +E+P+ILI D+KIS++  LLP+L+   
Sbjct: 180 TLDTTVDVVEGMQFDRGYLSPYFVTDAEAMEAVLEDPFILITDRKISSVNDLLPVLQRVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           + G+PL IIAEDVEG+ALATLVVN++R  L   AVKAP FGDRRK +L DIA + G  V+
Sbjct: 240 ERGKPLLIIAEDVEGEALATLVVNKIRGTLQSCAVKAPGFGDRRKAMLEDIAILTGGQVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++G+KLE  T    G AKKVV+ K++TTIV G G  E+I+ RIN I++ IE+T SD+D
Sbjct: 300 SEDLGIKLENVTPDMFGRAKKVVVEKENTTIVEGAGDPEKIKARINVIKRQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG  LV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATEVEMKEKKYRIEDALSATRAAVEEGIVPGGGSTLVH 419

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A +AL  V+  NED+  GIEIVR+AL  P RQI  NAG E  ++V ++++    N G++A
Sbjct: 420 AIKALDKVEAKNEDERMGIEIVRRALEEPLRQIATNAGLEGSVVVERVKQLPD-NEGFDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
               +GDMF+ GI+DP KV R+ALQ+A S+A M+L TE++V D P+D+  +P        
Sbjct: 479 LTGEYGDMFQRGIVDPAKVTRSALQNAASIAAMVLTTESLVADLPEDKKETP-------- 530

Query: 541 GGGMGGMDM 549
           GGGMG MD 
Sbjct: 531 GGGMGDMDF 539


>gi|47567508|ref|ZP_00238220.1| chaperonin, 60 kDa [Bacillus cereus G9241]
 gi|122063314|sp|Q4MPR6|CH60_BACCE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|47555910|gb|EAL14249.1| chaperonin, 60 kDa [Bacillus cereus G9241]
          Length = 544

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A KVV++K++TT+V G G +++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKVVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|85857894|ref|YP_460096.1| chaperonin GroEL [Syntrophus aciditrophicus SB]
 gi|119366190|sp|Q2LPJ8|CH601_SYNAS RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|85720985|gb|ABC75928.1| chaperonin GroEL [Syntrophus aciditrophicus SB]
          Length = 544

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 298/548 (54%), Positives = 398/548 (72%), Gaps = 5/548 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  + ARD +  GV+TLA AVK TLGP+GR V+I  ++G P +TKDGVTVAK I
Sbjct: 1   MAAKEIKYDSVARDKVMKGVDTLANAVKVTLGPRGRNVVIEKAWGGPTITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAIY EG K   AG+NPM +KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDMAGDGTTTATILAQAIYREGTKLAAAGMNPMSLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D +VQ V++ LK   K +  ++EI QV TISAN D  IGE I+ AME++G  G+IT+++A
Sbjct: 121 DKSVQLVIDELKKISKDIRDKKEITQVGTISANNDNTIGEIISEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + +V+GMQ DRGY+SPYFVT  E+M   +E+PYIL+YDKKIS +Q L+PILE  
Sbjct: 181 KGMETTLEIVEGMQFDRGYVSPYFVTDPEKMEVVMEDPYILLYDKKISVMQDLVPILEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRP+ I++ED+EG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 ARSGRPMLIVSEDLEGEALATLVVNNIRGTLKCAAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+KL+  T+ DLG+ K++ ++KD+TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 VSEELGIKLDSITLTDLGTCKRLHITKDNTTIVDGAGSQADIEGRVKQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLVGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R   AL+     +D+  G+ IV++A+  P RQI  NAG E  ++V K++E+ T N+G+NA
Sbjct: 421 RTLPALAGMDLPDDERPGLNIVKRAVEEPMRQIAANAGFEGSIVVEKVKEN-TGNFGFNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
               + DM E GIIDP KVVR ALQ+A S+A ++L TEA++ +APK + A       GGM
Sbjct: 480 DTEKYVDMMEAGIIDPTKVVRFALQNAASVASLLLTTEAMIAEAPKKKGAG----MPGGM 535

Query: 541 GGGMGGMD 548
              MG M+
Sbjct: 536 PPDMGDME 543


>gi|328950242|ref|YP_004367577.1| 60 kDa chaperonin [Marinithermus hydrothermalis DSM 14884]
 gi|328450566|gb|AEB11467.1| 60 kDa chaperonin [Marinithermus hydrothermalis DSM 14884]
          Length = 542

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 289/551 (52%), Positives = 384/551 (69%), Gaps = 12/551 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +     AR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEDARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLSLKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE ++     V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIRELAIPVEDRKAIEEVATISANDPD-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+  V+G Q D+GYISPYF+ + + M A +E PYILI++KKIS ++ LLPILE   
Sbjct: 180 GLETELEFVEGYQFDKGYISPYFINNPDAMEASLEEPYILIHEKKISNIRDLLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+ +PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTSKPLFIIAEDVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE  T++ LG A++V ++KD+TTIVGG G  E I+ RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENVTLSMLGRAERVRVTKDETTIVGGKGKKEDIDARINAIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L ATRAA +EGIVPGGG+ L+R
Sbjct: 360 KEKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALSATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A   +    +    D+  G +IVR+AL  P RQI +NAG E  +IVS++    KT  YG+
Sbjct: 420 AIPVVDEVIQKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVSQVLAETKTTAYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F D+ E GI+DP KV R+ALQ+A S+  M+L TEAVV + P+ + A+P      
Sbjct: 480 NAATGEFMDLMEAGIVDPAKVTRSALQNAASIGSMVLTTEAVVAEKPEKKEAAPA----- 534

Query: 539 GMGGGMGGMDM 549
              G    MD 
Sbjct: 535 ---GSTPDMDF 542


>gi|251795086|ref|YP_003009817.1| chaperonin GroEL [Paenibacillus sp. JDR-2]
 gi|247542712|gb|ACS99730.1| chaperonin GroEL [Paenibacillus sp. JDR-2]
          Length = 544

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 268/529 (50%), Positives = 380/529 (71%), Gaps = 2/529 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA AVK TLGPKGR V++   FG+P +T DGV++AK I 
Sbjct: 1   MAKEIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMVIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  +E LK   K +  ++ I QVA+IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVKAAIEELKVIAKPIEGKQSIAQVASISSA-DEEVGQLIAEAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+SPY +T T++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFVTELEVVEGMQFDRGYVSPYMITDTDKMEAVLDNPYILITDKKISNIQEILPVLEKVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSG+ L IIAED+EG+A ATLV+N++R     + VKAP FGDRRK +L DIAA+ GA V+
Sbjct: 240 QSGKQLLIIAEDIEGEAQATLVLNKLRGTFTCVGVKAPGFGDRRKAMLADIAALTGAQVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL+L+ A++  LGSA+++ ++K++T IV G+G  + I+ R+N+I+  +E+T S++D
Sbjct: 300 TEELGLELKSASVDQLGSARQIRITKENTIIVDGSGNPDDIQARVNQIRVQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A++      D+  G+ IV ++L  P R I  NAG E  +IV +++  K    GYNA 
Sbjct: 420 VYKAVAAVQTTGDEQTGVNIVLRSLEEPLRTIAANAGQEGSVIVERLKNEK-VGVGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
              + +MFE GI+DP KV R+ALQ+A S+A M L TEAVV D P+ + A
Sbjct: 479 TGEWVNMFEAGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPEPKGA 527


>gi|172058771|ref|YP_001815231.1| chaperonin GroEL [Exiguobacterium sibiricum 255-15]
 gi|226704130|sp|B1YEP6|CH60_EXIS2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|171991292|gb|ACB62214.1| chaperonin GroEL [Exiguobacterium sibiricum 255-15]
          Length = 545

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 282/538 (52%), Positives = 377/538 (70%), Gaps = 5/538 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDI     AR A+  GV+ LA+AVK T+GPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDILFSEEARRAMLRGVDALADAVKVTIGPKGRNVVLERKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T + +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDHFENMGAKLVAEVASKTNEIAGDGTTTATVLAQAMIREGLKNVTAGANPMVIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE L A  K +  +E I QVA ISA  D E+G+ IA AME++G  G+ITI++++
Sbjct: 121 KAVRRAVEELHAIAKPIEGKEAIAQVAAISAA-DEEVGQLIAEAMERVGQDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A +ENPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLENPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  +PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ V GA +I
Sbjct: 240 QQNKPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISIVTGAELI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L++  I  LG A KVV+SKD+TTIV GNG S+ I  R+  I+  IE+T SD+D
Sbjct: 300 TEELGLDLKETQITQLGRASKVVVSKDNTTIVEGNGHSDSITARVGAIRSQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNATRAAVEEGIVAGGGTAFIH 419

Query: 422 AAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             +A+   +     D+  G+ IV +AL  P RQI +NAG E  +IV +++  +    GYN
Sbjct: 420 VTKAVESILAVTTGDEATGVNIVLRALEAPLRQIAENAGQEGSVIVERLKH-EAQGMGYN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    + DM E GI+DP KV R+ALQ+A S++ M L TEAV+ D P+    +P MP  
Sbjct: 479 AATDEYVDMIETGIVDPAKVTRSALQNAASVSAMFLTTEAVIADKPEP-AGAPAMPDM 535


>gi|110632718|ref|YP_672926.1| chaperonin GroEL [Mesorhizobium sp. BNC1]
 gi|118597088|sp|Q11LG4|CH601_MESSB RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|110283702|gb|ABG61761.1| chaperonin GroEL [Chelativorans sp. BNC1]
          Length = 544

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 312/529 (58%), Positives = 409/529 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVQEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+YL    KK+ + EE+ QV TISANG++EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVDYLAKAAKKIKTSEEVAQVGTISANGEKEIGQMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNPEKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK+V ++K+ TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGRAKRVSIAKETTTIVDGAGQKSEIEGRVAQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +  KG+N DQ AG+ IVR+A+  P RQI  NAG E+ ++V KI ++    +GYNA
Sbjct: 421 RASSEIKAKGENADQEAGVNIVRRAIQAPARQIASNAGAEASIVVGKILDNNAVTFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           Q   +GDM  MGI+DP+KVVR ALQ A S+AG+++ TEA++ + PK ++
Sbjct: 481 QTGEYGDMIGMGIVDPMKVVRTALQDAASVAGLLITTEAMIAELPKKDS 529


>gi|304393170|ref|ZP_07375098.1| chaperonin GroL [Ahrensia sp. R2A130]
 gi|303294177|gb|EFL88549.1| chaperonin GroL [Ahrensia sp. R2A130]
          Length = 549

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 305/528 (57%), Positives = 412/528 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G+ AR  +  GV+ LA+AVK TLGPKGR VI+  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGSDARTRMMRGVDILADAVKVTLGPKGRNVILDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  LK   KK+ + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++A
Sbjct: 121 DAAVDEVVASLKKMSKKIKTSDEVAQVGTISANGEAEIGGRIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  + + VV+GMQ DRGY+SPYFVT+ E+M  E+++PYIL+++KK+++LQ +LPILE+ 
Sbjct: 181 KSLESTLDVVEGMQFDRGYLSPYFVTNPEKMLCELDDPYILLHEKKLTSLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L D+A + G +V
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDLAVLTGGSV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG+AK+V +SK++TT+V G G  + +EGR+++I+K I++T SDY
Sbjct: 301 ISEELGIKLEGVTLDMLGTAKRVSISKEETTLVDGAGKKKDVEGRVSQIKKQIDETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ +G  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVISIGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +  +G+N DQ AG+ IV++AL  P RQI +NAGDE  ++V KI + K+A YGYNA
Sbjct: 421 RASNNMKTEGENADQAAGVAIVKRALQAPIRQIAENAGDEGSVVVGKILDQKSATYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
               +GDM  MGIIDPVKVVR+ALQ A S+A +++ TEA+V + P  E
Sbjct: 481 ANGEYGDMVAMGIIDPVKVVRHALQDAASIASLLITTEAMVAEKPAKE 528


>gi|152235|gb|AAA26285.1| groEL [Sinorhizobium meliloti]
          Length = 545

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 313/531 (58%), Positives = 417/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G + R+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRSGREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L A  KK+ + +E+ QV TISANG+++IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSITKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG+N+DQ AG+ IVR+AL  P RQI++NAGDE+ ++V KI E  T ++GYNA
Sbjct: 421 RSSVKITVKGENDDQDAGVNIVRRALQSPARQIVENAGDEASIVVGKILEKNTDDFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q   +GDM  MGIIDPVKVVR ALQ A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPKKDAPA 531


>gi|91783188|ref|YP_558394.1| chaperonin GroEL [Burkholderia xenovorans LB400]
 gi|91783218|ref|YP_558424.1| chaperonin GroEL [Burkholderia xenovorans LB400]
 gi|118597096|sp|Q13ZW7|CH602_BURXL RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|91687142|gb|ABE30342.1| 60 kDa chaperonin (Cpn60), groEL [Burkholderia xenovorans LB400]
 gi|91687172|gb|ABE30372.1| 60 kDa chaperonin (Cpn60), groEL [Burkholderia xenovorans LB400]
          Length = 540

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 296/537 (55%), Positives = 390/537 (72%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARSRIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L    K + +  EI QV  ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAVLDELHRLSKPIKTSREIAQVGAISANADEAIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   ++  A +++P IL++DKKIS+++ LLP+LE+A
Sbjct: 181 KSLENELEVVEGMQFDRGYLSPYFINDPDKQVAHLDDPLILLHDKKISSIRDLLPVLEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+AL TLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIIAEDVEGEALTTLVVNSMRGVLKVAAVKAPGFGDRRKALLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +LEKAT+ +LG AK+V + K++T I+ G G   RI+ R+  I+  IE+  SDY
Sbjct: 301 ISEETGKQLEKATLEELGRAKRVEVQKENTIIIDGAGDQTRIDARVKAIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+ G N DQ AGI IV +AL  P R I  NAGDE  ++V+K+   K  NYGYN
Sbjct: 421 RARSAISSLTGANADQDAGIRIVLRALEAPLRVIAANAGDEPSVVVAKVLSGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APK+E A P    
Sbjct: 480 AATGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKEEKAVPAPAP 536


>gi|229074304|ref|ZP_04207347.1| 60 kDa chaperonin 2 [Bacillus cereus Rock4-18]
 gi|229094969|ref|ZP_04225969.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-29]
 gi|229101071|ref|ZP_04231842.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-28]
 gi|229113923|ref|ZP_04243353.1| 60 kDa chaperonin 2 [Bacillus cereus Rock1-3]
 gi|228669540|gb|EEL24952.1| 60 kDa chaperonin 2 [Bacillus cereus Rock1-3]
 gi|228682348|gb|EEL36454.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-28]
 gi|228688457|gb|EEL42335.1| 60 kDa chaperonin 2 [Bacillus cereus Rock3-29]
 gi|228708826|gb|EEL60956.1| 60 kDa chaperonin 2 [Bacillus cereus Rock4-18]
          Length = 544

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LKA  K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKAISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A K+V++K++TT+V G G +++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|289577800|ref|YP_003476427.1| chaperonin GroEL [Thermoanaerobacter italicus Ab9]
 gi|297544087|ref|YP_003676389.1| chaperonin GroEL [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289527513|gb|ADD01865.1| chaperonin GroEL [Thermoanaerobacter italicus Ab9]
 gi|296841862|gb|ADH60378.1| chaperonin GroEL [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 540

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 284/548 (51%), Positives = 377/548 (68%), Gaps = 10/548 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK G  AR A+  GVN +A+ VK TLGP+GR V++   +G+P VT DGVT+A+ I 
Sbjct: 1   MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F   GA+++++VAT T D +GDGTTTAT LAQA+  EG K + AG NPM ++RGI 
Sbjct: 61  LEDPFENQGAQLLKEVATKTNDVAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K + ++E I  VA+ISA  D EIG  IA AM+++G  G+IT++++K
Sbjct: 121 KAVDAAVEGLKRISKPIDNKESIAHVASISAA-DEEIGNLIAEAMDKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GMQ DRGYISPY VT  E+M A +E P ILI DKK+S +Q LLP+LE   
Sbjct: 180 TLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSNVQDLLPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIA+DVEG+ALATLVVN++R     +AVKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QQGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G  L+   +  LG A++V ++K++TTIVGG G +  I+ R+N+I+  IE+T SDYD
Sbjct: 300 SEELGYDLKDVRLDMLGRARQVKVTKENTTIVGGAGDAAEIKKRVNQIKAQIEETTSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++ G  TE  L EKK R +D+L AT+AA +EGIVPGGGIAL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLN 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
             + +    D+   D   G +IV +AL  P RQI  NAG +  +I+ KI+ +K  ++GY+
Sbjct: 420 VIEDVQKVVDSLDGDFKTGAKIVLRALEEPVRQIAANAGVDGSVIIEKIKAAKDPHFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A K  F DMF+ GI+DP KV R ALQ+A S+A M+L TEAVVVD P+  T          
Sbjct: 480 AYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAVVVDIPEKNTTPNP------ 533

Query: 540 MGGGMGGM 547
            G GM  M
Sbjct: 534 -GAGMDMM 540


>gi|163745715|ref|ZP_02153075.1| chaperonin GroEL [Oceanibulbus indolifex HEL-45]
 gi|161382533|gb|EDQ06942.1| chaperonin GroEL [Oceanibulbus indolifex HEL-45]
          Length = 548

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 303/529 (57%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG++EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARDVSDSDEVAQVGTISANGEKEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++MT E+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMTVELEDAIILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD T +V G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVSITKDATIVVDGAGEKAEIEARVAQIRNQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVRERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKKLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPSKE 529


>gi|114764191|ref|ZP_01443429.1| chaperonin GroEL [Pelagibaca bermudensis HTCC2601]
 gi|114543343|gb|EAU46359.1| chaperonin GroEL [Roseovarius sp. HTCC2601]
          Length = 547

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 305/536 (56%), Positives = 406/536 (75%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR  +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFDTDARTRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARPVNDSGEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQPL+P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPLVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AK V ++KD+TTIV G+G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKTVTITKDETTIVDGHGEKAEIEARVSQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL  ++G N DQ AG+ IVRKAL  P RQI +NAG +  ++  KI+ES+   +GYN
Sbjct: 421 QGAKALDGLEGANSDQNAGVTIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P  + A   MP
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKP-QKDAPAAMP 535


>gi|319940243|ref|ZP_08014595.1| chaperonin [Streptococcus anginosus 1_2_62CV]
 gi|25452840|sp|Q8KJ20|CH60_STRAP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|21310096|gb|AAM46144.1|AF378195_2 GroEL [Streptococcus anginosus]
 gi|319810545|gb|EFW06881.1| chaperonin [Streptococcus anginosus 1_2_62CV]
          Length = 540

 Score =  488 bits (1256), Expect = e-136,   Method: Composition-based stats.
 Identities = 278/543 (51%), Positives = 378/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKAN   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 TAVATAVEALKANSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A+++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A KV + KD T IV G+G +E I  R+  I+  IE + SD+D
Sbjct: 300 TEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGDAEAIANRVAVIKSQIESSTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+     + D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLSAVEALDLSGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M     MG
Sbjct: 479 TGEWVNMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPTPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|222106811|ref|YP_002547602.1| chaperonin [Agrobacterium vitis S4]
 gi|254813866|sp|B9K1Y8|CH60_AGRVS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|221737990|gb|ACM38886.1| chaperonin [Agrobacterium vitis S4]
          Length = 547

 Score =  488 bits (1256), Expect = e-136,   Method: Composition-based stats.
 Identities = 317/530 (59%), Positives = 415/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK G  AR+ + +GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFGRTAREKMLHGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANGD ++G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKISTSEEVAQVGTISANGDTQVGKDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYVLLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK+ ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLDMLGRAKKISITKENTTIVDGAGQKSDIEGRVAQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKERKDRIDDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI  NAGDE+ +IV KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRRALQSLVRQIATNAGDEASIIVGKILDKDNDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   FGDM  MGI+DPVKVVR ALQ+A S+A +++ TEA++ + PK ++A
Sbjct: 481 QTGEFGDMIAMGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKDSA 530


>gi|91978588|ref|YP_571247.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
 gi|123721548|sp|Q130Z3|CH602_RHOPS RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|91685044|gb|ABE41346.1| chaperonin GroEL [Rhodopseudomonas palustris BisB5]
          Length = 550

 Score =  488 bits (1256), Expect = e-136,   Method: Composition-based stats.
 Identities = 308/536 (57%), Positives = 401/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFAGDARDRMLRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD++RGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  V++ +    K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVIKDIGKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDVYILLHEKKVSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEELGVKLESVTLKMLGRAKKVVIDKENTTIVNGAGKKADIEARVQQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + P++  A+P MP
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDAASVAALLVTTEAMVAELPRE--AAPAMP 534


>gi|49476034|ref|YP_034075.1| chaperonin GroEL [Bartonella henselae str. Houston-1]
 gi|6226790|sp|O33963|CH60_BARHE RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Heat shock protein 60; AltName:
           Full=Protein Cpn60
 gi|2358234|gb|AAB69094.1| heat shock protein HSP60 [Bartonella henselae str. Houston-1]
 gi|49203113|emb|CAG44447.1| heat shock protein [Bartonella henselae str. Houston-1]
 gi|49238842|emb|CAF28126.1| Chaperonin protein groEL [Bartonella henselae str. Houston-1]
          Length = 547

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 315/530 (59%), Positives = 403/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKSEINARVNQIKVQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    +GYN 
Sbjct: 421 RAANALTVKGSNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T 
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDTP 530


>gi|312868113|ref|ZP_07728317.1| chaperonin GroL [Streptococcus parasanguinis F0405]
 gi|322390763|ref|ZP_08064275.1| chaperone GroEL [Streptococcus parasanguinis ATCC 903]
 gi|311096517|gb|EFQ54757.1| chaperonin GroL [Streptococcus parasanguinis F0405]
 gi|321142590|gb|EFX38056.1| chaperone GroEL [Streptococcus parasanguinis ATCC 903]
          Length = 541

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 284/547 (51%), Positives = 380/547 (69%), Gaps = 8/547 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSSDARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V S+E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVATAVEALKNNAIPVSSKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE T S++D
Sbjct: 300 TDDLGLELKDATIEALGQAAKVSVDKDSTVIVEGSGNPEAIANRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VISAVAALELEGDEATGRNIVLRALEEPVRQIAHNAGYEGSIVIDRLKNAEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM- 540
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+     P  PAG GM 
Sbjct: 479 TGEWVNMIDAGIIDPVKVSRSALQNAASVASLILTTEAVVANKPE-----PAAPAGPGMD 533

Query: 541 GGGMGGM 547
              MGGM
Sbjct: 534 PSMMGGM 540


>gi|294625357|ref|ZP_06703992.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292600337|gb|EFF44439.1| chaperonin GroEL [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 543

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 307/550 (55%), Positives = 407/550 (74%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI+ G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D++GDGTTTAT LAQA+  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LK   K     + I QV TISAN D  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIAEAMQKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYF+ + +  +A++++P+IL++DKKIS ++ LLP+LE  
Sbjct: 181 SGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNVRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AE+VEG+ALATLVVN +R  + V+AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAVLTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKATI DLG AKKV +SK++TTI+ G G +  IE R+ +I+  IEDT SDY
Sbjct: 301 ISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTAAIESRVGQIKTQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG NEDQ  GI+I  +A+  P R+I+ NAG+E  +I++K++E  + NYGYN
Sbjct: 421 RALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEG-SGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    FGDM + GI+DP KV R+ALQ+A S+AG+M+ TEA+V DAPK +   P +PA   
Sbjct: 480 AANGEFGDMVQFGILDPTKVTRSALQNAASIAGLMITTEAMVADAPKKDE--PALPA--- 534

Query: 540 MGGGMGGMDM 549
            GGGMGGMD 
Sbjct: 535 -GGGMGGMDF 543


>gi|229159422|ref|ZP_04287441.1| 60 kDa chaperonin 2 [Bacillus cereus R309803]
 gi|228624052|gb|EEK80859.1| 60 kDa chaperonin 2 [Bacillus cereus R309803]
          Length = 544

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 376/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +  I QVA ISA  D E+GE IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKTISKPIEGKSSIAQVAAISAA-DEEVGELIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A K+V++K++TT+V G G +++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|152238|gb|AAA26287.1| groEL [Sinorhizobium meliloti]
          Length = 541

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 313/550 (56%), Positives = 409/550 (74%), Gaps = 10/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ LK N +K+    EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M  E+E+PYILI++KK+S LQ +LP+LE  
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLERV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKKV + K++TTI+ G G    IEGR  +I+  IE+T SDY
Sbjct: 301 VSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D++ ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAVHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +K  N DQ  G+++VR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDGLKTANNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ + +GD++ MG+IDP KVVR  LQ A S+AG+++ TEA++ + PK E A    P    
Sbjct: 481 AQTNEYGDLYAMGVIDPAKVVRTGLQDAASVAGLLVTTEAMIAEKPKKEAAPAFRPR--- 537

Query: 540 MGGGMGGMDM 549
                 GMD 
Sbjct: 538 ------GMDF 541


>gi|89055849|ref|YP_511300.1| chaperonin GroEL [Jannaschia sp. CCS1]
 gi|119366245|sp|Q28LY7|CH60_JANSC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|88865398|gb|ABD56275.1| chaperonin GroEL [Jannaschia sp. CCS1]
          Length = 546

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 294/532 (55%), Positives = 409/532 (76%), Gaps = 1/532 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD++  T AR+ +  GVNTLA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I 
Sbjct: 1   MAKDVRFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKSVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LAV +V+  ++ + ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ K
Sbjct: 121 LAVTKVIAEIQGSAREVADSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEENK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQP++P+LE+  
Sbjct: 181 GLETETDVVEGMQFDRGYLSPYFVTNPDKMIAELDDCLILLHEKKLSSLQPMVPLLETVI 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 241 QSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++G+KLE  T+  LG+AK++ +SKD+TTIV G G    IE R+ +I++ IE++ SDYD
Sbjct: 301 AEDLGMKLESVTMDMLGTAKRLTISKDETTIVDGAGNKPEIEARVAQIRQQIEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ER+AKLAGGVAV++VG ++E  + E+KDR  D+L+ATRAA  EGIV GGG+ALV+
Sbjct: 361 REKLQERVAKLAGGVAVIKVGGMSEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALVQ 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
             ++L+ ++G+N DQ AGI IVR+AL  P RQI +N+G +  ++  KI+ES    +G+NA
Sbjct: 421 GGKSLAGLEGENADQNAGIAIVRRALEAPLRQIAENSGVDGSVVAGKIRESDDNAFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           Q   +GD+F+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A  
Sbjct: 481 QTEEYGDLFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPAKEGAPA 532


>gi|323340151|ref|ZP_08080415.1| chaperone GroEL [Lactobacillus ruminis ATCC 25644]
 gi|323092342|gb|EFZ34950.1| chaperone GroEL [Lactobacillus ruminis ATCC 25644]
          Length = 537

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 277/539 (51%), Positives = 392/539 (72%), Gaps = 2/539 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR  +  GV+ LA+ VK T+GPKGR V++  S+GAP +T DGVT+AK+I 
Sbjct: 1   MAKEIKFSEDARSKMLAGVDKLADTVKSTIGPKGRNVVLEQSYGAPTITNDGVTIAKAIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI NEG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V+ LK    KV S+ +I Q+A IS+  +   G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVDALKKMSHKVESKSDIAQIAAISSANEET-GKLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ DRGY+S Y VT  ++M A+++NPYIL+ DKKIS +Q +LP+L+S  
Sbjct: 180 GIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILVTDKKISNIQEILPLLQSIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           + GRPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L+DIA + GATVI
Sbjct: 240 EQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIAVLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG+A +V ++K++TTIV G+G   +I+ R+++++K I +T SD+D
Sbjct: 300 TDDLGLQLKDATINQLGTAGRVTVTKENTTIVEGSGDKAQIKERVDQLRKQIAETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EG VPGGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++   ++ D   GI IV++AL  P RQI +NAG E  +IV K++E +    GYNA 
Sbjct: 420 VIGAVADLKESGDVQTGINIVKRALEEPVRQIAENAGLEGSVIVEKLKEQE-PGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
              + DM + GI+DP KV R+ALQ+A S++ ++L TEAVV D P+ +  +PQMP GG M
Sbjct: 479 TDEWVDMVKEGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPKETAPQMPQGGMM 537


>gi|229028108|ref|ZP_04184254.1| 60 kDa chaperonin 2 [Bacillus cereus AH1271]
 gi|229171102|ref|ZP_04298699.1| 60 kDa chaperonin 2 [Bacillus cereus MM3]
 gi|228612375|gb|EEK69600.1| 60 kDa chaperonin 2 [Bacillus cereus MM3]
 gi|228733199|gb|EEL84035.1| 60 kDa chaperonin 2 [Bacillus cereus AH1271]
          Length = 544

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 276/534 (51%), Positives = 375/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +  LK   K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIAELKEISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ ATI  LG A KVV++K++TT+V G G S++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATIESLGRAGKVVVTKENTTVVEGIGNSQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPAMP 530


>gi|110680677|ref|YP_683684.1| chaperonin GroEL [Roseobacter denitrificans OCh 114]
 gi|118597100|sp|Q162U5|CH602_ROSDO RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|109456793|gb|ABG32998.1| 60 kDa chaperonin 1, putative [Roseobacter denitrificans OCh 114]
          Length = 547

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 303/532 (56%), Positives = 401/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATVKVVAAIKDAAREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+  +L+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELEDCIVLLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKIQITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + GDN DQ  GI IVRKAL  P RQI +NAG +  ++  KI+ES    +G+N
Sbjct: 421 QAGKHLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF  G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPAKEGAA 532


>gi|260584636|ref|ZP_05852382.1| chaperonin GroL [Granulicatella elegans ATCC 700633]
 gi|260157659|gb|EEW92729.1| chaperonin GroL [Granulicatella elegans ATCC 700633]
          Length = 539

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 278/546 (50%), Positives = 374/546 (68%), Gaps = 7/546 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             KDIK    AR ++  GV+ LA  VK TLGPKGR V++  +FG+P +T DGVT+AK I 
Sbjct: 1   MVKDIKFSEDARASMLRGVDILANTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L    + V S+E I QVA IS+     +G  IA AME++G  G+ITI+++K
Sbjct: 121 LATRAAVEELHKISRPVESKEAIAQVAAISSGSQE-VGSLIAEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A ++NP+ILI DKK+S +Q ++P+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMVAHLDNPFILITDKKVSNIQEIIPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GR L IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + GA VI
Sbjct: 240 QQGRALLIIADDVDGEALPTLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGAQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ AT+A LG+A KVV+SKD+TTIV G G  E I  R+  I+   +DT SD+D
Sbjct: 300 TEDLGLELKDATLAQLGTAGKVVVSKDNTTIVEGAGSKELISNRVALIRSQAQDTTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L EKK R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEKKLRIEDALNATRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + +       D+  G +IV ++L  P RQI  NAG E  +IV+ ++  +    GYNA 
Sbjct: 420 VQKTVDALELEGDEATGAKIVSRSLEEPLRQIATNAGLEGSVIVAHLKAQE-LGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P      P  PA  GM 
Sbjct: 479 SDEWVNMIEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKP-----IPAAPAMPGMD 533

Query: 542 GGMGGM 547
            GMG M
Sbjct: 534 PGMGMM 539


>gi|271970089|ref|YP_003344285.1| chaperonin GroEL [Streptosporangium roseum DSM 43021]
 gi|270513264|gb|ACZ91542.1| chaperonin GroEL [Streptosporangium roseum DSM 43021]
          Length = 541

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 272/541 (50%), Positives = 381/541 (70%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MAAKMIAFDEDARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NPM +K+GI
Sbjct: 61  ELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMSLKKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ V E L    K V ++ +I   A+ISA    +IGE IA AM+++G  G+IT++++
Sbjct: 121 EAAVERVSEELSKLAKDVETKAQIASTASISAGDP-QIGEMIAEAMDKVGKEGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            T   E+ + +GM+ D+GYISPYFVT  ERM A +++PYIL+ + KISA + LLP+L+  
Sbjct: 180 NTFGLELELTEGMRFDKGYISPYFVTDPERMEAVLDDPYILVVNSKISANKDLLPVLDKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R     +AVKAP FGDRRK +L DI  + GA V
Sbjct: 240 VQAGKPLLIIAEDIEGEALATLVVNKIRGLFRSVAVKAPGFGDRRKAMLGDIGILTGAQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++GLKLE  T+  LG A++V+++KD+TTIV G G +E+I GR+N+I+  I++T SDY
Sbjct: 300 ISEDLGLKLESTTLDQLGRARQVIVTKDETTIVDGGGDAEQIAGRVNQIRAEIDNTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++ G  TE  L E+K R +D++   +AA +EGIVPGGG+AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVPGGGVALL 419

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A A+A      + D+  G  IV+KAL  P +QI  NAG E  ++V K++   T   G N
Sbjct: 420 QAGAKAFDKLELSGDEATGAAIVKKALEEPLKQIAVNAGLEGGVVVEKVRNL-TPGEGLN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + +MFE GIIDP KV R+ALQ+A S+A + L TEAV+ + P+   A+P MP GG 
Sbjct: 479 AATGEYVNMFESGIIDPAKVTRSALQNAASIAALFLTTEAVIAEKPEKAGAAPAMPGGGD 538

Query: 540 M 540
           M
Sbjct: 539 M 539


>gi|289549213|ref|YP_003474201.1| chaperonin GroEL [Thermocrinis albus DSM 14484]
 gi|289182830|gb|ADC90074.1| chaperonin GroEL [Thermocrinis albus DSM 14484]
          Length = 545

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 294/542 (54%), Positives = 395/542 (72%), Gaps = 7/542 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  +  GV+ LA AVK TLGP+GR VII   +G P VTKDGVTVAK I
Sbjct: 1   MAAKRVVYGEEARAKLKAGVDKLANAVKVTLGPRGREVIIEKKWGTPLVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ +  +GA+++++VA+ T D +GDGTTTAT LAQAI+NEG K + +G NPMDIKRGI
Sbjct: 61  ELKDPYENMGAQLVKEVASKTADVAGDGTTTATVLAQAIFNEGLKAIASGANPMDIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AVQ VVE +K     V  R+EI QVATISAN D  IG+ IA AME +G  G+IT++++
Sbjct: 121 DRAVQVVVEEIKKLSIPVSGRKEIEQVATISANNDPTIGKIIADAMEAVGKDGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+A T +  VQGMQ DRGY+SPYF+T+ ++M   +E P+ILIY+KKIS ++ LLP+LE  
Sbjct: 181 KSAETTLETVQGMQFDRGYLSPYFITNPDKMECVLEEPFILIYEKKISNVKDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+P+ +IAEDVEG+ALATLVVN ++  +   AVKAP FG RRK+ L+DIA + G T 
Sbjct: 241 VRAGKPILVIAEDVEGEALATLVVNHIKGVIRACAVKAPGFGQRRKDYLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+G+KLE  T+  LG A KV++ KD+TTIVGG G  E I+ RI +I+K I++T SDY
Sbjct: 301 ITEELGIKLENVTLDMLGRADKVIVDKDNTTIVGGKGSKEAIQARIEQIKKQIQETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVA++ VG  TEA + EKK R +D++ AT+AA +EGIVPGGG+ALV
Sbjct: 361 DREKLQERLAKLSGGVAIIRVGAATEAEMKEKKARVEDAVHATKAAVEEGIVPGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQE---SKTANY 476
           RA++AL  +K DN DQ  G++I++KA   P RQI  NAG E  +++ K+ +    K  N+
Sbjct: 421 RASEALENLKLDNPDQQIGVDIIKKACRTPIRQIAANAGFEGYVVLEKVLQLGKEKGKNW 480

Query: 477 GYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET---ASPQ 533
           G++A    + DM E GIIDP KVVR A+Q+A S+AG ML  EA+V + P+++     SP+
Sbjct: 481 GFDAATGEYKDMVEAGIIDPTKVVRTAIQNAASVAGTMLTAEALVAEVPEEKKEKTPSPE 540

Query: 534 MP 535
           MP
Sbjct: 541 MP 542


>gi|220933625|ref|YP_002512524.1| chaperonin GroEL [Thioalkalivibrio sp. HL-EbGR7]
 gi|254813906|sp|B8GL19|CH60_THISH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|219994935|gb|ACL71537.1| chaperonin GroEL [Thioalkalivibrio sp. HL-EbGR7]
          Length = 546

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 291/534 (54%), Positives = 396/534 (74%), Gaps = 2/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+++    AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MSAKEVRFSDDARSRMVRGVNVLANAVKVTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++V++ T D +GDGTTTAT LAQAI  EG K VTAG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVSSQTSDIAGDGTTTATVLAQAIVREGMKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K     + I QV TISAN D  IG+ IA AM ++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKKLSKPCTDSKAIAQVGTISANSDESIGQIIADAMAKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            +   E+ VV+GMQ DRGY+SPYFV + + M+AE+++ ++L+YDKKIS ++ LLP+LE  
Sbjct: 181 SSLENELDVVEGMQFDRGYLSPYFVNNQQNMSAELDDCFVLLYDKKISNIRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAED+EG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKAGKPLLIIAEDIEGEALATLVVNTIRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKA++ DLG AK++V++K+++TI+ G G  + I+GR+ +I+  IED  SDY
Sbjct: 301 ISEEVGLSLEKASLDDLGQAKRIVVTKENSTIIDGAGKPDEIKGRVEQIRAQIEDATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QAL S+KG N DQ  GI I R+A+  P RQI+ N G+E  ++++ + E K  NYGYN
Sbjct: 421 RALQALKSLKGANHDQDIGIAIARRAMEEPLRQIVSNCGEEPSVVLNNVVEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
           A    +GDM EMGI+DP KV R+ALQ+A S++G+++ TEA+V + PK   ++P 
Sbjct: 480 AATGEYGDMIEMGILDPTKVTRSALQNAASVSGLIITTEAMVAELPKKGDSAPA 533


>gi|296113705|ref|YP_003627643.1| chaperonin protein Cpn60 [Moraxella catarrhalis RH4]
 gi|295921399|gb|ADG61750.1| chaperonin protein Cpn60 [Moraxella catarrhalis RH4]
 gi|326562445|gb|EGE12764.1| chaperonin GroEL [Moraxella catarrhalis 7169]
 gi|326563219|gb|EGE13487.1| chaperonin GroEL [Moraxella catarrhalis 12P80B1]
 gi|326563465|gb|EGE13728.1| chaperonin GroEL [Moraxella catarrhalis 103P14B1]
 gi|326569153|gb|EGE19215.1| chaperonin GroEL [Moraxella catarrhalis BC1]
 gi|326572959|gb|EGE22938.1| chaperonin GroEL [Moraxella catarrhalis CO72]
 gi|326573775|gb|EGE23732.1| chaperonin GroEL [Moraxella catarrhalis 101P30B1]
          Length = 545

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 294/533 (55%), Positives = 385/533 (72%), Gaps = 2/533 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+  G+ AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I 
Sbjct: 1   MAKDVSFGSNAREKMIDGVNILADAVKVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILVEGMKTVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE ++A        + I QV +ISAN D  IGE I+ AME +G  G+IT+++  
Sbjct: 121 KAVRAAVEEIRAISTPANDHKAIAQVGSISANSDATIGELISKAMETVGKQGVITVEEGS 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
                + VV+GMQ DRGYISPYF    + +T E +NP+IL+ DKKIS ++ ++P+LE   
Sbjct: 181 GFEDALEVVEGMQFDRGYISPYFANKQDSLTCEFDNPFILLVDKKISNIREIVPLLEKVM 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+ RPL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 241 QTSRPLLIIAEDVENEALATLVVNTLRGGLKTCAVKAPGFGDRRKAMLQDIAILTGGVVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL LE A I  LG+AKKV + K++T IV G G    IE R+  I++ +E++ SDYD
Sbjct: 301 SEEVGLSLETAEIEHLGTAKKVTIGKENTVIVDGAGDKASIEARVESIRRQVEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKL+GGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVR
Sbjct: 361 KEKLQERVAKLSGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVR 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A  ALS +KGDNEDQ AGI I+R+A+  P RQI+ NAGDE+ +IV++++   + NYGYNA
Sbjct: 421 ALSALSDLKGDNEDQNAGINILRRAMEAPLRQIVSNAGDEASVIVNEVKNG-SGNYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
               +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P  E   P 
Sbjct: 480 ASGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTEVMITDKPAPEAPMPA 532


>gi|260425778|ref|ZP_05779758.1| chaperonin GroL [Citreicella sp. SE45]
 gi|260423718|gb|EEX16968.1| chaperonin GroL [Citreicella sp. SE45]
          Length = 546

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 305/532 (57%), Positives = 406/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR  +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARTRMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEAIKAAARPVNDTNEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+++  IL+++KK+S+LQP++P+LES 
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELDDCMILLHEKKLSSLQPMVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTVDMLGSAKKVSITKDETTIVDGAGEKAEIEARVSQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A++L  ++G N DQ AGI IVRKAL  P RQI +NAG +  ++  KI+ES+   +GYN
Sbjct: 421 QGAKSLDGLEGANSDQNAGITIVRKALEAPLRQIAQNAGVDGSVVAGKIRESEDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ +  +
Sbjct: 481 AQTDEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPQKDAPA 532


>gi|52079060|ref|YP_077851.1| chaperonin GroEL [Bacillus licheniformis ATCC 14580]
 gi|52784430|ref|YP_090259.1| chaperonin GroEL [Bacillus licheniformis ATCC 14580]
 gi|319648637|ref|ZP_08002849.1| chaperonin [Bacillus sp. BT1B_CT2]
 gi|68566268|sp|Q65MZ8|CH60_BACLD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|52002271|gb|AAU22213.1| class I heat-shock protein (chaperonin) [Bacillus licheniformis
           ATCC 14580]
 gi|52346932|gb|AAU39566.1| GroEL [Bacillus licheniformis ATCC 14580]
 gi|317389285|gb|EFV70100.1| chaperonin [Bacillus sp. BT1B_CT2]
          Length = 544

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/528 (51%), Positives = 373/528 (70%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK   K +  +E I QVA+ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVAVAVESLKEISKPIEGKESIAQVASISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYIL+ DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILVTDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + GA VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISILTGAEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G G +E+I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQINQLGRASKVVVTKENTTIVEGAGDTEQIAARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  +IV +++  +    GYNA 
Sbjct: 420 VYNKVAALEAEGDELTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M + GI+DP KV R+ALQ+A S+A M L TEAVV D P++  
Sbjct: 479 TGEWVNMIDKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENK 526


>gi|315649232|ref|ZP_07902321.1| chaperonin GroEL [Paenibacillus vortex V453]
 gi|315275220|gb|EFU38589.1| chaperonin GroEL [Paenibacillus vortex V453]
          Length = 542

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 274/534 (51%), Positives = 378/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRAMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GID
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMIIRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V  L+   K+V + +EI QVA++SA  D  +G+ IA AM+++G  G+IT+++++
Sbjct: 121 KAVKAAVIELQNIAKEVKNHQEIAQVASVSAADDE-VGQLIAEAMDKVGKDGVITVEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGYISPY +T T++M A +ENPYILI DKK++  Q +LPILE   
Sbjct: 180 GFLTELEVVEGMQFDRGYISPYMITDTDKMEAVLENPYILITDKKVTNTQEILPILEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAED+EG+A A L+VN++R     +AVKAP FGDRRK +L+DIAA+ G  VI
Sbjct: 240 QQGKPLVLIAEDIEGEAQAMLIVNKLRGTFNAVAVKAPGFGDRRKAMLQDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A+I  LG+A++V ++K++T IV G G  E I+ R+ +I+  +E+T SD+D
Sbjct: 300 TEELGLDLKTASIDQLGTARQVRVTKENTIIVDGAGNKEDIDARVKQIRNQLEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+S      D+  G+ IV +AL  P R I  NAG E  +IV ++++ +    GYNA 
Sbjct: 420 VYNAVSAVEVQGDEKTGVNIVLRALEEPIRTIAANAGKEGSVIVERLKKEE-IGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +MFE GI+DP KV R+ALQ+A S+A M L TEAV+ D P+ E   P MP
Sbjct: 479 TDEWVNMFEAGIVDPAKVTRSALQNAASVAAMFLTTEAVIADKPEPEK--PAMP 530


>gi|182678711|ref|YP_001832857.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039]
 gi|226704088|sp|B2ICU4|CH60_BEII9 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|182634594|gb|ACB95368.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 548

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 309/534 (57%), Positives = 409/534 (76%), Gaps = 1/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + ARD +  GV  LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+   D++GDGTTTAT LA +I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LKAN KKV S +EI QV TISANGD+ +G+ I+ AM+++G  G+IT+++A
Sbjct: 121 DHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYIL+++KK+S+LQ +LP+LE+ 
Sbjct: 181 KSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G T+
Sbjct: 241 VQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+A LG AK++ + K+ TTI+ G G  + IEGRI++I+  I +T SDY
Sbjct: 301 ISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+K++ERLAKLAGGVAVL VG  TE  + EKKDR  D+L+ATRAA +EG+ PGGG+AL+
Sbjct: 361 DREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +  DN DQ AGIEIVRKA+  P +QI+ N+G +  ++V K+ ES    +GYN
Sbjct: 421 RAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
           AQ   +GDM ++GIIDP KVVR ALQ A S+AG+++ TEA + +APK E   P 
Sbjct: 481 AQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPKKEAPLPP 534


>gi|260576472|ref|ZP_05844462.1| chaperonin GroEL [Rhodobacter sp. SW2]
 gi|259021355|gb|EEW24661.1| chaperonin GroEL [Rhodobacter sp. SW2]
          Length = 546

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 297/532 (55%), Positives = 402/532 (75%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  +G K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKDGLKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +KA  + V    E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVAAIKAASRPVSDSAEVAQVGTISANGEVEIGRQIAEAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGLETETEVVEGMQFDRGYLSPYFVTNPDKMVADLEDVLILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE   I  LG AKKV ++KD+TTIV G+G    I+ R+ +I++ IEDT SDY
Sbjct: 301 ISDDLGMKLENVGIDMLGRAKKVTITKDNTTIVDGHGDKAEIKARVAQIRQQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRAAVQEGIVVGGGVALM 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA +L  V G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ESK   +G+N
Sbjct: 421 QAAGSLDGVTGANADQNAGIAIVRRALEAPLRQIAQNAGVDGAVVAGKVRESKDKTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+A +++ TEA++ D P+ +  +
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRIALEDAASVASLLITTEAMIADRPEPKGNA 532


>gi|2493641|sp|P95678|CH60_RHOCA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|1699436|gb|AAB37532.1| Cpn60 [Rhodobacter capsulatus]
          Length = 545

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 296/533 (55%), Positives = 398/533 (74%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T ARD +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA   VVE +KA  + V   +E+ QV TISANG+ +IG  IA A +++G  G+IT+++ 
Sbjct: 121 DLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADASQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKV +SK++TTIV G+G    I  R+  I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAHIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +AA+ L  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAAKKLNDLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TE ++ + P+ + A  
Sbjct: 481 AQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPKAAPA 533


>gi|319779133|ref|YP_004130046.1| Heat shock protein 60 family chaperone GroEL [Taylorella
           equigenitalis MCE9]
 gi|317109157|gb|ADU91903.1| Heat shock protein 60 family chaperone GroEL [Taylorella
           equigenitalis MCE9]
          Length = 547

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 292/536 (54%), Positives = 391/536 (72%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AK +  G  AR  I  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MTAKQVFFGDDARSRIVRGVNVLANAVKTTLGPKGRNVVLERSFGAPLVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++R+VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENIGAQLVREVASKTADNAGDGTTTATVLAQAIVEEGLKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ L+   +   + +EI QVA+ISAN D  +GE IA AM+++G  G+IT++  
Sbjct: 121 DKAVAASVDELQKLSRPSSTSKEIAQVASISANSDTSVGEIIANAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A +++PYILI+DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINNGEKQIAALDDPYILIHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA +    V
Sbjct: 241 AKTSRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAVLTNGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G+ LE AT+ +LG AK+V + K+ TT++ G G  ++IE R+N I++ I+++ SDY
Sbjct: 301 ISEETGMSLETATLENLGQAKRVEVGKESTTVIDGAGAVDKIEERVNLIRRQIDESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+ +VKGDN DQ AGI++V +A+  P R I+ NAG+E  ++++ +   +  NYGYN
Sbjct: 421 RTKQAIAAVKGDNADQDAGIKLVLRAIEAPLRTIVSNAGEEPSVVLNNVLNGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM E G++DP KV RNALQ+A S+A ++L TEA V +  +D+ A P MP
Sbjct: 480 AATGEYGDMMEQGVLDPTKVTRNALQNAASVASLLLTTEAAVTEVVEDKPA-PAMP 534


>gi|15964949|ref|NP_385302.1| chaperonin GroEL [Sinorhizobium meliloti 1021]
 gi|307301020|ref|ZP_07580789.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
 gi|307317754|ref|ZP_07597192.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|7404334|sp|P35470|CH602_RHIME RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|15074128|emb|CAC45775.1| 60 KD chaperonin B (GroEL) protein [Sinorhizobium meliloti 1021]
 gi|306896516|gb|EFN27264.1| chaperonin GroEL [Sinorhizobium meliloti AK83]
 gi|306903975|gb|EFN34561.1| chaperonin GroEL [Sinorhizobium meliloti BL225C]
          Length = 542

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 316/541 (58%), Positives = 414/541 (76%), Gaps = 2/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  + ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V+ L+ N +KV    EI QVATISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVEAIVKELRNNARKVSKNAEIAQVATISANGDAEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GM+ DRGY+SPYF+T+ E+M  E+E+ YIL+++KK+S LQ ++PILES 
Sbjct: 181 KTAEIELEVVEGMEFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNLQAMIPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKSMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  T+  LG AK++++ K+ TTIV G G  E I GR+ +I+  IEDT SDY
Sbjct: 301 ISEELGIKLENTTMDTLGRAKRIMVDKETTTIVDGAGSKEDIGGRVAQIKAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R   AL+ +   N+DQ  GIEIVR+A+  P RQI +NAG E  +IV K++E +   +G+N
Sbjct: 421 RVVSALNGLATANDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKQDFAFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD+F+MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK +   PQMP GGG
Sbjct: 481 AQTGEFGDLFQMGVIDPAKVVRAALQDAASIAGLLVTTEAMIAEKPKKDGQ-PQMPPGGG 539

Query: 540 M 540
           M
Sbjct: 540 M 540


>gi|78221257|ref|YP_383004.1| chaperonin GroEL [Geobacter metallireducens GS-15]
 gi|119366243|sp|Q39ZP5|CH60_GEOMG RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|78192512|gb|ABB30279.1| chaperonin GroEL [Geobacter metallireducens GS-15]
          Length = 546

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 296/527 (56%), Positives = 383/527 (72%), Gaps = 1/527 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK     R+AI  GVNTLA+AVK TLGPKGR VII  SFG+P +TKDGVTVAK I 
Sbjct: 1   MAKIIKFDQEGRNAILKGVNTLADAVKVTLGPKGRNVIIEKSFGSPLITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQAIY +G K V AG NPM+IKRGID
Sbjct: 61  LEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ +V  L+   K +   +EI QV TISAN D+ IG  IA AME++G  G+IT+++AK
Sbjct: 121 SAVETIVAELQKISKPIKDHKEIAQVGTISANNDKTIGGIIAEAMEKVGKEGVITVEEAK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T +  V+GMQ DRGY+SPYFVT  ERM A +EN  ILI+DKKIS ++ LLPILE   
Sbjct: 181 AMETSLETVEGMQFDRGYLSPYFVTDPERMEASLENANILIHDKKISNMKDLLPILEQTA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +SGRPL IIAED+EG+ALATLVVN++R  L + AVKAP FGDRRK +L DIA + G  VI
Sbjct: 241 KSGRPLLIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAVLTGGKVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT   LG+AK+V + KD+TTI+ G+G    I+GR+ +I+  IE+T SDYD
Sbjct: 301 SEELGFKLENATFDMLGTAKRVTIDKDNTTIIDGDGSEADIQGRVKQIRAQIEETSSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA DEGIVPGGG+A +R
Sbjct: 361 REKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVAYIR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           +  AL       +Q  G+ ++++AL  P RQI +NAG +  ++V K++  K A +G+NA 
Sbjct: 421 SLGALEGISLPAEQQFGVTLIKRALEEPIRQIAQNAGVDGSIVVDKVKNGKDA-FGFNAA 479

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
              + DM   GIIDP KV R+ALQ+A S+AG+ML TEA++ D PK+E
Sbjct: 480 DDEYVDMIAAGIIDPTKVSRSALQNAASVAGLMLTTEAMIADKPKEE 526


>gi|90962186|ref|YP_536102.1| chaperonin GroEL [Lactobacillus salivarius UCC118]
 gi|119366246|sp|Q1WSW0|CH60_LACS1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|90821380|gb|ABE00019.1| 60 kDa chaperonin GROEL [Lactobacillus salivarius UCC118]
 gi|90823040|gb|ABE01047.1| 60 kDa chaperonin [Lactobacillus salivarius]
          Length = 540

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 279/543 (51%), Positives = 390/543 (71%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR  +  GV+ LA  VK T+GPKGR V++  S+G+P +T DGVT+AK+  
Sbjct: 1   MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKATD 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI NEG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  V+ L      V S+ +I QVA+IS+  + E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVDALHEMSHTVESKSDIAQVASISSA-NEEVGKLIADAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ DRGY+S Y VT  ++M A+++NPYIL+ DKKIS +Q +LP+L+S  
Sbjct: 180 GIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GRPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L+DIA + GATVI
Sbjct: 240 QQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+  T+  LGSA KV ++K++TTIV G G  ++I  R+ +I+K I +T SD+D
Sbjct: 300 TDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EG VPGGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++   +  D   GI IV++AL  P RQI +NAG E  +IV K++E K    G+NA 
Sbjct: 420 VIGKVAALEEEGDVQTGINIVKRALEEPVRQIAENAGLEGSVIVEKLKEQK-PGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
            + + DM E GI+DP KV R+ALQ+A S++ ++L TEAVV D P+ E+ + QMPA  GMG
Sbjct: 479 TNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPESNN-QMPATPGMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|326562814|gb|EGE13109.1| chaperonin GroEL [Moraxella catarrhalis 46P47B1]
 gi|326570639|gb|EGE20675.1| chaperonin GroEL [Moraxella catarrhalis BC7]
 gi|326571346|gb|EGE21363.1| chaperonin GroEL [Moraxella catarrhalis BC8]
          Length = 545

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 294/533 (55%), Positives = 385/533 (72%), Gaps = 2/533 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+  G+ AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I 
Sbjct: 1   MAKDVSFGSNAREKMIDGVNILADAVKVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILVEGMKTVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE ++A        + I QV +ISAN D  IGE I+ AME +G  G+IT+++  
Sbjct: 121 KAVRAAVEEIRAISTPANDHKAIAQVGSISANSDATIGELISKAMETVGKQGVITVEEGS 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
                + VV+GMQ DRGYISPYF    + +T E +NP+IL+ DKKIS ++ ++P+LE   
Sbjct: 181 GFEDALEVVEGMQFDRGYISPYFANKQDSLTCEFDNPFILLVDKKISNIREIVPLLEKVM 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+ RPL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 241 QTSRPLLIIAEDVENEALATLVVNTLRGGLKTCAVKAPGFGDRRKAMLQDIAILTGGVVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL LE A I  LG+AKKV + K++T IV G G    IE R+  I++ +E++ SDYD
Sbjct: 301 SEEVGLSLETAEIEHLGTAKKVTIGKENTVIVDGAGDKASIEARVESIRRQVEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKL+GGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVR
Sbjct: 361 KEKLQERVAKLSGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVR 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A  ALS +KGDNEDQ AGI I+R+A+  P RQI+ NAGDE+ +IV++++   + NYGYNA
Sbjct: 421 ALSALSDLKGDNEDQNAGINILRRAMEAPLRQIVSNAGDEASVIVNEVKNG-SGNYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
               +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P  E   P 
Sbjct: 480 ASGKYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTEVMITDKPAPEAPMPA 532


>gi|23015493|ref|ZP_00055267.1| COG0459: Chaperonin GroEL (HSP60 family) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 552

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 307/530 (57%), Positives = 401/530 (75%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRG+
Sbjct: 61  ELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  +K+  +KV +  EI QV TISANG++EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVAAVVADVKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E++NPYIL+++KK+S LQPLLP+LE  
Sbjct: 181 KGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTVELDNPYILLHEKKLSGLQPLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG++K++ ++K+DTTIV G+G    I+ R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLESVNLEMLGTSKRITITKEDTTIVDGSGDKSAIDARCKQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGASEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +K  N DQ  GI IVR+AL  P RQI +NAG +  ++  KI ESK   +G++
Sbjct: 421 HAVKALEGLKSGNADQEVGISIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDLAFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ  V+ DM + GIIDP KVVR ALQ A S+AG+++ TEA++ + PK + 
Sbjct: 481 AQTGVYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPKKDA 530


>gi|319654650|ref|ZP_08008731.1| chaperonin [Bacillus sp. 2_A_57_CT2]
 gi|317393716|gb|EFV74473.1| chaperonin [Bacillus sp. 2_A_57_CT2]
          Length = 543

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 280/534 (52%), Positives = 381/534 (71%), Gaps = 3/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV++LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDSLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K + ++E I QVA ISA  +  +G+ IA AME++G  G+ITI+++K
Sbjct: 121 KAVVTAVEELKAISKPIENKESIAQVAAISAADNE-VGQLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYILI DKKI+++Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITSIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL ++AEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLVAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ ATI  LG A KVV++K++TTIV G G S +I GR+N+I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATIDSLGRATKVVVTKENTTIVEGAGDSAQIGGRVNQIRTQMEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG+AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGVALLN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  G+ IV +A+  P R I  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAIQAEGDEATGVNIVLRAMEEPVRTIAHNAGLEGSIIVDRLK-REAVGTGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+AGS+A M L TEAVV D P+ E A+P MP
Sbjct: 479 TGEWVNMIEAGIVDPTKVTRSALQNAGSVAAMFLTTEAVVADKPE-ENAAPAMP 531


>gi|261409071|ref|YP_003245312.1| chaperonin GroEL [Paenibacillus sp. Y412MC10]
 gi|329928454|ref|ZP_08282323.1| chaperonin GroL [Paenibacillus sp. HGF5]
 gi|261285534|gb|ACX67505.1| chaperonin GroEL [Paenibacillus sp. Y412MC10]
 gi|328937790|gb|EGG34197.1| chaperonin GroL [Paenibacillus sp. HGF5]
          Length = 542

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/534 (51%), Positives = 378/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRSMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GID
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMIIRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V  L    K+V + +EI QVA++SA  D E+G+ IA AM+++G  G+IT+++++
Sbjct: 121 KAVKAAVTELANIAKEVKNHQEIAQVASVSAA-DEEVGQLIAEAMDKVGKDGVITVEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGYISPY +T T++M A +ENPYILI DKK++  Q +LPILE   
Sbjct: 180 GFLTELEVVEGMQFDRGYISPYMITDTDKMEAVLENPYILITDKKVTNTQEILPILEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAED+EG+A A L+VN++R     +AVKAP FGDRRK +L+DIAA+ G  VI
Sbjct: 240 QQGKPLVLIAEDIEGEAQAMLIVNKLRGTFNAVAVKAPGFGDRRKAMLQDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A+I  LG+A++V ++K++T IV G G  E I+ R+ +I+  +E+T SD+D
Sbjct: 300 TEELGLDLKTASIDQLGTARQVRVTKENTIIVDGAGNKEDIDARVKQIRNQLEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EG+V GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGMVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G+ IV +AL  P R I  NAG E  +IV ++++ +    GYNA 
Sbjct: 420 VYNAVAAVQVEGDEKTGVNIVLRALEEPIRTIAANAGQEGSVIVERLKKEE-IGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +MFE GI+DP KV R+ALQ+A S+A M L TEAV+ D P+ E   P MP
Sbjct: 479 TDTWVNMFEAGIVDPAKVTRSALQNAASVAAMFLTTEAVIADKPEPEK--PAMP 530


>gi|167587510|ref|ZP_02379898.1| chaperonin GroEL [Burkholderia ubonensis Bu]
          Length = 540

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 297/531 (55%), Positives = 393/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AKD++   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MTAKDVRFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADETIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS+++ LLP+LE+ 
Sbjct: 181 KSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISSIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL IIAEDV+G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIIAEDVDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KAT+ DLG AK+V + KDDT I+ G+G  +RIE R+  I+  IE+  SDY
Sbjct: 301 ISEEAGKQLQKATLEDLGRAKRVEVRKDDTIIIDGSGDEKRIEARVKSIRTQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEIEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AG+ IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSAVTSLKGANSDQDAGVHIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKDE  
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKDEKP 530


>gi|125975373|ref|YP_001039283.1| chaperonin GroEL [Clostridium thermocellum ATCC 27405]
 gi|256005481|ref|ZP_05430443.1| chaperonin GroEL [Clostridium thermocellum DSM 2360]
 gi|281419333|ref|ZP_06250348.1| chaperonin GroEL [Clostridium thermocellum JW20]
 gi|1345758|sp|P48212|CH60_CLOTH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=HSP-60; AltName: Full=Protein Cpn60
 gi|1103644|emb|CAA92242.1| groEL [Clostridium thermocellum]
 gi|125715598|gb|ABN54090.1| chaperonin GroEL [Clostridium thermocellum ATCC 27405]
 gi|255990536|gb|EEU00656.1| chaperonin GroEL [Clostridium thermocellum DSM 2360]
 gi|281406953|gb|EFB37216.1| chaperonin GroEL [Clostridium thermocellum JW20]
 gi|316939488|gb|ADU73522.1| chaperonin GroEL [Clostridium thermocellum DSM 1313]
          Length = 541

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 275/530 (51%), Positives = 372/530 (70%), Gaps = 4/530 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK G  AR A+  GVN LA+ VK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKQIKFGEEARRALERGVNQLADTVKVTLGPKGRNVVLDKKFGSPMITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQAI  EG K V AG NPM +K+GI 
Sbjct: 61  LEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVAAGANPMLLKKGIA 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE +K   +KV  +E+I +VA+ISAN D  IGE IA AME++   G+IT+++AK
Sbjct: 121 KAVDAAVEGIKEISQKVKGKEDIARVASISAN-DEVIGELIADAMEKVTNDGVITVEEAK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + +V+GMQ DRGY+SPY VT TE+M A ++ PYILI DKKIS +Q +LP+LE   
Sbjct: 180 TMGTNLEIVEGMQFDRGYVSPYMVTDTEKMEAVLDEPYILITDKKISNIQDILPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIAEDVEG+ALATL+VN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKKLVIIAEDVEGEALATLLVNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           + ++GL+L+  T+  LG A++V + K++T IV G G  + I+ RI  I+  IE+T SD+D
Sbjct: 300 TSDLGLELKDTTVEQLGRARQVKVQKENTIIVDGAGDPKEIQKRIASIKSQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L AT+AA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIQVGAATETEMKEKKLRIEDALAATKAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGD--NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
               ++   D  + D+  G++I+ +AL  P RQI +NAG E  +IV K++ S+    G++
Sbjct: 420 VIPKVAKVLDTVSGDEKTGVQIILRALEEPVRQIAENAGLEGSVIVEKVKASE-PGIGFD 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A    + +M E GI+DP KV R+ALQ+A S+A M+L TE+VV D P+ ET
Sbjct: 479 AYNEKYVNMIEAGIVDPAKVTRSALQNAASVASMVLTTESVVADIPEKET 528


>gi|329847960|ref|ZP_08262988.1| chaperonin GroL [Asticcacaulis biprosthecum C19]
 gi|328843023|gb|EGF92592.1| chaperonin GroL [Asticcacaulis biprosthecum C19]
          Length = 549

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 320/532 (60%), Positives = 410/532 (77%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G+ ARD +  GVN LA AVK TLGPKGR V++  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKLVYFGSDARDKMLRGVNILANAVKVTLGPKGRNVVLEKSFGAPRSTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+MIR+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRYENMGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE +K + KKV S EEI QV TISANGD E+G+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVAVVVEQIKLSSKKVTSNEEIAQVGTISANGDAEVGQMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ ++M A +E+PYIL++DKKIS+LQP+LPILE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNPDKMEAVLEDPYILVFDKKISSLQPMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGRPLLIIAEDVEGEALATLVVNRLRGGLRVAAVKAPGFGDRRKAMLEDIAVLTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV ++K++TTIV G G    IE RI++I+K IE+T SDY
Sbjct: 301 ISEDLGIKLETVGLDMLGRAKKVTITKENTTIVDGIGEKSEIEARISQIKKQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGSTEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A++AL ++KG N DQ AGI IVRKA+  P RQI +N+G E  ++V+K+  +  AN+G+N
Sbjct: 421 KASKALVNLKGANADQNAGIAIVRKAIQAPLRQIAENSGVEGSVVVNKVLANADANFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA V +APK ++ S
Sbjct: 481 AQTEKYVDLVADGVIDPAKVVRTALQDAASVAGILITTEAAVAEAPKKDSGS 532


>gi|299134195|ref|ZP_07027388.1| chaperonin GroEL [Afipia sp. 1NLS2]
 gi|298590942|gb|EFI51144.1| chaperonin GroEL [Afipia sp. 1NLS2]
          Length = 550

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 310/536 (57%), Positives = 404/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARERMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  V++ ++   K V S  E+ QV TISANGD  IG  IA AM+++G  G+IT+++A
Sbjct: 121 DIAVAAVIKDIEKRAKPVASSSEVAQVGTISANGDSTIGSMIAKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MTAE+++ YIL+++KK++ LQ +LP+LE+ 
Sbjct: 181 KSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTAELDDAYILLHEKKLTGLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AED+EG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIVAEDIEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKK V+ K++TTIVGG G    IE R+N+I+  IE+T SDY
Sbjct: 301 ISEDLGMKLENVTLKQLGRAKKAVIDKENTTIVGGAGKKADIEARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PK+  ++P MP
Sbjct: 481 AQNEEYVDMVAKGIIDPAKVVRTALQDAASVAGLLVTTEAMVAELPKE--SAPAMP 534


>gi|212702623|ref|ZP_03310751.1| hypothetical protein DESPIG_00651 [Desulfovibrio piger ATCC 29098]
 gi|212673895|gb|EEB34378.1| hypothetical protein DESPIG_00651 [Desulfovibrio piger ATCC 29098]
          Length = 548

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 278/536 (51%), Positives = 386/536 (72%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++     AR+ +A GV+ LA AVK TLGPKGR V I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKEVLFDVKAREKLARGVDKLANAVKVTLGPKGRNVAIEKSFGAPVITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++++VA+ T D++GDGTTTAT LAQAIY+EG K V AG NPM IKRGI
Sbjct: 61  ELDDKFENMGAQLVKEVASKTSDAAGDGTTTATILAQAIYHEGVKLVAAGRNPMAIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D  V+ ++  L    K    ++EI Q+ TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKGVEALIGELANLAKPTRDQKEIAQIGTISANSDATIGNIIAEAMAKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GM+ DRGY+SPYFVT+ E+M  E++NPYIL  +KKIS+++ +LP+LE  
Sbjct: 181 KGLETTMDVVEGMRFDRGYLSPYFVTNAEKMECEMDNPYILCTEKKISSMKDMLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL I+AEDVEG+ALATLVVN++R  L V+A+KAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKVNRPLVILAEDVEGEALATLVVNKLRGALQVVAIKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
            S++ G KLE  T+ DLG+AK+VV+ K+DTTIV G G ++ I+ R+ +I+  +E++ SDY
Sbjct: 301 ASDDTGTKLENMTLNDLGTAKRVVVKKEDTTIVDGAGKADEIKARVKQIRAQVEESTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLVGGVAVVHVGAATEVEMKEKKDRVEDALNATRAAVEEGIVPGGGTALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R ++ L S+K  ++D+ AG+ I+R A+  P RQI  NAG E  ++V K+++ K   +G+N
Sbjct: 421 RVSKVLDSIKPADDDELAGVNIIRNAIEAPLRQIAHNAGFEGSIVVEKVRQGKD-GFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+ + G+IDP KV R AL +A S+A ++L TE  + + P+ +  +P MP
Sbjct: 480 AATGEYEDLIKAGVIDPKKVTRTALLNAASVASLLLTTECAISEKPEPKKDAPAMP 535


>gi|319409219|emb|CBI82863.1| groEL chaperonin [Bartonella schoenbuchensis R1]
          Length = 547

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 314/529 (59%), Positives = 407/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKEVKFGREARERLVRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVVE L    KK+ +  EI QV TISANG  EIG+ IA AM+++G  G+IT+++A
Sbjct: 121 DSAVAEVVESLFKKAKKIQTSAEIAQVGTISANGASEIGKIIADAMDKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKICAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G   +I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVHISKENTTIVDGSGQKAQISARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA A++VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANAITVKGSNADQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLISLGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|241113378|ref|YP_002973213.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861586|gb|ACS59252.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 542

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 312/529 (58%), Positives = 404/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA  EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVQEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  VK  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDNVKTANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK +
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPKKD 529


>gi|75676758|ref|YP_319179.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255]
 gi|119366222|sp|Q3SPG4|CH603_NITWN RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|74421628|gb|ABA05827.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255]
          Length = 548

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 308/537 (57%), Positives = 402/537 (74%), Gaps = 3/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDARQRMLRGVDILADAVKVTLGPKGRNVVIERSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ +    K V S  E+ QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 DIAVAAVVKDIGKRAKAVASSAEVAQVGTISSNGDASIGKMIAQAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T+V +V+GM+ DRGY+SPYFVT+ E+M AE+++ YIL+++KK++ LQ LLP+LE+ 
Sbjct: 181 KSLETDVDIVEGMKFDRGYLSPYFVTNAEKMAAELDDAYILLHEKKLTGLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL I+AEDVEG+ALA LVVNR+R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VKSGKPLLIVAEDVEGEALAALVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+G+KLE  T+  LG AKKV++ K++TTIV G G  + IE R+ +I+  IE+T SDY
Sbjct: 301 ISDELGMKLENVTLNMLGRAKKVLIDKENTTIVNGAGKKKDIEARVGQIRARIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RARKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           AQK  + DM   GIIDP KVVR ALQ A S+AG+++ TEA+V + PKDE   P MPA
Sbjct: 481 AQKEEYVDMVAKGIIDPAKVVRTALQDASSIAGLLVTTEAMVAELPKDEP--PAMPA 535


>gi|39998429|ref|NP_954380.1| chaperonin GroEL [Geobacter sulfurreducens PCA]
 gi|59797821|sp|Q747C7|CH60_GEOSL RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|39985376|gb|AAR36730.1| 60 kDa chaperonin [Geobacter sulfurreducens PCA]
 gi|298507373|gb|ADI86096.1| chaperonin GroEL [Geobacter sulfurreducens KN400]
          Length = 544

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 295/528 (55%), Positives = 388/528 (73%), Gaps = 1/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAA+ IK     R+AI  GVNTLA+AVK TLGPKGR V+I  +FG+P +TKDGVTVAK I
Sbjct: 1   MAARIIKFDQEGRNAILKGVNTLADAVKVTLGPKGRNVVIEKAFGSPLITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++++VA+ T D +GDGTTTAT LAQAIY +G K V AG NPM+IKRGI
Sbjct: 61  ELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  LK+  K +   +EI QV TISAN D+ IG+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVETIVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAQAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T +  V+GMQ DRGY+SPYFVT  ERM A +EN  ILI+DKKIS ++ LLP+LE  
Sbjct: 181 KAMETSLETVEGMQFDRGYLSPYFVTDPERMEASLENAMILIHDKKISNMKDLLPVLEQT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN++R  L + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG KLE  T+  LG AK++ + KD+TTI+ G+G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEEIGNKLENTTMDMLGRAKRITVDKDNTTIIDGDGKEADIQGRVKQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA DEGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  +L       +Q  G+ +++++L  P RQI +NAG +  ++V K++ SK A +GYNA
Sbjct: 421 RALASLDALSLPTEQQFGVNVIKRSLEEPIRQIAQNAGVDGSIVVDKVKNSKDA-FGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
            +  + DM   GIIDP KV R+ALQ+A S+AG+ML TEA++ D PK+E
Sbjct: 480 AEDEYVDMLAAGIIDPTKVSRSALQNAASVAGLMLTTEAMIADKPKEE 527


>gi|25452890|sp|Q9L691|CH602_RHILE RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|7578866|gb|AAF64160.1|AF239163_2 GroEL [Rhizobium leguminosarum]
          Length = 542

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 312/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+IK  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K VT+G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LKAN +K+ +  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DLAVAAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E E+PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +   TV
Sbjct: 241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  VK  N DQ  G++IVR+A+  P RQI +NAG E  +IV K++E    +YG+N
Sbjct: 421 RAVKALDAVKTANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK +
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPKKD 529


>gi|317487382|ref|ZP_07946171.1| chaperonin GroL [Bilophila wadsworthia 3_1_6]
 gi|316921359|gb|EFV42656.1| chaperonin GroL [Bilophila wadsworthia 3_1_6]
          Length = 547

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 280/536 (52%), Positives = 380/536 (70%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+I     AR+ ++ GV+ LA AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MASKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM IKRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ V + L    K    ++EI QV TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKAVEAVSKELGNIAKPTRDQKEIAQVGTISANSDATIGNIIAEAMAKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GM+ DRGY+SPYFVT+ E+M  E++NPYIL  +KKIS+++ +LP+LE  
Sbjct: 181 KGLETTLDVVEGMKFDRGYLSPYFVTNAEKMVCELDNPYILCNEKKISSMKDMLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL IIAED+EG+ALATLVVN++R  L V+AVKAP FG+RRK +L DIA + G   
Sbjct: 241 AKVNRPLVIIAEDIEGEALATLVVNKLRGALNVVAVKAPGFGERRKAMLEDIAILTGGEA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           + EE G+KLE   ++ LG+AK+VV+ K++TTIV G G S+ I+ R+ +I+  IE+T SDY
Sbjct: 301 VFEERGVKLESLPLSSLGTAKRVVIDKENTTIVDGAGKSDEIKARVKQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGI+PGGG A V
Sbjct: 361 DREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIIPGGGTAFV 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  + L      ++D+ AG+ IVR++L  P R I  NAG E  ++V K++E K   +G+N
Sbjct: 421 RTIKVLDDIKPADDDELAGLNIVRRSLEEPLRLIAGNAGHEGSVVVEKVREGKD-GFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+ + G+IDP KV R ALQ+A S+A ++L TE  + + P+ +   P MP
Sbjct: 480 AATGEYEDLIKAGVIDPKKVARIALQNAASVASLLLTTECAIAEKPEPKKDMPAMP 535


>gi|262283706|ref|ZP_06061470.1| chaperonin [Streptococcus sp. 2_1_36FAA]
 gi|262260552|gb|EEY79254.1| chaperonin [Streptococcus sp. 2_1_36FAA]
          Length = 540

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 373/543 (68%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   V  LK     V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVSALKETAIPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A+++NPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE   S++D
Sbjct: 300 TEDLGLDLKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESATSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVS 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAALELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M     MG
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|296877173|ref|ZP_06901213.1| chaperonin GroEL [Streptococcus parasanguinis ATCC 15912]
 gi|296431693|gb|EFH17500.1| chaperonin GroEL [Streptococcus parasanguinis ATCC 15912]
          Length = 541

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 284/547 (51%), Positives = 380/547 (69%), Gaps = 8/547 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSSDARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V S+E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVATAVEALKNNAIPVSSKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE T S++D
Sbjct: 300 TDDLGLELKDATIEALGQAAKVSVDKDSTVIVEGSGNPEAIANRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VISAVATLELEGDEATGRNIVLRALEEPVRQIAHNAGYEGSIVIDRLKNAEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM- 540
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+     P  PAG GM 
Sbjct: 479 TGEWVNMIDAGIIDPVKVSRSALQNAASVASLILTTEAVVANKPE-----PVAPAGPGMD 533

Query: 541 GGGMGGM 547
              MGGM
Sbjct: 534 PSMMGGM 540


>gi|162454188|ref|YP_001616555.1| heat shock protein groEL [Sorangium cellulosum 'So ce 56']
 gi|187470720|sp|A9GBQ2|CH602_SORC5 RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|161164770|emb|CAN96075.1| heat shock protein groEL [Sorangium cellulosum 'So ce 56']
          Length = 542

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 305/530 (57%), Positives = 399/530 (75%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I    +AR  I  GVN LA+AVK TLGPKGR V+I  SFG+P VTKDGVTVAK I
Sbjct: 1   MAAKEIIYNESARSMILAGVNALADAVKVTLGPKGRNVVIEKSFGSPTVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+R+VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM+IKRGI
Sbjct: 61  ELENRFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIYREGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +VE+L+ + K+    +EI QV TISANGD  IG+ +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVEHLRGSAKQTKDAKEIAQVGTISANGDETIGKLLADAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+A T + VV+GMQ DRGY+SPYFVT  E M A +E+ YILI +KKIS ++ LLP+LE+ 
Sbjct: 181 KSADTTLDVVEGMQFDRGYLSPYFVTDPEAMKANLEDCYILISEKKISNMKDLLPVLEAI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S + L IIAEDVEG+ALATLVVN++R  L   AVKAP FGDRRKE+L+DIA +    V
Sbjct: 241 AKSQKQLLIIAEDVEGEALATLVVNKLRGTLHCAAVKAPGFGDRRKEMLKDIATLTDGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE  TI+DLG AK V++ KD+TTIVGG G  ++I+ R  EI+  IE+T SDY
Sbjct: 301 IAEELGLKLENVTISDLGRAKTVIIDKDNTTIVGGQGKKDKIKARQQEIRAQIENTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLVGGVAVVKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  +L     N++Q  G+ I+R+A+  P RQI  NAG+E  ++V K+++ K  +YGYNA
Sbjct: 421 RAQSSLEKLKVNDEQRFGVNIIRRAIEEPLRQISANAGEEGSIVVQKVRDGKD-SYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               +G++ EMG+IDPVKVVR+ALQ+A S+A +ML TEA++ + PK+E  
Sbjct: 480 ASGDYGNLLEMGVIDPVKVVRSALQNAASVASLMLTTEALIAERPKEEKP 529


>gi|461734|sp|P34939|CH60_RHILV RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|387874|gb|AAA26246.1| chaperonin 60 [Rhizobium leguminosarum]
          Length = 546

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 312/531 (58%), Positives = 415/531 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+IK G   R+ +  GV+ LA+AVK TLGPKGR VII  SFGAPR+TKDGV+VAK I
Sbjct: 1   MASKEIKFGRTGREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV+ L+A  KK+ + EE+ QV TISANGD+++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ +IL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKRMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTIV G+G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGGIAL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALA 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVR+AL    RQI +NAGDE+ ++V K+ +    N+GYNA
Sbjct: 421 RSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           Q S +GDM  MGI+DP+KVVR ALQ+A S+A +++ TEA++ + PK +  +
Sbjct: 481 QTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKKDAPA 531


>gi|326201150|ref|ZP_08191022.1| chaperonin GroEL [Clostridium papyrosolvens DSM 2782]
 gi|325988718|gb|EGD49542.1| chaperonin GroEL [Clostridium papyrosolvens DSM 2782]
          Length = 540

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/542 (50%), Positives = 371/542 (68%), Gaps = 5/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR +I  GVN LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I
Sbjct: 1   MAAKIISFDANARKSIENGVNKLADAVKVTLGPKGRNVVLEKKFGSPTITNDGVTIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K + AG NP+ +KRGI
Sbjct: 61  ELEDPYENMGAQLVKEVASKTNDVAGDGTTTATLLAQAIVREGMKNIAAGANPIILKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + A  +VVE +K N +K+  + ++  VATIS+  D +IG  IA AME++   G+ITI++ 
Sbjct: 121 EKATDKVVEVIKGNSQKIKGKNDMTFVATISSG-DEKIGSLIADAMEKVTAEGVITIEEN 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K + T + +V+GMQ DRGYISPY VT  ++M A +E+PYILI +KKI+ +Q LLP LE  
Sbjct: 180 KASDTVIEIVEGMQFDRGYISPYMVTDNDKMEAVLEDPYILITEKKINNVQDLLPALELV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G  + +IAEDVEGDALATLVVN++R     +AVKAP FGDRRKE+LRDIA + G  V
Sbjct: 240 VKNGGKMLLIAEDVEGDALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLRDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+ ++   +   G AK V + K++T IV G G  + I+ R+  I+K IE T S Y
Sbjct: 300 VSEEVGMDIKDIKLEWFGKAKSVKVQKENTIIVSGAGSQQEIKDRVESIKKQIELTTSSY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL ERLAKLAGGVAV+ VG  TE  + EKK R +D+L+ATRAA +EGIVPGGG A +
Sbjct: 360 DKEKLNERLAKLAGGVAVIRVGAATETEMKEKKYRIEDALNATRAAVEEGIVPGGGTAYL 419

Query: 421 RAAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
            A   +    D    D+  G  I+ +AL  P RQI  NAG +  +IV K++ S+    GY
Sbjct: 420 NAIPEVGKLVDTLHGDEKTGAAIILRALEEPLRQIAVNAGVDGSVIVEKVKSSE-KGKGY 478

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A K  + DMFE GIIDPVKV R+A+Q+A S+A M+L TE+ V + P+ + A P MPAG 
Sbjct: 479 DAAKDEYVDMFEAGIIDPVKVTRSAIQNAASVAAMILTTESAVAEKPEKKKA-PAMPAGD 537

Query: 539 GM 540
             
Sbjct: 538 MD 539


>gi|332072094|gb|EGI82580.1| chaperonin GroL [Streptococcus pneumoniae GA41301]
          Length = 540

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 277/543 (51%), Positives = 377/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+ E  +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPEAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|166343921|gb|ABY86696.1| chaperonin GroEL2 [Sorangium cellulosum]
          Length = 542

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 303/529 (57%), Positives = 398/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I    +AR +I  GVN LA+AVK TLGPKGR V+I  SFG+P VTKDGVTVAK I
Sbjct: 1   MAAKEIIYNESARSSILAGVNALADAVKVTLGPKGRNVVIEKSFGSPTVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+R+VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM+IKRGI
Sbjct: 61  ELENRFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIYREGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +VE+L+ + K+    +EI QV TISANGD  IG+ +A AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVEHLRGSAKQTKDAKEIAQVGTISANGDETIGKLLADAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+A T + VV+GMQ DRGY+SPYFVT  E M   +E+ YILI +KKIS ++ LLP+LE+ 
Sbjct: 181 KSADTTLDVVEGMQFDRGYLSPYFVTDPEAMKTTLEDAYILISEKKISNMKDLLPVLEAI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +S + L IIAEDVEG+ALATLVVN++R  L   AVKAP FGDRRKE+L+DIA +    V
Sbjct: 241 AKSQKQLLIIAEDVEGEALATLVVNKLRGTLHCAAVKAPGFGDRRKEMLKDIATLTDGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE  TI+DLG AK V++ KD+TTIVGG G  ++I+ R  EI+  IE+T SDY
Sbjct: 301 IAEELGLKLENVTISDLGRAKTVIIDKDNTTIVGGQGKKDKIKARQQEIRAQIENTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLVGGVAVVKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  +L     N++Q  G+ I+R+A+  P RQI  NAG+E  ++V K++E K  ++GYNA
Sbjct: 421 RAQSSLEKLQVNDEQRFGVNIIRRAIEEPLRQISANAGEEGSIVVQKVREGKE-SFGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               +G++ EMG+IDP KVVR+ALQ+A S+A +ML TEA++ + PK+E 
Sbjct: 480 ASGTYGNLLEMGVIDPAKVVRSALQNAASVASLMLTTEALIAERPKEEK 528


>gi|83309302|ref|YP_419566.1| chaperonin GroEL [Magnetospirillum magneticum AMB-1]
 gi|119366248|sp|Q2WAW8|CH60_MAGSA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|82944143|dbj|BAE49007.1| Chaperonin GroEL [Magnetospirillum magneticum AMB-1]
          Length = 552

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 305/530 (57%), Positives = 401/530 (75%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR  +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRG+
Sbjct: 61  ELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  +K+  +KV +  EI QV TISANG++EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVAAVVADVKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY SPYFVT+ E+MT E++NPYIL+++KK+S LQPLLP+LE  
Sbjct: 181 KGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTVELDNPYILLHEKKLSGLQPLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG++K++ ++K+DTTIV G+G    I+ R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLESVNLEMLGTSKRITITKEDTTIVDGSGDKGAIDARCKQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  +E  + E+KDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGGSEIEVKERKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +AL  +   N DQ  GI IVR+AL  P RQI +NAG +  ++  KI ESK  ++G++
Sbjct: 421 HAVKALEGLASGNADQEVGISIVRRALQAPVRQIAENAGHDGAVVAGKIGESKDLSFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ  ++ DM + GIIDP KVVR ALQ A S+AG+++ TEA++ + PK + 
Sbjct: 481 AQTGIYTDMIKAGIIDPTKVVRTALQDAASVAGLLITTEAMIAERPKKDA 530


>gi|304319878|ref|YP_003853521.1| putative heat shock protein groEL [Parvularcula bermudensis
           HTCC2503]
 gi|303298781|gb|ADM08380.1| putative heat shock protein groEL [Parvularcula bermudensis
           HTCC2503]
          Length = 547

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 307/530 (57%), Positives = 414/530 (78%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR TKDGV+VAK I
Sbjct: 1   MAAKEVRFEADARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA++I++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLIKEVASKTNDEAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +V+E +++N   V     I QV TISANG++EIGE IA AME++G  G+IT++++
Sbjct: 121 DLAVTKVIEQIRSNATPVSGSAGIEQVGTISANGEKEIGEMIAKAMEKVGNEGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+MT E+E+PYIL+++KK+S LQ +LP+LESA
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMTTELEDPYILLHEKKLSNLQSMLPLLESA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG+AK+V ++KD+TTIV G G  + IEGR  +++K IEDT SDY
Sbjct: 301 VSEDLGIKLENVTLDMLGTAKRVTITKDETTIVDGAGDKDDIEGRTAQLRKQIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + E+KDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            AA+AL  ++G N+DQ AGI I+R+A+  P RQI++NAG E  ++V K+ E     +G+N
Sbjct: 421 YAARALDGLEGVNDDQNAGIHIIRRAVQAPLRQIVENAGQEGSIVVGKLLEQDDTKFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +G++ +MGI+DP KVVR+ALQ A S+AG+++ TEA++ +APK ++
Sbjct: 481 AQTEEYGNLLDMGIVDPAKVVRHALQDAASVAGLLITTEAMIAEAPKKDS 530


>gi|114705804|ref|ZP_01438707.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
 gi|114538650|gb|EAU41771.1| chaperonin GroEL [Fulvimarina pelagi HTCC2506]
          Length = 550

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 310/528 (58%), Positives = 417/528 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D A+ +VVE L    + + + +E+ QV TISANG++++GE IA AM+++G  G+IT+++A
Sbjct: 121 DAAIAKVVEALGEAARSIDTSDEVAQVGTISANGEKDVGEMIASAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+ YIL+++KK+S LQ +LP+LES 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNGEKMVAELEDAYILLHEKKLSNLQAMLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL II EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSKPLVIIGEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AKK+ ++K++TTIV G G +E+I+ R+ +I+  IE+T SDY
Sbjct: 301 VSEDVGIKLENVTLDMLGRAKKISITKENTTIVDGAGETEQIKSRVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ A+ +KG N DQ AGI IVRKAL  P RQI++NAG E  ++V KI E+++ ++GYNA
Sbjct: 421 RASNAVDLKGVNADQDAGIAIVRKALQAPLRQIVQNAGAEGSIVVGKILENESLSFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           Q   +GDM +MGI+DPVKVVR+ALQ AGS+AG+++ TEA++ +APK +
Sbjct: 481 QTGEYGDMIQMGIVDPVKVVRSALQDAGSVAGLLVTTEAMISEAPKKD 528


>gi|171319177|ref|ZP_02908296.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
 gi|171095605|gb|EDT40566.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
          Length = 540

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 296/537 (55%), Positives = 394/537 (73%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRKLSKPISTNREIAQVGSISANADDAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLP+LE+ 
Sbjct: 181 KSLDNELEVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEAT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AED++G+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KA++ DLG AK+V + K+DT I+ G G  +RI+ R+  I+  IE+T SDY
Sbjct: 301 ISEETGKQLQKASLDDLGRAKRVEVRKEDTIIIDGAGDEQRIDARVKSIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVAEGIVPGGGVALL 420

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + A S+KG N DQ AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GYN
Sbjct: 421 RARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE  +     
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPAQAAAP 536


>gi|113866733|ref|YP_725222.1| chaperonin GroEL [Ralstonia eutropha H16]
 gi|123134358|sp|Q0KDR7|CH60_RALEH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|113525509|emb|CAJ91854.1| Chaperonin GroEL (HSP60 family) [Ralstonia eutropha H16]
          Length = 547

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 395/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKA + DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKAGLNDLGQAKRIEIGKENTIIIDGAGDAAAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PK+E+A  
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKEESAPA 532


>gi|319899294|ref|YP_004159389.1| groEL chaperonin [Bartonella clarridgeiae 73]
 gi|319403260|emb|CBI76819.1| groEL chaperonin [Bartonella clarridgeiae 73]
          Length = 547

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 314/529 (59%), Positives = 405/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGASEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M  ++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVTDLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+++I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGHKAEITARVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL++KG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTIKGKNPDQEAGIHIVRRALQAPARQIATNAGEEAAIIVGKVLENSSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|319784305|ref|YP_004143781.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170193|gb|ADV13731.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 551

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 312/530 (58%), Positives = 406/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVSALGKAAKKIKTSEEVAQVGTISANGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +   G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASANIKATGVNADQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGDYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|194288826|ref|YP_002004733.1| chaperonin groel [Cupriavidus taiwanensis LMG 19424]
 gi|226704112|sp|B3R2Y3|CH60_CUPTR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|193222661|emb|CAQ68664.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Cupriavidus
           taiwanensis LMG 19424]
          Length = 547

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 297/533 (55%), Positives = 395/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVGAAVEELKKISKPTTTSKEIAQVGAISANSDASIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+    ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAAGIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S ++GDN DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALQGDNADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PK+E+A  
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAETPKEESAPA 532


>gi|229055098|ref|ZP_04195528.1| 60 kDa chaperonin 2 [Bacillus cereus AH603]
 gi|229165240|ref|ZP_04293030.1| 60 kDa chaperonin 2 [Bacillus cereus AH621]
 gi|228618235|gb|EEK75270.1| 60 kDa chaperonin 2 [Bacillus cereus AH621]
 gi|228721246|gb|EEL72772.1| 60 kDa chaperonin 2 [Bacillus cereus AH603]
          Length = 545

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/530 (51%), Positives = 375/530 (70%), Gaps = 2/530 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LKA  K +  +  I QVA IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKAISKPIEGKSSIAQVAAISSA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A K+V++K++TT+V G G S++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNSQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+   A+
Sbjct: 479 TGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPEPAGAA 528


>gi|154685103|ref|YP_001420264.1| chaperonin GroEL [Bacillus amyloliquefaciens FZB42]
 gi|166198433|sp|A7Z207|CH60_BACA2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|154350954|gb|ABS73033.1| GroEL [Bacillus amyloliquefaciens FZB42]
          Length = 544

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/528 (51%), Positives = 371/528 (70%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVTVAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G G +E+I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGAGDTEKIAARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEK-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++  
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEENA 526


>gi|240851180|ref|YP_002972583.1| chaperonin GroEl [Bartonella grahamii as4aup]
 gi|240268303|gb|ACS51891.1| chaperonin GroEl [Bartonella grahamii as4aup]
          Length = 547

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 316/529 (59%), Positives = 403/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKSEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    YGYN 
Sbjct: 421 RAANALTVKGSNPDQEAGIHIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEVPKKDT 529


>gi|25452839|sp|Q8KJ18|CH60_STRCV RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|21310099|gb|AAM46146.1|AF378196_2 GroEL [Streptococcus constellatus]
          Length = 540

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 277/543 (51%), Positives = 375/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKAN   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 TAVATAVEALKANSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A+++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A KV + KD T IV G+G +E I  R+  I+  IE   S++D
Sbjct: 300 TEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGAAEAIANRVAVIKSQIESATSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               +     + D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLNTVEALDLSGDEATGRNIVLRALEEPIRQIAINAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GIIDPVKV R+ALQ+A S+A ++L TEAVV   P+  + +P M     MG
Sbjct: 479 TGEWVDMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVASQPEPASPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|300692352|ref|YP_003753347.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
 gi|299079412|emb|CBJ52083.2| chaperone Hsp60 (GroEL), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
          Length = 547

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 297/533 (55%), Positives = 392/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLQDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+K+ E    NYGYN
Sbjct: 421 RARAAVSSLKGANADQDAGIKIVLRAMEEPLRQIVANAGDEASVVVAKVIEG-NGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A  
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAAPA 532


>gi|332798401|ref|YP_004459900.1| 60 kDa chaperonin [Tepidanaerobacter sp. Re1]
 gi|332696136|gb|AEE90593.1| 60 kDa chaperonin [Tepidanaerobacter sp. Re1]
          Length = 538

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 282/539 (52%), Positives = 382/539 (70%), Gaps = 2/539 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK    AR A+  G++ LA+ VK TLGPKGR V++   FG P +T DGV++A+ I 
Sbjct: 1   MAKQIKFEEDARRALLEGIDKLADTVKVTLGPKGRNVVLEKKFGTPTITNDGVSIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +   GA++I++VAT T+D +GDGTTTAT LAQAI +EG K V AG NP+ +K+GI 
Sbjct: 61  LEDPYENAGAQLIKEVATKTQDDAGDGTTTATLLAQAIIHEGMKNVVAGANPIILKKGIK 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV  VVE +K   K V ++E I QVA+ISA  D EIGE IA AME++G  G+IT+++++
Sbjct: 121 KAVDAVVEEIKTFSKPVETKEAIAQVASISAA-DEEIGELIAEAMEKVGKDGVITVEESQ 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GM+ DRGYISPY VT TE+M A +++PYILI DKKI+ +Q LLPILE   
Sbjct: 180 TMGTTLEVVEGMEFDRGYISPYMVTDTEKMEAVLDDPYILITDKKITTVQDLLPILEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIAEDVEG+ALATLVVN++R  L  +AVKAP FGDRRKE+L DIA + G  VI
Sbjct: 240 QQGKKLVIIAEDVEGEALATLVVNKLRGTLTCVAVKAPGFGDRRKEMLEDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++G+ L+   ++ LG A++V + K++TTIV G+G +E I+ RI+ I+  IE+T SD+D
Sbjct: 300 SEDLGMDLKNIDMSMLGRARQVRVDKENTTIVEGSGKTEDIKKRISAIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L ATRAA +EGIVPGGG A + 
Sbjct: 360 REKLQERLAKLAGGVAVIQVGAATETELKERKLRIEDALSATRAAVEEGIVPGGGTAFID 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL       D+  GI+I+++AL  P RQI  NAG E  ++V K++ S+    G++A 
Sbjct: 420 AIPALDKIQAEGDEAIGIKIIKRALEEPVRQIAANAGYEGSIVVEKLKASE-KGVGFDAL 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
           +  +GDM   GI+DP KV R+ LQ+A S+A +++ TEAVV D P+ E   P MP G  M
Sbjct: 479 REEYGDMLTKGIVDPTKVTRSTLQNAASIASLVITTEAVVTDIPEKEKPMPPMPGGDMM 537


>gi|229015661|ref|ZP_04172647.1| 60 kDa chaperonin 2 [Bacillus cereus AH1273]
 gi|229021852|ref|ZP_04178425.1| 60 kDa chaperonin 2 [Bacillus cereus AH1272]
 gi|228739448|gb|EEL89871.1| 60 kDa chaperonin 2 [Bacillus cereus AH1272]
 gi|228745633|gb|EEL95649.1| 60 kDa chaperonin 2 [Bacillus cereus AH1273]
          Length = 544

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 275/534 (51%), Positives = 377/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LKA  K +  +  I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVTAAIEELKAISKPIEGKSSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY +T +++M A ++NPYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R    V+AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+G  L+ AT+  LG A K+V++K++TT+V G G +++IE RI +I+  +E+T S++D
Sbjct: 300 TEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG +L+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI IV +AL  P RQI  NAG E  ++V +++  +    G+NA 
Sbjct: 420 VYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVVERLK-GEKVGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P+    +P MP
Sbjct: 479 TGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPE--PNAPVMP 530


>gi|332970163|gb|EGK09157.1| chaperone GroEL [Desmospora sp. 8437]
          Length = 544

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 268/530 (50%), Positives = 378/530 (71%), Gaps = 3/530 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    +R ++  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEESRRSLLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K V AG NPM I+RGI+
Sbjct: 61  LDDKFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVAAGANPMVIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V+ +K   K V  +E I QVA ISAN D  +G+ IA AME++G  G++T++++K
Sbjct: 121 KAVKTAVDEIKNIAKPVEGKESIAQVAAISANDDE-VGQLIAEAMEKVGNDGVVTVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGYISPY VT  ++M A +++PYILI DKKIS +Q +LP+LE   
Sbjct: 180 GFVTELEVVEGMQFDRGYISPYMVTDNDKMEAVLDDPYILITDKKISNVQEILPLLERVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAED+EG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  V+
Sbjct: 240 QQGKPLLIIAEDLEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLQDIATLTGGQVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++G+ L+ A  + LG +++V ++KDDT +V G G    I  RIN+I++ +E+T S++D
Sbjct: 300 TEDLGMDLKTADFSVLGRSRQVRVTKDDTIVVDGAGDRGEISSRINQIRQQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRA  +EG+V GGGIALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAGVEEGMVSGGGIALVN 419

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
              A+  +KG+++D+  GI I+R+AL  P RQI  NAG E  ++V + ++ +    G+NA
Sbjct: 420 VMHAVENLKGNDDDEQTGINIIRRALEEPLRQIAFNAGLEGSVVVERAKKEE-VGIGFNA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               + DM + GI+DP KV R+ALQ+A S+A M+L TEAVV D P+ E  
Sbjct: 479 ATGEWVDMIKAGIVDPAKVTRSALQNAASVAAMVLTTEAVVADKPEPEDK 528


>gi|260463304|ref|ZP_05811505.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|259030894|gb|EEW32169.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
          Length = 551

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 312/530 (58%), Positives = 406/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L    KK+ + EE+ QV TISANGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVAALGKAAKKIKTSEEVAQVGTISANGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+  +   G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASANIKATGVNADQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QSGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|83591926|ref|YP_425678.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170]
 gi|119366211|sp|Q2RWV4|CH602_RHORT RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|83574840|gb|ABC21391.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170]
          Length = 548

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 309/533 (57%), Positives = 406/533 (76%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ LA AVK TLGPKGR V++  S+GAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ + D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VVE +K   KK+ +  E+ QV TISANGD E+G+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGY+SPYFVT+ E+M A++ENPYIL+++KK+S LQ LLP+LE+ 
Sbjct: 181 KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LG+AKKV ++K++TT+V G G  + IE R ++I+  IEDT SDY
Sbjct: 301 ISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKKDR  D++ ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A ++L SVKG N DQ  GIEIVR+AL  P RQI +NAG +  ++  K+ E+   ++GYN
Sbjct: 421 HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ  ++ ++   G+IDP KVVR ALQ A S+AG+++ TEA+V + P+ + A P
Sbjct: 481 AQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAMP 533


>gi|241518551|ref|YP_002979179.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862964|gb|ACS60628.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 542

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 306/529 (57%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ LKAN +K+ S  EI QV TISANGD EIG  +A AME++G  G+IT+++A
Sbjct: 121 DIAVDAVVKELKANARKITSNSEIAQVGTISANGDEEIGRYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PYILI++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEEPYILIHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VKSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AK V + K++TTI+ G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLNMLGRAKTVSIEKENTTIIDGVGSKAEIDGRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  GI+IVR+A+  P RQI +NAG E  ++V K++E    ++G+N
Sbjct: 421 RAVKALDGLPTANDDQRVGIDIVRRAIEAPVRQIAENAGAEGSIVVGKLREKSELSFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK +
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKD 529


>gi|288940591|ref|YP_003442831.1| chaperonin GroEL [Allochromatium vinosum DSM 180]
 gi|288895963|gb|ADC61799.1| chaperonin GroEL [Allochromatium vinosum DSM 180]
          Length = 543

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 305/549 (55%), Positives = 403/549 (73%), Gaps = 8/549 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  GV+ LA AVK TLGPKGR V+I  S+GAP VTKDGV+VAK+I
Sbjct: 1   MAAKQIFFSENARVRMLRGVDVLANAVKVTLGPKGRNVVIEKSWGAPTVTKDGVSVAKAI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQA+  EG K V AG+NPMDIKRG+
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAMVREGLKSVAAGMNPMDIKRGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  ++ L+A  +   + +EI QV TISAN D  IG  IA AME++G  G+IT+++ 
Sbjct: 121 DQAVEAAIKELQALSRPCSTNKEIAQVGTISANSDDSIGNIIAEAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + +    E+++P+IL+YDKKIS ++ LLP+LE  
Sbjct: 181 KSLHNELDLVEGMQFDRGYLSPYFINNQQSQKTELDDPFILLYDKKISNIRDLLPVLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKAGKPLLILAEDIEGEALATLVVNTLRGILKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKAT+ DLG+AK+V + KDDTTI+ G G  + I+ R  +I+  +E+T SDY
Sbjct: 301 ISEEVGLSLEKATLNDLGTAKRVQVGKDDTTIIDGAGSHDDIKARCEQIRAQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+ALV
Sbjct: 361 DREKLQERLAKLAGGVAVIKVGAATEIEMKEKKMRVEDALHATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+  +KG N+DQ  GI I R+A+  P RQI+ NAG+E  +I++ +    + ++GYN
Sbjct: 421 RALTAIKDLKGANDDQTVGITIARRAMEEPLRQIVANAGEEPSVILNTV-ADGSGSFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    FGDM EMG+IDP KV R+ALQ+A S+AG+M+ TEA+V D PK E AS   PA   
Sbjct: 480 AANGEFGDMMEMGVIDPTKVTRSALQNACSVAGLMITTEAMVADEPKKEKAS-AAPA--- 535

Query: 540 MGGGMGGMD 548
             GGM  MD
Sbjct: 536 --GGMDDMD 542


>gi|319407640|emb|CBI81289.1| groEL chaperonin [Bartonella sp. 1-1C]
          Length = 547

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 316/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGHKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|187735900|ref|YP_001878012.1| chaperonin GroEL [Akkermansia muciniphila ATCC BAA-835]
 gi|226704078|sp|B2UKV8|CH60_AKKM8 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|187425952|gb|ACD05231.1| chaperonin GroEL [Akkermansia muciniphila ATCC BAA-835]
          Length = 550

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 279/528 (52%), Positives = 375/528 (71%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I+    AR A+  GV  +A+AVK TLGP GR V+I   FG+P +TKDGVTVAK I 
Sbjct: 1   MAKQIQFDETARQALLRGVEQIAKAVKSTLGPAGRNVVIDKKFGSPLITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++R+V++ T D +GDGTTTAT LA++IY EG + VTAG NP+ ++RGI 
Sbjct: 61  LEDPFENMGAQLVREVSSKTNDVAGDGTTTATVLAESIYREGLRNVTAGANPISLQRGIM 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A   VVE LK   K V S +E+ QVAT+SAN D EIG  IA AM+++G  G IT+++AK
Sbjct: 121 KAADSVVEELKKISKPVDSSKEVAQVATVSANWDAEIGNIIAEAMDKVGKDGTITVEEAK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GMQ D+GY+SPYFVT+ E M A +ENPYILI++KKI+ L+  LP+LE   
Sbjct: 181 GIETTLDVVEGMQFDKGYLSPYFVTNAETMEAVLENPYILIHEKKINNLKDFLPLLEKVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +SGRP  +IAED+EG+ALATLVVNR+R  L + AVKAP FGDRRK ++ DIA + G   I
Sbjct: 241 KSGRPFLVIAEDIEGEALATLVVNRLRGVLNICAVKAPGFGDRRKAMMEDIAILTGGKCI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++G+KLE   I DLG AK+VV+SKD+T IV G+  S  IE RI++I++ I+DT SDYD
Sbjct: 301 TEDLGIKLENVGIEDLGQAKRVVVSKDETVIVEGSAKSSDIEARISQIRRQIKDTTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  + EKK R  D+L ATRAA +EGIVPGGG+AL+R
Sbjct: 361 REKLQERLAKLAGGVAVIHVGAATETEMKEKKARVDDALHATRAAVEEGIVPGGGVALIR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A +A+       D+  G +IV +A+  P RQ+  NAG E  LIV+ ++  K    GYN  
Sbjct: 421 AQKAIDTLKLEGDEATGAQIVYRAVEAPLRQLACNAGREGALIVANVKGMKNTAEGYNVA 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + D+   G++DP KV R+ALQ+A S+AG++L TE V+ D P+ ++
Sbjct: 481 TDKYEDLLSAGVVDPTKVTRSALQNAASIAGLLLTTECVIADKPEKKS 528


>gi|13474837|ref|NP_106407.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452873|sp|Q98AX9|CH603_RHILO RecName: Full=60 kDa chaperonin 3; AltName: Full=GroEL protein 3;
           AltName: Full=Protein Cpn60 3
 gi|14025593|dbj|BAB52193.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
          Length = 552

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 309/530 (58%), Positives = 409/530 (77%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N  K+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVSDVVWTLIKNATKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G  E I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLDMLGRAKKVSISKENTTIVDGAGKKEEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +G+NA
Sbjct: 421 RASLSINAVGANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|308172431|ref|YP_003919136.1| class I heat-shock protein (chaperonin) GroEL [Bacillus
           amyloliquefaciens DSM 7]
 gi|307605295|emb|CBI41666.1| class I heat-shock protein (chaperonin) GroEL [Bacillus
           amyloliquefaciens DSM 7]
 gi|328552255|gb|AEB22747.1| chaperonin GroEL [Bacillus amyloliquefaciens TA208]
 gi|328910528|gb|AEB62124.1| class I heat-shock protein (chaperonin) GroEL [Bacillus
           amyloliquefaciens LL3]
          Length = 544

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 272/528 (51%), Positives = 371/528 (70%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVTVAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G G +E+I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGAGDTEKIAARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++  
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEENA 526


>gi|298292072|ref|YP_003694011.1| chaperonin GroEL [Starkeya novella DSM 506]
 gi|296928583|gb|ADH89392.1| chaperonin GroEL [Starkeya novella DSM 506]
          Length = 545

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 305/528 (57%), Positives = 403/528 (76%), Gaps = 1/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MSAKEVKFSGDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LK N +KV S EEI QV TISANGD ++G+ +A AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVADLKKNARKVTSNEEIAQVGTISANGDADVGKFLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  E E+PYILI++KK+S LQ LLP+LES 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMRVEFEDPYILIHEKKLSGLQELLPVLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L+DIA + G T 
Sbjct: 241 VQTSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KL+  T+A LG AKKVV+ K++TTIV G G  + I  R+++I+  IE+T SDY
Sbjct: 301 ISDDLGIKLDSVTLAMLGRAKKVVIEKENTTIVDGAGSKKDINDRVSQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA + L      N DQ  G++IVRKA+  P RQI  NAG++  LIV +I E  T  YG+N
Sbjct: 421 RATKVLENIATANPDQKTGVDIVRKAIQAPARQIASNAGEDGSLIVGRILEKNTYAYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   + DMF+ G+IDP KV+R++LQ+A S+A +++ TEA++ + PK 
Sbjct: 481 AQSGEYVDMFKAGVIDPAKVLRSSLQNAASVASLLITTEAMIAELPKK 528


>gi|25452854|sp|Q8VT58|CH60_STRGN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|18478665|gb|AAL73234.1|AF338228_3 GroEL [Streptococcus gordonii]
          Length = 540

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 373/543 (68%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   V  LK     V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVSALKETAIPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A+++NPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE   S++D
Sbjct: 300 TEDLGLDLKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESATSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVS 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M     MG
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|84499753|ref|ZP_00998041.1| chaperonin GroEL [Oceanicola batsensis HTCC2597]
 gi|84392897|gb|EAQ05108.1| chaperonin GroEL [Oceanicola batsensis HTCC2597]
          Length = 548

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 298/529 (56%), Positives = 402/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFG+PR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFNTDARNKMLKGVNVLADAVKVTLGPKGRNVVLEKSFGSPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V   +E+ QV TISANG+  IG  IA AM+++G  G+IT+++ 
Sbjct: 121 DLATSKVVEAIKSAARDVTDSDEVAQVGTISANGEASIGRMIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TEV VV+GMQ DRGY+SPYFVT+ ++M  E+E+  IL+++KK+S+LQPL+P+LES 
Sbjct: 181 KGMETEVDVVEGMQFDRGYLSPYFVTNPDKMLTELEDCMILLHEKKLSSLQPLVPLLESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV GNG    IE R+++I   I++T SDY
Sbjct: 301 ISEDLGMKLENVTMDMLGTAKKVSITKDETTIVDGNGDKAEIEARVSQINTQIQETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTETEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  + G N DQ AGI IVR+AL  P RQI +NAG +  ++  K++ES    YG+N
Sbjct: 421 QGGKALEGLTGANPDQEAGIAIVRRALEAPLRQIAENAGVDGAVVAGKVRESDDVKYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR AL+ A S++G+++ TEA+V D P+ E
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASISGLLITTEAMVADKPQKE 529


>gi|330993457|ref|ZP_08317392.1| 60 kDa chaperonin 1 [Gluconacetobacter sp. SXCC-1]
 gi|329759487|gb|EGG75996.1| 60 kDa chaperonin 1 [Gluconacetobacter sp. SXCC-1]
          Length = 549

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 310/536 (57%), Positives = 405/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR  +  GV+ LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGGEARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  VVE LK N KK+ +  E  QV TISANG+ EIGE I+ AM+++G  G+IT+++A
Sbjct: 121 DKAVGVVVEELKKNAKKITTPAETAQVGTISANGEAEIGEMISKAMQKVGSEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE+ VV+GMQ DRGYISPYFVT+ E+MT ++++PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KGLHTELDVVEGMQFDRGYISPYFVTNAEKMTVDLDSPYILIHEKKLSSLQPILPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAEDV+G+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV + K++TTIV G G SE I+GR ++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGTAKKVHIDKENTTIVEGAGNSEGIKGRCSQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D+L ATRAA +EGIVPGGG AL 
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEIEVKERKDRVDDALHATRAAVEEGIVPGGGTALA 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA+  L  +   N+DQ  G +I+RKAL  P RQI  NAG++  +I  K+ E+ T  +G++
Sbjct: 421 RASTKLGGLHFHNDDQRVGADIIRKALQAPLRQIAHNAGEDGAVIAGKVLENDTYTFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+   GIIDP+KVVR ALQ A S+AG+++ TEA+V + P+ +  +P MP
Sbjct: 481 AQMGDYKDLVAAGIIDPMKVVRTALQDAASVAGLLITTEAMVAERPEKK--APAMP 534


>gi|86136484|ref|ZP_01055063.1| chaperonin GroEL [Roseobacter sp. MED193]
 gi|85827358|gb|EAQ47554.1| chaperonin GroEL [Roseobacter sp. MED193]
          Length = 550

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 402/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V    E+ QV TISANG+  IG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKASARDVKDSAEVAQVGTISANGEEAIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIADLDDCMILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTIVDGAGAKAEIEARVGQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL+ ++G N DQ AGI IV+KA+  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKALAGLEGANADQNAGIVIVKKAIEAPLRQIAENAGVDGAVVAGKVRESDDTTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  +  + 
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPSKDGGAA 533


>gi|157151055|ref|YP_001451151.1| chaperonin GroEL [Streptococcus gordonii str. Challis substr. CH1]
 gi|189082372|sp|A8AZE1|CH60_STRGC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157075849|gb|ABV10532.1| 60 kDa chaperonin/groEL protein [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 540

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 373/543 (68%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   V  LK     V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVSALKETAIPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A+++NPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A KV + KD T IV G G  E I  R+  I+  IE   S++D
Sbjct: 300 TEDLGLELKDATIEALGQASKVTVDKDSTVIVEGAGNPEAIANRVAVIKSQIESATSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVS 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+S      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVSGIELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEA-GAGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M     MG
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|297570120|ref|YP_003691464.1| chaperonin GroEL [Desulfurivibrio alkaliphilus AHT2]
 gi|296926035|gb|ADH86845.1| chaperonin GroEL [Desulfurivibrio alkaliphilus AHT2]
          Length = 551

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 290/529 (54%), Positives = 384/529 (72%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+KDIK G+ AR++I  GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MASKDIKYGSKARESILRGVNTLADAVKVTLGPKGRNVLIEKSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG +PM+IKRGI
Sbjct: 61  EIKDKFENMGAQMVKEVASKTSDVAGDGTTTATILAQAIYTEGSKLVAAGNSPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D +V  VV  LK       +++EI QV TISAN D  IG  IA AM+++G  G+IT+++A
Sbjct: 121 DKSVAAVVAELKNIATPTKTQKEIAQVGTISANNDATIGNIIAEAMDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T + VV+GMQ DRGY+SPY VT  E+M   +E+PYIL+ +KK+S ++ LLPILE  
Sbjct: 181 KSMETSLDVVEGMQFDRGYLSPYLVTDPEKMEVNLEDPYILLSEKKVSNMKDLLPILEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  +PL IIAEDV+G+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKMNKPLVIIAEDVDGEALATLVVNKLRGTLNVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SEE+G+KLE  T+ DLG AK+VV  KD+TTI+ G G  +++EGR+ +I+  IE++ SDY
Sbjct: 301 VSEELGIKLENITVNDLGQAKRVVCDKDNTTIIDGAGDKDKLEGRVKQIRAQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D+L+ATRAA +EGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLIGGVAVINVGAATEVEMKEKKARVEDALNATRAAVEEGIVPGGGVAYL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  +AL     + DQ  G +IV +AL  P RQI  NAG E  +IV +++  K    G+NA
Sbjct: 421 RCLKALKELKLSHDQDLGKKIVTRALEEPVRQIANNAGLEGSVIVEQVKNMKDLTKGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               F D+ E G+IDP KV R ALQ+A S+AG++L TE ++ + P+D+ 
Sbjct: 481 DTEKFEDLLEAGVIDPAKVTRFALQNAASVAGLLLTTECMIAEHPEDDK 529


>gi|163869040|ref|YP_001610271.1| chaperonin GroEL [Bartonella tribocorum CIP 105476]
 gi|189044129|sp|A9IY10|CH60_BART1 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|161018718|emb|CAK02276.1| groEL chaperonin [Bartonella tribocorum CIP 105476]
          Length = 547

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 316/529 (59%), Positives = 403/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV EVV  L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV +SK++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+    YGYN 
Sbjct: 421 RAASALTVKGGNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTYGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEMPKKDT 529


>gi|241662152|ref|YP_002980512.1| chaperonin GroEL [Ralstonia pickettii 12D]
 gi|240864179|gb|ACS61840.1| chaperonin GroEL [Ralstonia pickettii 12D]
          Length = 547

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 297/533 (55%), Positives = 392/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +S +KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++VSK+ E K  NYGYN
Sbjct: 421 RARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVSKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PKD+TA  
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAELPKDDTAPA 532


>gi|310640732|ref|YP_003945490.1| 60 kda chaperonin [Paenibacillus polymyxa SC2]
 gi|309245682|gb|ADO55249.1| 60 kDa chaperonin [Paenibacillus polymyxa SC2]
          Length = 542

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 267/534 (50%), Positives = 378/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRSMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG +P+ I++GID
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQALITEGLKNVTAGASPIGIRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V  L+A  K + S++ I QVA ISA  D  +GE IA AME++G  G+IT+++++
Sbjct: 121 KAVKAAVAELQAISKPIESKQSIAQVAGISAADDE-VGELIAEAMEKVGKDGVITVEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGYISPY +T T++M A ++NPYILI DKKI+  Q +LP+LE   
Sbjct: 180 GFATELEVVEGMQFDRGYISPYMITDTDKMEAVLDNPYILITDKKITNTQEILPLLEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAED+EG+ALA LVVN++R     +AVKAP FGDRRK +L+DIAA+ G  VI
Sbjct: 240 QQGKPLVLIAEDIEGEALAMLVVNKLRGTFNAVAVKAPGFGDRRKAMLQDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A++  LG+A++V ++K++T +V G G    I+ R+++I+  +E+T S++D
Sbjct: 300 TEELGLDLKTASVDQLGTARQVRITKENTIVVDGAGNKADIDARVSQIRTQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG+AL+ 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGIVSGGGVALLN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A++      D+  G+ IV +AL  P R I  NAG+E  +IV +++  +    G+NA 
Sbjct: 420 VYKAVAAVELQGDEQTGVNIVLRALEAPIRTIAANAGEEGSVIVERLKREE-VGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M E GI+DP KV R ALQ+A S+A M L TEAV+ D P+ E A   MP
Sbjct: 479 TGDWVNMIEAGIVDPAKVTRYALQNAASVAAMFLTTEAVIADKPEPEKA--AMP 530


>gi|187930493|ref|YP_001900980.1| chaperonin GroEL [Ralstonia pickettii 12J]
 gi|187727383|gb|ACD28548.1| chaperonin GroEL [Ralstonia pickettii 12J]
          Length = 540

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 299/538 (55%), Positives = 396/538 (73%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARVRIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRNLSKPISTNREIAQVGSISANSDEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AEDVE +ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDVESEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAVLTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KAT+ DLG AK+V + KDDT I+ G G    I+ R+  I+  I++  SDY
Sbjct: 301 ISEETGKQLQKATLEDLGRAKRVEVRKDDTIIIDGAGDQASIDARVKSIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQA-LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A L++KG N DQ AGI IV+ AL  P R I+ NAG+E  ++++K+ E K  NYGYN
Sbjct: 421 RARSAVLNLKGANSDQDAGIRIVQHALEAPLRAIVANAGEEPSVVIAKVAEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A + DAPK++  + Q+PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASVAGLILTTDATIADAPKEDKPA-QVPAP 536


>gi|303258259|ref|ZP_07344266.1| chaperonin GroL [Burkholderiales bacterium 1_1_47]
 gi|331001097|ref|ZP_08324728.1| chaperonin GroL [Parasutterella excrementihominis YIT 11859]
 gi|302859012|gb|EFL82096.1| chaperonin GroL [Burkholderiales bacterium 1_1_47]
 gi|329569402|gb|EGG51180.1| chaperonin GroL [Parasutterella excrementihominis YIT 11859]
          Length = 547

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 289/531 (54%), Positives = 395/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AK +  G  AR  +  GVN LA+AVK TLGPKGR V++  +FG P +TKDGV+VAK +
Sbjct: 1   MTAKQVLFGNDARSRMVNGVNVLADAVKVTLGPKGRNVVLERAFGGPTITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D++GDGTTTAT LAQAI +EG KYV AG++PMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVDEGMKYVAAGMSPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E L +  K   + +E+ QV  ISAN D EIG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAAIEQLHSLSKPTTTSKEVAQVGAISANSDHEIGDIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A +ENPY+L+ +KKIS ++ LLPILE  
Sbjct: 181 KSLHNELEVVEGMQFDRGYLSPYFINNPDKQVALLENPYLLLVEKKISNIRDLLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKSGRPLLIIAEDIEGEALATLVVNSIRGVLKTVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS ++GL LEKAT+A+LGSAKKV ++K+ TTI+ G G  ++IE R+ +I+  +E+T SDY
Sbjct: 301 ISSDVGLTLEKATLAELGSAKKVEVNKESTTIIDGAGKEDQIEARVKQIRAQMEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI 420

Query: 421 RAAQALSVK-GDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA+    GDN +Q AGI+IV +A+  P RQI++NAGDE  ++V ++   K  N+G+N
Sbjct: 421 RAKQAIKEIKGDNPEQDAGIKIVLRAMEEPMRQIVRNAGDEPSVVVDRVANGK-GNFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDM EMG++DP KV R ALQ+A S+A ++L TE ++ D P+D+ A
Sbjct: 480 AQTGEYGDMIEMGVLDPTKVTRTALQNAASVASLILTTECMIADMPEDKPA 530


>gi|260461328|ref|ZP_05809576.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|319785493|ref|YP_004144969.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032865|gb|EEW34128.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075]
 gi|317171381|gb|ADV14919.1| chaperonin GroEL [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 555

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 310/530 (58%), Positives = 407/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K +K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAVKLVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV  L  N KK+ + EE+ QV TI+ NGD  +G+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTEVVATLIKNAKKIKTSEEVAQVGTIAGNGDESVGKMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M AE+E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVAELEDVYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++V G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A +GYNA
Sbjct: 421 RASLSINVVGVNSDQAAGINIVRRALQAPARQIAANAGAEASIVAGKILENKGATFGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++ TEA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTTEAMIAEAPKKESA 530


>gi|332143307|ref|YP_004429045.1| chaperonin GroEL [Alteromonas macleodii str. 'Deep ecotype']
 gi|226704079|sp|B4S112|CH60_ALTMD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|327553329|gb|AEB00048.1| chaperonin GroEL [Alteromonas macleodii str. 'Deep ecotype']
          Length = 546

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 304/536 (56%), Positives = 399/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++ G  AR  +  GVNTLA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVRFGDDARSKMLKGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D E+G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKALSTDCADSKSIAQVGTISANSDAEVGDIIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E++NP+IL+ DKKIS ++ LLP LE  
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVELDNPFILLVDKKISNIRELLPTLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL+LEK  + DLG+AK+VV++KD+TT+V GNG  E IEGR  +I+  IE++ SDY
Sbjct: 301 ISEEIGLELEKVQLEDLGTAKRVVINKDNTTVVDGNGDQEAIEGRCAQIKGQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  LS   GDNEDQ  G+++  +A+  P RQI  N+G E+ ++V++++     NYGYN
Sbjct: 421 RAAAKLSELTGDNEDQTVGVKLALRAMEAPLRQISINSGAEASVVVNEVKNG-DGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA+V + PKDE A+P MP
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFASSIASLMITTEAMVAELPKDE-AAPAMP 534


>gi|299821513|ref|ZP_07053401.1| chaperonin GroEL [Listeria grayi DSM 20601]
 gi|299817178|gb|EFI84414.1| chaperonin GroEL [Listeria grayi DSM 20601]
          Length = 542

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 273/533 (51%), Positives = 376/533 (70%), Gaps = 2/533 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA AVK TLGPKGR V++G  FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRSMLRGVDQLANAVKVTLGPKGRNVVLGKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDEFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA IS+  D E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 RAVAAAIEELKTISKPIEGKESIAQVAAISSG-DEEVGKLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY SPY VT +++M AE+E PYILI DKK++ +Q +LP+LE   
Sbjct: 180 GFATELDVVEGMQFDRGYTSPYMVTDSDKMIAELEKPYILITDKKVNNIQEILPLLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL I+AEDVEG+A ATLV+N++R    V+AVKAP FGDRRK +L D+A + G  VI
Sbjct: 240 QQNRPLLIVAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDLAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATI  LG+A KVV++KDDTT+V G G S +IE R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKTATIDQLGTASKVVVTKDDTTVVEGAGESAQIEARVNQIRAQMEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D+  GI+IV ++L  P RQI  NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAELEATGDEATGIKIVLRSLEEPVRQIAHNAGLEGSVIVERLKNEK-VGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQM 534
              + +M + GI+DP KV R+ALQ+A S+A ++L TEAVV D P++   +   
Sbjct: 479 NGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADQPEENAPAAAP 531


>gi|311067075|ref|YP_003971998.1| chaperonin GroEL [Bacillus atrophaeus 1942]
 gi|310867592|gb|ADP31067.1| chaperonin GroEL [Bacillus atrophaeus 1942]
          Length = 544

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/528 (51%), Positives = 372/528 (70%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   ++ L+   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVTVAIQNLQEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G+G +++I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGETDKIAARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  K    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEK-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++  
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEENA 526


>gi|306824647|ref|ZP_07457992.1| chaperonin GroEL [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304433215|gb|EFM36186.1| chaperonin GroEL [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 540

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 279/543 (51%), Positives = 377/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 AAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  RI  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRIAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVADLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIEEGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|83596013|gb|ABC25372.1| chaperonin (groEL) [uncultured marine bacterium Ant29B7]
          Length = 542

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 311/546 (56%), Positives = 398/546 (72%), Gaps = 6/546 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I    AAR+ +  GV+ LA AVK TLGPKGR VII  SFG+P VTKDGVTVA+ I
Sbjct: 1   MSAKEITFDVAARNGLRAGVDALANAVKVTLGPKGRNVIIEKSFGSPVVTKDGVTVAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + +N    +GA+M+++VA+ T D +GDGTTTAT LAQAI   G K V AG NPMD+KRGI
Sbjct: 61  TLENKLENLGAQMLKEVASKTADVAGDGTTTATVLAQAIIKHGHKNVMAGANPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVA-TISANGDREIGEKIAYAMEQIGPHGIITIDQ 179
           D AV  VV+ L     +VG   + I+   T+SAN D  IG+ IA AM+++   G+IT+++
Sbjct: 121 DKAVAVVVKALAKMSIEVGESNDKIEQVATVSANNDPSIGKLIAEAMDKVKKEGVITVEE 180

Query: 180 AKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILES 239
           +K   T V VV+GMQ DRGY+SPYF T+TE+M A++ENPYILIYDKKIS ++ LLP+LE 
Sbjct: 181 SKGTETYVDVVEGMQFDRGYLSPYFTTNTEKMVADLENPYILIYDKKISTMKELLPVLEP 240

Query: 240 ATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGAT 299
             QSGRP  IIAEDV+G+AL TLVVN++R  L V AVKAP FGDRRK +L DIA + G T
Sbjct: 241 VAQSGRPFLIIAEDVDGEALGTLVVNKIRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGT 300

Query: 300 VISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSD 359
           VISEE G KLE AT+  LG+A+KV + KD+TT+V G G  + I GR+ +I+  IE T SD
Sbjct: 301 VISEERGFKLENATLDMLGTAEKVTLDKDNTTVVNGAGNKDDISGRVGQIKAQIETTTSD 360

Query: 360 YDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIAL 419
           YDR+KL+ERLAKLAGGVAVL VG  +E  L EKKDR  D+L AT+AA +EGIVPGGG+AL
Sbjct: 361 YDREKLQERLAKLAGGVAVLYVGAASEVELKEKKDRVDDALSATKAAIEEGIVPGGGVAL 420

Query: 420 VRAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
           VRA ++LS +KG+N D+  GI I+ +A+  P RQI+ NAG E  +IVSK++E K  +YG+
Sbjct: 421 VRAIESLSKLKGENADETTGIAIIARAIEEPLRQIVLNAGLEGSVIVSKVREGK-GDYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA+   + +M E GIIDP KV R AL++A S+A ++L TEA +V+ PK E   P MPAG 
Sbjct: 480 NAKTDNYCNMHEAGIIDPTKVTRVALENAASVASLLLTTEATIVEIPKPE---PAMPAGP 536

Query: 539 GMGGGM 544
            MGG M
Sbjct: 537 DMGGMM 542


>gi|309780747|ref|ZP_07675488.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
 gi|308920429|gb|EFP66085.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
          Length = 547

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 296/533 (55%), Positives = 391/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +S +KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++VSK+ E K  NYGYN
Sbjct: 421 RARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVSKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PKD+ A  
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAELPKDDAAPA 532


>gi|241664661|ref|YP_002983021.1| chaperonin GroEL [Ralstonia pickettii 12D]
 gi|240866688|gb|ACS64349.1| chaperonin GroEL [Ralstonia pickettii 12D]
          Length = 540

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 298/538 (55%), Positives = 396/538 (73%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARVRIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRNLSKPISTNREIAQVGSISANSDEAIGKIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AEDVE +ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDVESEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAVLTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KAT+ DLG AK+V + KDDT I+ G G    I+ R+  I+  I++  SDY
Sbjct: 301 ISEETGKQLQKATLEDLGRAKRVEVRKDDTIIIDGAGDQASIDARVKSIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQA-LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A L++KG N DQ AGI IV+ AL  P R I+ NAG+E  ++++K+ E K  NYGYN
Sbjct: 421 RARSAVLNLKGANSDQDAGIRIVQHALEAPLRAIVANAGEEPSVVIAKVAEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A + +APK++  + Q+PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASVAGLILTTDATIAEAPKEDKPA-QVPAP 536


>gi|288957187|ref|YP_003447528.1| chaperonin GroEL [Azospirillum sp. B510]
 gi|288909495|dbj|BAI70984.1| chaperonin GroEL [Azospirillum sp. B510]
          Length = 547

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 303/529 (57%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K G  AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFGPTAREKLLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG   V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGVTKVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV  ++A  KKV + +EI QV TISANG+ EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DLAVATVVADIQARAKKVTTNDEIAQVGTISANGEAEIGKMIAQAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+ ++M A++ENPYIL+++KK+S LQPLLP+LE+ 
Sbjct: 181 KSLDTELDVVEGMQFDRGYLSPYFVTNADKMVADLENPYILLHEKKLSGLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 VQSSRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDMAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKVV+SK+ TTIV G G    IE R  +I+  +E+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGTAKKVVISKETTTIVDGAGDKADIEARCGQIRAQVEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + E+KDR  D++ ATRAA +EG+V GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGVVAGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A++AL  +   N++Q  GI+I+R+AL  P RQI  NAG +  ++V K+ +    N+G++
Sbjct: 421 YASKALDALTPANDEQRVGIDIIRRALQAPVRQIAYNAGTDGSIVVGKLLDQTDTNFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQK  F D+   GIIDPVKVVR ALQ A S+AG+++ TEA++ + P+ +
Sbjct: 481 AQKGEFTDLVAAGIIDPVKVVRTALQDAASIAGLLITTEAMIAEKPEKK 529


>gi|307941716|ref|ZP_07657071.1| chaperonin GroL [Roseibium sp. TrichSKD4]
 gi|307775324|gb|EFO34530.1| chaperonin GroL [Roseibium sp. TrichSKD4]
          Length = 546

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 310/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  + AR+ +  GV+TLA AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSSDARERMLRGVDTLANAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVKEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  E V+ L+A  K + + EE+ QV TISANGD ++G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAAAEAVKALEAASKTITTSEEVAQVGTISANGDVQVGADIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+GMQ DRGY+SPYFVT+TE+M A++E PYIL+++KK+S LQ +LPILES 
Sbjct: 181 KSLETELEVVEGMQFDRGYLSPYFVTNTEKMLADLEKPYILLHEKKLSNLQAMLPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+A+KV ++K++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTLDMLGTAEKVNITKENTTIVDGAGEKPDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI+IV +AL  P RQI +NAG E  ++V KIQE+    +G+N
Sbjct: 421 RAKKAVEGLASDNADIAAGIKIVLRALEAPIRQIAENAGVEGSIVVGKIQENDDTTFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   F +M E GIIDP KVVR ALQ A S+AG+++ TEA+V + PK E
Sbjct: 481 AQTEEFVNMIEAGIIDPTKVVRTALQDAASVAGLLITTEAMVAELPKKE 529


>gi|73542341|ref|YP_296861.1| chaperonin GroEL [Ralstonia eutropha JMP134]
 gi|118597120|sp|Q46XW6|CH60_RALEJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|72119754|gb|AAZ62017.1| Chaperonin Cpn60/TCP-1 [Ralstonia eutropha JMP134]
          Length = 547

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 395/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAAAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENPDQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PK+E+A  
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAETPKEESAPA 532


>gi|309780521|ref|ZP_07675268.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
 gi|308920676|gb|EFP66326.1| chaperonin GroL [Ralstonia sp. 5_7_47FAA]
          Length = 540

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 298/538 (55%), Positives = 396/538 (73%), Gaps = 3/538 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARVRIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + +  EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAAVLDELRNLSKPISTNREIAQVGSISANSDEAIGKIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKIS ++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AEDVE +ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDVESEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAVLTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KAT+ DLG AK+V + KDDT I+ G G    I+ R+  I+  I++  SDY
Sbjct: 301 ISEETGKQLQKATLEDLGRAKRVEVRKDDTIIIDGAGDQVSIDARVKSIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQA-LSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A L++KG N DQ AGI IV+ AL  P R I+ NAG+E  ++++K+ E K  NYGYN
Sbjct: 421 RARSAVLNLKGANSDQDAGIRIVQHALEAPLRAIVANAGEEPSVVIAKVAEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAG 537
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A + +APK++  + Q+PA 
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASVAGLILTTDATIAEAPKEDKPA-QVPAP 536


>gi|262375896|ref|ZP_06069127.1| chaperonin GroL [Acinetobacter lwoffii SH145]
 gi|262308990|gb|EEY90122.1| chaperonin GroL [Acinetobacter lwoffii SH145]
          Length = 544

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 294/533 (55%), Positives = 401/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNTLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           + K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  TLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE +KA  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVRSVVENIKATAKPASDSKAIEQVGSISANSDTTVGQLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDSLDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL II+EDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKTGKPLLIISEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG++L++ T+  LG+A KV +SK++T IV G G + +I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEIGMQLDQTTLDHLGTAHKVTVSKENTVIVDGAGNAGQIADRVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE A+ EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVAMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA AL  V G N+DQ  GI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAASALEGVTGANDDQNVGINILRRAIEAPLRQIVSNAGDEPSVVINAVKNGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ + P+D+ A P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITEIPEDKPAMP 532


>gi|296132296|ref|YP_003639543.1| chaperonin GroEL [Thermincola sp. JR]
 gi|296030874|gb|ADG81642.1| chaperonin GroEL [Thermincola potens JR]
          Length = 540

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 282/531 (53%), Positives = 370/531 (69%), Gaps = 2/531 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+I     AR A+  GVN LAEAV+ TLGPKGR V++   FG+P +T DGVT+A+ I 
Sbjct: 1   MAKEILFREEARRALERGVNALAEAVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++++VAT T D +GDGTTTAT LAQAI  EG K V AG NPM +K+GI+
Sbjct: 61  LPDPFENMGAQLVKEVATKTNDVAGDGTTTATILAQAIIREGLKNVAAGANPMILKKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE +K   K V  ++ I QVA+ISA  D EIG+ IA AME++G  G+IT++++K
Sbjct: 121 KAVNVTVEEIKKIAKPVEDKQAIAQVASISAA-DEEIGQLIAEAMEKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              T + VV+GM  DRGYISPY +T T++M A + +PYILI DKKISA+  +LP+LE   
Sbjct: 180 GLKTTLDVVEGMNFDRGYISPYMITDTDKMEAVLNDPYILITDKKISAIADILPVLEKVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  V 
Sbjct: 240 QAGKPLLIIAEDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGQVA 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+KL+  TI  LG A++V + K++T IVGG G  E IE RI +I+  IE+T SD+D
Sbjct: 300 SEEVGVKLDSVTIDMLGRARQVKVKKEETVIVGGQGKQENIEKRIAQIKTLIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV+EVG  TE  + EKK R +D+L+ATRAA +EGIVPGGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIEVGAATETEMKEKKLRIEDALNATRAAVEEGIVPGGGTAFIS 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              AL       D   GI+IV+KAL  P RQI  NAG E  +IV K++E + A  G+NA 
Sbjct: 420 VIPALDKIEAEGDVKTGIDIVKKALEEPVRQIANNAGLEGSVIVEKVKE-QPAGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
              + DM   GI+DP KV R+ALQ+A S+A M+L TE +V D P+ E  + 
Sbjct: 479 TEEYVDMIAAGIVDPAKVTRSALQNAASIAAMLLTTETIVADKPEKENNAA 529


>gi|227821518|ref|YP_002825488.1| chaperonin GroEL [Sinorhizobium fredii NGR234]
 gi|227340517|gb|ACP24735.1| 60 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 542

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 314/550 (57%), Positives = 410/550 (74%), Gaps = 9/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T ARD +  GV+ +A AV+ TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFNTDARDRMLRGVDIMANAVRVTLGPKGRNVVIDRSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T + +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASRTSEIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  +V  LK   ++V   EEI QVATISANGD EIG  +A AM+++G  G+IT+++A
Sbjct: 121 DLAVDALVTELKGKARQVSKNEEIAQVATISANGDAEIGRYLAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA  E+ VV+GMQ DRGY+SPYF+T+ ++M AE+E+ YILI++KK+S LQ ++PILE+ 
Sbjct: 181 KTAQIELEVVEGMQFDRGYLSPYFITNQDKMRAELEDVYILIHEKKLSNLQAMIPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 IQAGKPLLIIAEDVEGEALATLVVNKLRGGLKISAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+  LG AK+V++ KD TTIVGG G  E I GR+ +I+  I++T SDY
Sbjct: 301 VSEDLGIKLENVTMEALGRAKRVMVEKDATTIVGGGGTKEDISGRVAQIKAQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  + L  +  DN+DQ  G+EIVR+A+  P RQI +NAG E  +IV +++E     YG+N
Sbjct: 421 RIVKVLEGLSTDNDDQRVGVEIVRRAIEAPVRQIAENAGAEGSIIVGRLREKTDFAYGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           AQ   FGD+F MG+IDP KVVR ALQ A S+AG+++ TEA++ + PK E   P  PA   
Sbjct: 481 AQTGEFGDLFAMGVIDPAKVVRAALQDAASVAGLLVTTEAMIAEKPKKEGQMPMPPA--- 537

Query: 540 MGGGMGGMDM 549
                 GMD 
Sbjct: 538 -----PGMDF 542


>gi|300310329|ref|YP_003774421.1| chaperonin GroEL [Herbaspirillum seropedicae SmR1]
 gi|300073114|gb|ADJ62513.1| chaperonin GroEL (HSP60) protein [Herbaspirillum seropedicae SmR1]
          Length = 549

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 286/531 (53%), Positives = 390/531 (73%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKQVIFGDEARAKVVNGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG NP D+KRGI
Sbjct: 61  ELKDKLENMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGFKYVAAGFNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  +K   K   + +EI QV +ISAN D +IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVTAIVGEVKNLAKPTTTSKEIAQVGSISANSDADIGDIIAKAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + E+    ++NP+IL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDIVEGMQFDRGYLSPYFINNQEKQIVALDNPFILLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+A+LG AK+V + K++TTI+ GNG +  IE R+  I+  I +  SDY
Sbjct: 301 IAEEVGLTLEKATLAELGQAKRVEIGKENTTIIDGNGEAAGIEARVAMIRTQIGEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +  +KGDN DQ AGI+IV +A+  P RQI+ NAGDE  ++V+K+ E  + N+GYN
Sbjct: 421 RARANVKDLKGDNPDQEAGIKIVLRAIEEPLRQIVFNAGDEPSVVVNKVLEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GD+ E+G++DP KV R+ALQ+A S+A ++L T+A+V +  +D+ A
Sbjct: 480 ASNGTYGDLVELGVLDPAKVTRSALQNAASVASLILTTDALVAEVAEDKPA 530


>gi|307128676|ref|YP_003880706.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri CARI]
 gi|306483138|gb|ADM90008.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri CARI]
          Length = 545

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 298/536 (55%), Positives = 386/536 (72%), Gaps = 3/536 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+I+    ARD +  GV+ LA AVK TLGPKGR V++  SFG P+VTKDGV+VAK I 
Sbjct: 1   MSKNIQFDIEARDKLKKGVDALANAVKVTLGPKGRNVVLQKSFGGPQVTKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++    +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG NPMD+KRGID
Sbjct: 61  LEDPIENLGAQMVKEVASKTNDIAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATI-SANGDREIGEKIAYAMEQIGPHGIITIDQA 180
            AV+ VV  LK   ++VG   E I+     SAN D  IGE I+ A E++G  G+IT+++A
Sbjct: 121 KAVEAVVNDLKKQSREVGGSNEKIKQVASISANNDETIGELISVAFEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GMQ DRGY SPYFVT++E+M  E +NPYIL+ DKKIS+++ LLPILE  
Sbjct: 181 KGIETTVDVVEGMQFDRGYQSPYFVTNSEKMITEFDNPYILLSDKKISSMKDLLPILEPI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+E+VEG+ALATLVVN++R  L V AVKAP FGDRRK +L D+A + G TV
Sbjct: 241 AQSGKPLLIISEEVEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDLAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G KLE   +  LG A++V + KD+TTIV G+G    IE R+N+I+  IE T SDY
Sbjct: 301 ISEETGSKLEDTKLNFLGKAERVTIDKDNTTIVNGHGDKYDIESRVNQIKAQIETTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAVL VG  +E  + EKKDR  D+L ATRAA +EGIV GGG+ALV
Sbjct: 361 DKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALV 420

Query: 421 RAAQALSVK-GDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +ALS   GDN DQ  GI+IV+++L  P RQI+ NAG+E  +IV+K+ E K   +GY+
Sbjct: 421 RAIKALSEIKGDNVDQDTGIKIVKRSLQEPLRQIVANAGEEGSVIVAKVAEGKDE-FGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A+   + +M   GIIDP KV R AL++A S++GM+L TE V+ +  K+E   PQMP
Sbjct: 480 AKLGEYKNMIYEGIIDPTKVTRVALENAASVSGMLLTTECVITEIKKEEQTMPQMP 535


>gi|319404658|emb|CBI78260.1| groEL chaperonin [Bartonella rochalimae ATCC BAA-1498]
 gi|319404677|emb|CBI78279.1| groEL chaperonin [Bartonella rochalimae ATCC BAA-1498]
          Length = 547

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 316/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPM +KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMCLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QVATISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVATISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGHKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK ET
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKET 529


>gi|134293863|ref|YP_001117599.1| chaperonin GroEL [Burkholderia vietnamiensis G4]
 gi|187470690|sp|A4JPD1|CH602_BURVG RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|134137020|gb|ABO58134.1| chaperonin GroEL [Burkholderia vietnamiensis G4]
          Length = 540

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 302/535 (56%), Positives = 392/535 (73%), Gaps = 2/535 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AKD+K    AR  I  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MTAKDVKFRDGARSQIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+E L+   + + + +EI QV  ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVGVVLEELRTLSRPISTHKEIAQVGAISANADDAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGYISPYF+   E+  A +++  IL++DKKIS ++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYISPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
           +++G+PL I+AEDVE +ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 SKAGKPLLIVAEDVEAEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G +L+KAT+ DLGSAK+V + KDDT I+ G G + RI+ R+  I+  I++  SDY
Sbjct: 301 ISEETGKQLDKATLDDLGSAKRVEVRKDDTIIIDGAGDAARIDARVKSIRVQIDEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG VTE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAVTEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KG N DQ AGI IV +AL  P R I  NAGDE  ++++K+ E  + N+GYN
Sbjct: 421 RARAALTDLKGANGDQDAGIRIVLRALEAPLRVIASNAGDEPSVVIAKVLEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQM 534
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V DAPKDE A    
Sbjct: 480 AATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLVLTTDATVADAPKDERAEAAP 534


>gi|253576827|ref|ZP_04854153.1| chaperonin GroL [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843858|gb|EES71880.1| chaperonin GroL [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 539

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 272/532 (51%), Positives = 377/532 (70%), Gaps = 2/532 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEDARHAMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             N F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG +P+ +++GID
Sbjct: 61  LDNAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQALIREGLKNVTAGASPIGLRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE LK   K +  ++ I QVA ISA  D E+GE IA AME++G  G+IT+++++
Sbjct: 121 KAVRAAVEELKKISKTIEGKQSIAQVAAISAA-DEEVGELIAEAMEKVGKDGVITVEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+SPY +T T++M A +ENPYILI DKKIS+ Q +LPILE   
Sbjct: 180 GFATELEVVEGMQFDRGYVSPYMITDTDKMEAVLENPYILITDKKISSTQEILPILEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RPL IIAED+EG+A A L+VN++R     +AVKAP FGDRR+ +L+DIAA+ GA VI
Sbjct: 240 QQSRPLLIIAEDIEGEAQAMLIVNKLRGTFSAVAVKAPGFGDRREAMLQDIAALTGAQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+  TI  LG+A++V+++K++TTIV G+G    I+ R+N+I+  +E+T S++D
Sbjct: 300 TEKLGLDLKSTTIEQLGNARQVIVTKENTTIVDGSGDKADIQARVNQIRAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG+ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGIVSGGGVALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G+ IV +AL  P R I  NAG+E  +IV +++  +    GYNA 
Sbjct: 420 VYNAVAAVEATGDEKTGVNIVLRALEEPVRTIAANAGEEGSVIVDRLK-KEPVGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
              + +M E GI+DP KV R+ALQ A S+AG+ L TEAV+ D P+ E  +  
Sbjct: 479 TGEWVNMIEAGIVDPAKVTRSALQHAASVAGLFLTTEAVIADKPEPEKPAGP 530


>gi|115522886|ref|YP_779797.1| chaperonin GroEL [Rhodopseudomonas palustris BisA53]
 gi|122297531|sp|Q07TB7|CH601_RHOP5 RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|115516833|gb|ABJ04817.1| chaperonin GroEL [Rhodopseudomonas palustris BisA53]
          Length = 547

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 304/536 (56%), Positives = 402/536 (75%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSQDARDRMLRGVDILANAVKVTLGPKGRNVLIERSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  QLEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQSIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  VV+ ++   K V S  EI QV TIS+NGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVVKDIEKRAKPVASSAEIAQVGTISSNGDAAIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+ TTEV +V+GM+ DRGY+SPYFVT+ E+M  E ++ Y+L+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLTTEVDIVEGMKFDRGYLSPYFVTNAEKMAVEFDDAYVLLHEKKVSGLQSMLPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK ++ DIA + G  +
Sbjct: 241 VQAGKPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  T+  LG AKKVV+ K++TTIVGG G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISDDLGMKLENVTLKMLGRAKKVVIDKENTTIVGGAGKKADIESRVGQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+K+  +G++
Sbjct: 421 RAKKAVGRINNDNADVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + DM   GI+DP KVVR ALQ A S++ +++ TEA+V + P+D  A+P MP
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDAASVSALLVTTEAMVAELPRD--AAPAMP 534


>gi|217969841|ref|YP_002355075.1| chaperonin GroEL [Thauera sp. MZ1T]
 gi|217507168|gb|ACK54179.1| chaperonin GroEL [Thauera sp. MZ1T]
          Length = 549

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 291/530 (54%), Positives = 395/530 (74%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  G+N LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARERMVAGINILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   ++ LK   K   + +EI QV +ISAN D +IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVVATIDELKKLSKPCSTNKEIAQVGSISANSDSDIGDIIARAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A +E P++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLQNELDVVEGMQFDRGYLSPYFINNPDKQVAILEQPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG A ++ + K++T I+ G G ++RIE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLDDLGQAARIEVGKENTIIIDGAGQADRIEARVKQIRVQIEEASSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +KGDN DQ AGI+IV +A+  P R+I+ NAGDE  ++V+K+ E  + NYG+N
Sbjct: 421 RARAALGELKGDNHDQDAGIKIVLRAMEQPLREIVANAGDEPSVVVNKVVEG-SGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A    +GDM EMG++DP KV R ALQ+A S+AG+ML T+ +V +  +D+ 
Sbjct: 480 AATGEYGDMVEMGVLDPTKVTRTALQNAASVAGLMLTTDCMVGELAEDKP 529


>gi|269125063|ref|YP_003298433.1| chaperonin GroEL [Thermomonospora curvata DSM 43183]
 gi|268310021|gb|ACY96395.1| chaperonin GroEL [Thermomonospora curvata DSM 43183]
          Length = 540

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 277/541 (51%), Positives = 375/541 (69%), Gaps = 4/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MAAKMIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NPM +KRGI
Sbjct: 61  ELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMALKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ V E L    K V ++E+I   A+ISA  D  IGE IA AM+++   G+IT++++
Sbjct: 121 EAAVERVSEELSKLAKDVETKEQIASTASISAG-DTRIGEIIAEAMDKVTKDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            T   E+ + +GM+ D+GYISPYFVT  ERM A +++PYILI   K+SA + LLP+LE+ 
Sbjct: 180 NTFGLELELTEGMRFDKGYISPYFVTDPERMEAVLDDPYILIVQGKVSANKDLLPVLEAV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  V
Sbjct: 240 MQAGKPLLIIAEDVEGEALATLVVNKIRGIFKSIAVKAPGFGDRRKAMLGDIATLTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGLK+E  T+  LG A+KVV++KD+TTIV G G +  IEGRIN+I+  IE+T SDY
Sbjct: 300 ISEEIGLKVENTTLDMLGKARKVVVTKDETTIVDGAGDAAEIEGRINQIRTEIENTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+  G  TE  L E+K R +D++   +AA +EGIVPGGG+AL+
Sbjct: 360 DREKLQERLAKLRGGVAVIRAGAATEVELKERKHRIEDAVRNAQAAVEEGIVPGGGVALL 419

Query: 421 RAA-QALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A+ +A        D+  G  IV++AL  P +QI  NAG E  ++V K++       G +
Sbjct: 420 QASAKAFDKLELTGDEATGAAIVKRALEEPIKQIAVNAGLEGGVVVEKVRNL-PPGQGLD 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + DMFE GIIDP KV R+ALQ+A S+A + L TEAV+ + P+ E A P  P GG 
Sbjct: 479 AATGEYVDMFEKGIIDPAKVTRSALQNAASIAALFLTTEAVIAEKPEKEKA-PAAPGGGD 537

Query: 540 M 540
           M
Sbjct: 538 M 538


>gi|260432854|ref|ZP_05786825.1| chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416682|gb|EEX09941.1| chaperonin GroL [Silicibacter lacuscaerulensis ITI-1157]
          Length = 546

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 307/532 (57%), Positives = 407/532 (76%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVNTLA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+A  +VVE +KA  ++V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DMATAKVVEAIKAAAREVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCLILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE  TI  LGSAKKV +SKD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEELGMKLENVTIDMLGSAKKVTISKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A ++L  +KG N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES    +G+N
Sbjct: 421 QAGKSLADLKGANADQDAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESDDPAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P  E A+
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLITTEAMVADKPAKEGAA 532


>gi|325983085|ref|YP_004295487.1| chaperonin GroEL [Nitrosomonas sp. AL212]
 gi|325532604|gb|ADZ27325.1| chaperonin GroEL [Nitrosomonas sp. AL212]
          Length = 549

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/532 (55%), Positives = 399/532 (75%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK++K G +AR  +  GVN LA+AVK TLGPKGR V++  S+GAP +TKDGV+VAK I
Sbjct: 1   MSAKEVKFGDSARHRMVAGVNILADAVKVTLGPKGRNVVLDRSYGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLKEVASKTSDVAGDGTTTATVLAQAIVKEGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V  LK   K   + +EI QV +ISAN D EIG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTTAVGELKKLSKPCATAKEIAQVGSISANSDNEIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                E+ VV+GMQ DRGY+SPYFV+S E+  A ++NPYIL++DKKIS ++ LLPILE  
Sbjct: 181 SGLQNELEVVEGMQFDRGYLSPYFVSSAEKQIALLDNPYILLHDKKISNIRDLLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDV+G+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++TTI+ G G ++ IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRIEVGKENTTIIDGAGNADNIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVA+++VG  TE  + EKK R +D+L ATRAA +EG++PGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGVIPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S KGDN DQ AGI+IV +AL  P RQI+ N GDE  ++V+K+ E +  N+GYN
Sbjct: 421 RAISAVKSTKGDNHDQDAGIKIVLRALEEPLRQIVTNCGDEPSVVVNKVAEGQ-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A  S +GD+  MG++DP KV R+ALQ+A S+A +ML T+A+V + PK++  +
Sbjct: 480 AATSEYGDLVAMGVLDPTKVTRSALQNAASVASLMLTTDAMVAELPKEDAPA 531


>gi|4433781|dbj|BAA22519.1| GroEL protein [Bacillus subtilis]
          Length = 544

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/526 (51%), Positives = 368/526 (69%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A   GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRANLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVALAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYLVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   IA LG A KVV++K++TTIV G G +++I  R+ +I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGV V++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEE 524


>gi|307704013|ref|ZP_07640946.1| chaperonin GroL [Streptococcus mitis SK597]
 gi|307622437|gb|EFO01441.1| chaperonin GroL [Streptococcus mitis SK597]
          Length = 540

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 278/543 (51%), Positives = 377/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVATAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+S      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVSNLELAGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAELGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|302388863|ref|YP_003824684.1| chaperonin GroEL [Thermosediminibacter oceani DSM 16646]
 gi|302199491|gb|ADL07061.1| chaperonin GroEL [Thermosediminibacter oceani DSM 16646]
          Length = 536

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 284/538 (52%), Positives = 377/538 (70%), Gaps = 3/538 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK IK    AR A+  G++ LA  VK TLGPKGR V++   FG P +T DGVT+A+ I 
Sbjct: 1   MAKQIKFNEDARRALLKGIDKLANTVKVTLGPKGRNVVLDKKFGTPTITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA++I++VAT T+D +GDGTTTAT LAQAI +EG K V AG NPM IK+GI+
Sbjct: 61  LEDPFENMGAQLIKEVATKTQDVAGDGTTTATLLAQAIIHEGMKNVVAGANPMLIKKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+ +VE LK   K V ++E I QVA+ISA  D EIG  IA AME++G  G+IT++++K
Sbjct: 121 KAVKAIVEELKTFSKPVETKEAIAQVASISAA-DEEIGNLIAEAMEKVGKDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GM+ DRGYISPY VT  E+M A +++PYILI DKK+S +Q L+PILE   
Sbjct: 180 TMGTTLEVVEGMEFDRGYISPYMVTDAEKMEAVLDDPYILITDKKLSNIQDLIPILEKVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G  L IIAEDVEG+ALATLVVN++R  L  +AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 240 QAGAKLLIIAEDVEGEALATLVVNKLRGTLLSVAVKAPGFGDRRKAMLQDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ ++  T+  LG A++V ++K+ T IV G G  E I+ RIN I+  IE+T SD+D
Sbjct: 300 SEELGIDIKTVTMDMLGRARQVKVNKEKTIIVDGAGSKEEIKKRINSIKAQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L EKK R +D+L AT+AA +EGIVPGGG A + 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKEKKHRIEDALSATKAAVEEGIVPGGGTAFIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL     + D+  G+EI+R+AL  P RQI  NAG +  +IV K++       G++A 
Sbjct: 420 ALPALDKLSVDGDEKIGVEIIRRALEEPVRQIAYNAGLDGSVIVEKLK-GMEKGIGFDAL 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           +  FGDM + GI+DP KV R+ LQ+A S+A M+L TEAVV + P+ E   P MP    
Sbjct: 479 REEFGDMIKKGIVDPTKVTRSTLQNAASVAAMVLTTEAVVAELPEKEKNQP-MPNPDM 535


>gi|42521743|ref|NP_967123.1| 60 kDa chaperonin [Bdellovibrio bacteriovorus HD100]
 gi|59797773|sp|Q6MRI1|CH60_BDEBA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|39574273|emb|CAE77777.1| 60 KDA chaperonin [Bdellovibrio bacteriovorus HD100]
          Length = 546

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/535 (55%), Positives = 393/535 (73%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K I     AR  I  GVNTLA AVK TLGPKGR V+I  SFG+P +TKDGVTVAK I 
Sbjct: 1   MSKVITFSEDARTHILKGVNTLANAVKVTLGPKGRNVVIDKSFGSPLITKDGVTVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            +N F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V+AG NPM IKRGID
Sbjct: 61  LENKFENMGAQMVKEVASKTNDEAGDGTTTATVLAQAIYREGAKLVSAGHNPMSIKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV  ++E LK+  K V    E+ QV  ISAN D+EIG+ +A AM+++G  G+ITI+++K
Sbjct: 121 KAVGIIIEELKSMSKPVKGSNEVAQVGAISANNDKEIGQMLADAMDKVGREGVITIEESK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           TA TEV VV+GMQ DRGY+SPYFVT+ ERM A +EN Y+L+YDKKIS+++ ++ ILE   
Sbjct: 181 TAKTEVTVVEGMQFDRGYLSPYFVTNAERMEAVLENAYVLVYDKKISSMKDMIGILEGVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           + GR L IIAEDVEG+ALATLVVN++R  L + AVKAP FGDRRK +L DIA + GA VI
Sbjct: 241 KQGRQLLIIAEDVEGEALATLVVNKLRGTLHIAAVKAPGFGDRRKAMLEDIAILTGAKVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++GLKLE AT+ADLG AK++V+ KD+TTI+ G G    I GR+ +I+  IE+T SDYD
Sbjct: 301 SEDVGLKLEAATVADLGVAKRIVVDKDNTTIIDGAGKKNDINGRVGQIKAQIEETSSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KLKERLAKLAGGVAV+ VG  +E  + EKK R +D+L+ATRAA +EGIV GGG AL+R
Sbjct: 361 KEKLKERLAKLAGGVAVIHVGAPSEVEMKEKKHRVEDALNATRAAVEEGIVAGGGTALLR 420

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A+  +     +E++  G  I+++A   P RQI  NAG +  +++ +I ++K+  +G+NA 
Sbjct: 421 ASTKIDKSKFSEEEQFGATIIKRACEEPIRQIAANAGLDGAIVLDRILQNKSTTWGFNAY 480

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + D+ + G+IDPVKVVR AL +A S++ +ML TE ++ +APK E+A+P MP 
Sbjct: 481 SDEYTDLIKDGVIDPVKVVRCALTNAASVSSLMLTTETMIAEAPKKESAAPAMPG 535


>gi|315611703|ref|ZP_07886625.1| chaperonin GroEL [Streptococcus sanguinis ATCC 49296]
 gi|315316118|gb|EFU64148.1| chaperonin GroEL [Streptococcus sanguinis ATCC 49296]
          Length = 540

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 277/543 (51%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 AAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAIFHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVADLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIEEGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|255318906|ref|ZP_05360132.1| chaperonin GroL [Acinetobacter radioresistens SK82]
 gi|262378839|ref|ZP_06071996.1| chaperonin GroL [Acinetobacter radioresistens SH164]
 gi|255304162|gb|EET83353.1| chaperonin GroL [Acinetobacter radioresistens SK82]
 gi|262300124|gb|EEY88036.1| chaperonin GroL [Acinetobacter radioresistens SH164]
          Length = 544

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 298/533 (55%), Positives = 403/533 (75%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVNTLA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARTKMIAGVNTLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ VVE ++A  K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DLAVKTVVENIRATAKPADDFKAIEQVGSISANSDETVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKIS ++ L+ +LE+ 
Sbjct: 181 SGFEDSLDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKISNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + GATV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ LE+A + DLG+A KV +SK++T IV G G ++ I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEVGMSLEQANLEDLGTAHKVTVSKENTVIVDGAGNADAIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA+AL  + G+N+DQ  GI I+R+A+  P RQI+ NAGDE  ++++ ++  +  NYGYN
Sbjct: 421 RAAKALDGLTGNNDDQNVGINILRRAIEAPLRQIVSNAGDEPSVVINAVKSGE-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A P
Sbjct: 480 AASGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAVP 532


>gi|154245114|ref|YP_001416072.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
 gi|154159199|gb|ABS66415.1| chaperonin GroEL [Xanthobacter autotrophicus Py2]
          Length = 548

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 313/530 (59%), Positives = 404/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSGDAREKLLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDRFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV   +  ++A  KKV S  E+ QV TISANGD  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAAAIADIRARAKKVSSSAEVAQVGTISANGDASIGEMIAGAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M A++E PY+LI++KK+S LQP+LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNAEKMIADLEEPYLLIFEKKLSGLQPILPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGRPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TIA LG AKKV++ K+ TTIV G G    IE R+N+I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVTIAQLGRAKKVILEKEKTTIVDGVGEKADIEARVNQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  V  +N D  AGI+IV +AL  P RQI +N+G E  ++V K+QES   N+G+N
Sbjct: 421 RAKKAVELVTSENPDITAGIKIVLRALEAPIRQIAENSGVEGSIVVGKVQESNDPNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK ++
Sbjct: 481 AQSEEYVDMIGAGIVDPAKVVRTALQDAASIAALIVTTEALVAELPKRDS 530


>gi|152980643|ref|YP_001354342.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille]
 gi|166198468|sp|A6T1E5|CH60_JANMA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|151280720|gb|ABR89130.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille]
          Length = 548

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/530 (55%), Positives = 395/530 (74%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++  G AAR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE L A  K   + +EI QV +ISAN D  IGE+IA AME++G  G+IT++  
Sbjct: 121 DKAVAATVEQLAAIAKPCTTTKEIAQVGSISANSDASIGERIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + E+ TA +ENP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 KSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAED+EG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++EE+GL LEK T+ +LG AK++ + K++TT++ GNG +  IE R+ +I+  IE+  SDY
Sbjct: 301 VAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAVTIEARVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  A+ +KGDN DQ AGI IV +A+  P R I++NAG+E+ ++V+K+ E K  N+GYNA
Sbjct: 421 RARAAIKIKGDNPDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGK-GNFGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
               +GDM EMG++DP KV R+ALQ+A S+A ++L T+ +V +  +D+ A
Sbjct: 480 ANGTYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEDKAA 529


>gi|332364540|gb|EGJ42311.1| chaperone GroEL [Streptococcus sanguinis SK355]
          Length = 540

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|241762556|ref|ZP_04760631.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753449|ref|YP_003226342.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|241372884|gb|EER62571.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552812|gb|ACV75758.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 549

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 305/536 (56%), Positives = 394/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V++  +FGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE L++  K V    E+ QV  ISANGD E+G +IA AME++G  G+IT+++A
Sbjct: 121 DLAATKVVESLRSRSKPVSDFNEVAQVGIISANGDEEVGRRIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M AE+ +PYILIY+KK+S LQ +LPILES 
Sbjct: 181 KGFDFELDVVEGMQFDRGYLSPYFITNPEKMVAELADPYILIYEKKLSNLQSILPILESV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGEL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAK+V ++K++TTIV G G    I+ R+  I+  IE T SDY
Sbjct: 301 ISEDLGIKLENVTLNMLGSAKRVSITKENTTIVDGAGDQSTIKDRVEAIRSQIEATTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + E+KDR  D+L ATRAA  EGIVPGGG AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVQEGIVPGGGTALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A + L  + G NEDQ  GI+IVR+AL  P RQI +NAG +  ++  K+ +      G+N
Sbjct: 421 YATKTLEGLNGVNEDQQRGIDIVRRALQAPVRQIAQNAGFDGAVVAGKLIDGNDDKIGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           AQ   + D+   G+IDP KVVR ALQ A S+AG+++ TEA V D P+D+ A P MP
Sbjct: 481 AQTEKYEDLAATGVIDPTKVVRTALQDAASVAGLLITTEAAVGDLPEDKPA-PAMP 535


>gi|149913713|ref|ZP_01902246.1| chaperonin GroEL [Roseobacter sp. AzwK-3b]
 gi|149812833|gb|EDM72662.1| chaperonin GroEL [Roseobacter sp. AzwK-3b]
          Length = 547

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 301/531 (56%), Positives = 401/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MSAKDVKFNTDARNKLLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VV  +K   + V + +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVAAIKDAARPVENSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT++++M AE+E+  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNSDKMVAELEDCLILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LGSAKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGSAKKVSITKDETTIVDGAGNKSEIEARVGQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALI 420

Query: 421 RAAQALSVK-GDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           + A+AL    G N DQ  GIEIVR AL  P RQI +NAG +  ++  KI+ES    +GYN
Sbjct: 421 QGAKALDGMTGANADQMRGIEIVRLALEAPLRQIAENAGVDGSVVAGKIRESNDLKFGYN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+ + A
Sbjct: 481 AQTEEYGDMFKFGVIDPAKVVRTALEDAASVAGLLVTTEAMVADKPQKDGA 531


>gi|84516671|ref|ZP_01004030.1| chaperonin GroEL [Loktanella vestfoldensis SKA53]
 gi|84509707|gb|EAQ06165.1| chaperonin GroEL [Loktanella vestfoldensis SKA53]
          Length = 551

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 301/530 (56%), Positives = 405/530 (76%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K GT AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 3   MAAKEVKFGTDARNRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 62

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA  T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 63  ELEDKFENMGAQMVKEVANRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGI 122

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 123 DLATSKVVEAIKAAARPVNDSDEVAQVGTISANGESEIGRQIADAMQKVGNEGVITVEEN 182

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ E+MT E+E+  IL+++KK+S+LQP++P+LES 
Sbjct: 183 KGLETETVVVEGMQFDRGYLSPYFVTNPEKMTVELEDAIILLHEKKLSSLQPMVPLLESV 242

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 243 IQSGKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 302

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK++ ++KD+TTIV G G    IE R+ +I+  IEDT SDY
Sbjct: 303 ISEDLGMKLENVTIDMLGSAKRISITKDETTIVDGAGNKAEIEARVAQIRGQIEDTSSDY 362

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EG+V GGG+AL+
Sbjct: 363 DREKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALI 422

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  +KG N DQ  GI I+RKA+  P RQI +N+G +  ++  KI+ES   ++G+N
Sbjct: 423 QAGKVLEGLKGANSDQDVGIAIIRKAIEAPLRQIAENSGVDGSVVAGKIRESNDKSFGFN 482

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA++ D P  ++
Sbjct: 483 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMIADKPSKDS 532


>gi|118595283|ref|ZP_01552630.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium
           HTCC2181]
 gi|118441061|gb|EAV47688.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium
           HTCC2181]
          Length = 553

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 289/536 (53%), Positives = 396/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVNTLA AVK T+GPKG+ V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVRFGDDVRQKMVKGVNTLANAVKVTMGPKGKNVVLERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T DS+GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELQDRFENMGAQMVKEVASKTSDSAGDGTTTATVLAQAIIREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  L    K   + +EI QV +ISAN D  +G+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVESAVAELHKLSKPCNTSKEIAQVGSISANSDTSVGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
              + E+ VV+GMQ DRGY+SPYF+ + +R  A +E+P+IL++DKKIS+++ LLP+LE  
Sbjct: 181 SGLSNELDVVEGMQFDRGYLSPYFINNQDRQIALLEDPFILLHDKKISSIKELLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ +PL IIAED+EG+ALATLVVN +R  +  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKASKPLLIIAEDIEGEALATLVVNNIRGIIKAVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+GL LE   I DLG AKK+ + K++T ++ G G  E I+ RI +I+  IE++ SDY
Sbjct: 301 ISDEVGLTLENVKIEDLGQAKKIEVGKENTIVIDGAGSQENIKTRIGQIKTQIEESSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L +TRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGATTEIEMKEKKARVEDALHSTRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A++  KGDN DQ AGI+IV +A+  P RQI+ NAG ES ++V+ +    T NYG+N
Sbjct: 421 RAKDAIAKTKGDNADQEAGIKIVLRAVEDPLRQIVSNAGIESSVVVNNV-AEGTGNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMG++DP KV R+ALQ+A S+AG+ML TE ++ D PKD++A+P MP
Sbjct: 480 AANETYGDMVEMGVLDPTKVTRSALQNAASIAGLMLTTECMIADQPKDDSAAPAMP 535


>gi|237755991|ref|ZP_04584576.1| chaperonin GroL [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691854|gb|EEP60877.1| chaperonin GroL [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 544

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/533 (54%), Positives = 388/533 (72%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  +  GV+ LA AVK TLGP+GR VI+   +G+P VTKDGV+VAK I
Sbjct: 1   MAAKKLVYGDEARAKLKAGVDKLANAVKVTLGPRGREVILEKKWGSPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + +  + A+++++VA+ T D +GDGTTTAT L QAIY EG K + +G NP+ +KRGI
Sbjct: 61  ELTDPYENMAAQLVKEVASKTADVAGDGTTTATVLTQAIYEEGLKAIASGANPVYVKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +VE LK   K V  R+EI QVATISAN D EIG+ IA AME++G  G+IT++++
Sbjct: 121 DEAVKIIVEELKKISKPVTGRKEIEQVATISANNDPEIGKIIADAMEKVGKDGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+A T + V +GMQ DRGY+SPYFVT+ E+M A +ENPYILIY+KK+S ++ LLP+LE  
Sbjct: 181 KSAETVLEVTEGMQFDRGYLSPYFVTNPEKMEAVLENPYILIYEKKVSNIRELLPVLEKV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ RPL IIAEDVEG+ALATLVVN ++  L V AVKAP FG+RRK +L+DIA + G T 
Sbjct: 241 VQTNRPLLIIAEDVEGEALATLVVNHIKGVLRVCAVKAPGFGERRKAMLQDIAILTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE   +  LG A KVV+ KD+TTI+GG G  E I+ RI +I+K IE T S+Y
Sbjct: 301 ITEDLGIKLESVDLDMLGKADKVVVDKDNTTIIGGKGNPEDIKARIEQIKKQIETTTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVA+++VG  TEA L EKKDR  D++ AT+AA +EGIVPGGGIAL 
Sbjct: 361 DKEKLQERLAKLAGGVAIIKVGAATEAELKEKKDRVDDAVHATKAAVEEGIVPGGGIALF 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA++AL ++K +N D+  GI+IV+ A   P +QI  NAG E  +I+ KI++    NYG+N
Sbjct: 421 RASRALCNIKEENTDKAWGIKIVKNACKVPLKQIAYNAGFEGSVIIEKIKDVDNVNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    + DM E GIIDP KVVR ALQ+A S+AG ML  E +V +  + E   P
Sbjct: 481 AATGEYVDMVEAGIIDPTKVVRTALQNAASIAGTMLTAECLVAEIKEKEEKLP 533


>gi|40714533|dbj|BAD06928.1| molecular chaperone GroEL [Ralstonia pickettii]
          Length = 547

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 296/533 (55%), Positives = 395/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKA + DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKAGLNDLGQAKRIEIGKENTIIIDGAGDAGAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PKDE+A  
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKDESAPA 532


>gi|253680828|ref|ZP_04861631.1| chaperonin GroL [Clostridium botulinum D str. 1873]
 gi|253562677|gb|EES92123.1| chaperonin GroL [Clostridium botulinum D str. 1873]
          Length = 543

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 278/536 (51%), Positives = 375/536 (69%), Gaps = 4/536 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I  G  +R A+  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKSILFGEESRRAMQAGVDKLANAVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +  +GA+++++VAT T D +GDGTTTAT LAQAI  EG K VTAG NPM I++GI 
Sbjct: 61  LEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPMLIRKGIK 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LAV   VE +K + K+V  +E+I +VA ISA     IG+ IA AME++G  G+IT++++ 
Sbjct: 121 LAVDTAVEQIKKSSKQVDGKEDIARVAAISAADPE-IGKLIADAMERVGNEGVITVEESN 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  TE+ VV+GMQ DRGY+SPY VT  E+M A +EN YIL+ DKKIS +Q +LPILE   
Sbjct: 180 TMATELEVVEGMQFDRGYLSPYMVTDAEKMEAVLENAYILLTDKKISNIQEILPILEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L IIAED+EG+ALATLVVN++R     +AVKAP FGDRRKE+LRDIA + G  VI
Sbjct: 240 QQGKKLLIIAEDIEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLRDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G +++  T+  LG+A+ V ++K++TTIV G G    IE RI++I++ IE+T SD+D
Sbjct: 300 SEELGTEIKDVTLDMLGTAESVKVTKENTTIVNGKGNKSEIEDRISQIKRQIEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L AT+AA +EGIV GGG A +R
Sbjct: 360 KEKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALAATKAAVEEGIVAGGGTAYLR 419

Query: 422 AAQALSVKGD-NEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A + +    D N +   GI I+R+AL  P RQI  NAG E  +I+ KI   +    G++A
Sbjct: 420 AIKEVEKLTDSNSEIKLGISIIRRALEEPVRQIASNAGLEGSVIIDKIMNGQE-GMGFDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
            +  + +M E GI+DP KV R+ALQ+A S+A   L TE VV + P+   A PQ PA
Sbjct: 479 LEGQYVNMVEKGIVDPAKVTRSALQNAASVASTFLTTECVVAEIPEKNPA-PQAPA 533


>gi|323135631|ref|ZP_08070714.1| chaperonin GroEL [Methylocystis sp. ATCC 49242]
 gi|322398722|gb|EFY01241.1| chaperonin GroEL [Methylocystis sp. ATCC 49242]
          Length = 546

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 307/529 (58%), Positives = 405/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  T ARD I  GV  LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSTDARDRILRGVEVLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+   D +GDGTTTAT LA +I  EG K V AGLNPMD+KRG+
Sbjct: 61  ELSDKFENLGAQLVREVASKQNDIAGDGTTTATVLAASIAKEGAKAVAAGLNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV+ +V  LKA+ KKV S +EI QV TISANGDR IGE+IA AM+++G  G+IT+++A
Sbjct: 121 DLAVEAIVADLKAHSKKVTSNDEIAQVGTISANGDRFIGEEIAKAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE  +V+GMQ DRGY+SPYF+T+ E+M AE+++ Y+LI++KK+S LQPLLPILE+ 
Sbjct: 181 KSLETETDIVEGMQFDRGYLSPYFITNAEKMIAELDDAYLLIHEKKLSTLQPLLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQTGKPLVIVAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G  + IE RI +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGDKKDIEARIAQIKSQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EG+ PGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  VK  N DQ  G++IVRKA+  P RQI+ NAG +  ++V K+ E+    YG++
Sbjct: 421 RAIKALDGVKTANGDQKTGVDIVRKAIQAPARQIVDNAGGDGAVVVGKLLEATEYGYGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQK  FGD+ ++GIIDP KVVR ALQ A S+AG+++ TEA + +APK E
Sbjct: 481 AQKGEFGDLMKLGIIDPTKVVRTALQDAASIAGLIITTEATITEAPKKE 529


>gi|283853897|ref|ZP_06371110.1| chaperonin GroEL [Desulfovibrio sp. FW1012B]
 gi|283570720|gb|EFC18767.1| chaperonin GroEL [Desulfovibrio sp. FW1012B]
          Length = 549

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 285/536 (53%), Positives = 386/536 (72%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKDI     AR+ +  GV+ LA AVK TLGPKGR V+I  S+G+P +TKDGVTVAK I
Sbjct: 1   MAAKDILFDARAREKLKRGVDKLANAVKVTLGPKGRNVVIEKSYGSPIITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY+EG K V AG NPM IKRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIYSEGVKLVAAGRNPMAIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VV  L+   K    ++EI QV TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKAVESVVAELETLAKPTRDQKEIAQVGTISANSDATIGNIIAEAMNKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GMQ DRGY+SPYFVT  ERM  E++ P ILI +KK+SA++ LLPILE  
Sbjct: 181 KGMETTLDVVEGMQFDRGYLSPYFVTDPERMVCELDEPLILINEKKVSAMKDLLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL I+AED+EG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G   
Sbjct: 241 AKMSRPLLIVAEDIEGEALATLVVNKLRGTLQVCAVKAPGFGDRRKAMLEDIAILTGGQS 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +SE++G+KLE  T+ DLG AK+V++ K++TTIV G G +E+I+ R+ +I+   ++T S Y
Sbjct: 301 VSEDLGIKLENITLVDLGKAKRVIVDKENTTIVDGAGDAEKIKARVKQIRAQADETTSSY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAK+ GGVAV+ VG  TE  + EKK R +D+L+ATRAA +EGIVPGGG+ALV
Sbjct: 361 DKEKLQERLAKIVGGVAVINVGAATETEMKEKKARVEDALNATRAAVEEGIVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  ++L  +K  ++D+ +GIEIVR+A+  P RQI  NAG E  ++V+K+++     +G+N
Sbjct: 421 RCVKSLTDIKALDDDEQSGIEIVRRAIEEPLRQIASNAGFEGSIVVAKVRDG-AEGFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+   G+IDP KV R ALQ++ S+AG++L TEA V + P+ +   P MP
Sbjct: 480 AATGQYEDLIAAGVIDPKKVTRIALQNSASVAGLLLTTEAAVAEKPEPKKDMPAMP 535


>gi|288959865|ref|YP_003450205.1| chaperonin GroEL [Azospirillum sp. B510]
 gi|288912173|dbj|BAI73661.1| chaperonin GroEL [Azospirillum sp. B510]
          Length = 543

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 301/530 (56%), Positives = 400/530 (75%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD I  GV+TLA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFSADARDRILRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AGLNP+D+KRGI
Sbjct: 61  ELADKFENLGAQLVREVASKTADLAGDGTTTATVLAQAIVREGAKAVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V+  +KA  K + + +E+ QV TISANG+R IG  IA A+ ++G  G+IT+++A
Sbjct: 121 DRAVAAVIADVKARAKTISTNDEVAQVGTISANGERAIGAIIAEAVAKVGNDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TE+ VV+G+Q DRGY+SPYFVT+ E++  + + PYILI+DKK+S+LQPLLP+LE+ 
Sbjct: 181 KSLETELNVVEGLQFDRGYLSPYFVTNAEKLVVDFDTPYILIHDKKLSSLQPLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS RPL IIAEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAILEDIAILTNGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IG+KLE  ++ADLG+AK+VV++K++TT++ G G  E I+ RIN+I+  IE+T SDY
Sbjct: 301 ISEDIGIKLETVSLADLGTAKRVVIAKEETTVIDGAGGREAIDARINQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ VG  TE  + E+KDR  D++ ATRAA  EGIVPGGG+ L+
Sbjct: 361 DREKLQERLAKLSGGVAVIRVGGSTEVEVKERKDRVDDAVHATRAAIAEGIVPGGGVTLL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +A+  V   N+D+  GI+IVR+AL  P RQI +NAG +  +IV K+ E     +GY+
Sbjct: 421 YATRAIDAVVPVNDDERVGIDIVRRALQAPVRQIAENAGADGSVIVGKLLEGNDTAFGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   F D+ + GIIDP KVVR ALQ A S+AG+++ TEA++V+ P+ ++
Sbjct: 481 AQTGEFTDLLKAGIIDPAKVVRIALQDAASVAGLLITTEALIVERPEPKS 530


>gi|306830035|ref|ZP_07463221.1| chaperonin GroEL [Streptococcus mitis ATCC 6249]
 gi|304427748|gb|EFM30842.1| chaperonin GroEL [Streptococcus mitis ATCC 6249]
          Length = 540

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 277/543 (51%), Positives = 377/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 AAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVAALELAGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAELGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M     MG
Sbjct: 479 TGEWVNMIEEGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVSPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|91780203|ref|YP_555410.1| chaperonin GroEL [Burkholderia xenovorans LB400]
 gi|118597104|sp|Q13IM9|CH605_BURXL RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|91692863|gb|ABE36060.1| groEL 60 kDa chaperonin [Burkholderia xenovorans LB400]
          Length = 546

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 286/532 (53%), Positives = 393/532 (73%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFG+P VTKDGV+VAK I
Sbjct: 1   MAAKEIIFSDVARSKLVEGVNILANAVKVTLGPKGRNVVLERSFGSPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELPDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   ++ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVVAAIDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+   ++  A ++NPY+L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPYVLLHDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G  + IE R+ +I+  I++  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGEHKNIEARVKQIRAQIDEASSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R   A+S +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+    + N+GYN
Sbjct: 421 RVRNAISGLKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKV-AEGSGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           AQ   +GD+ E G++DP KV R ALQ+A S+A ++L T+A V +APKD   +
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAALLLTTDATVYEAPKDPAPA 531


>gi|296125258|ref|YP_003632510.1| chaperonin GroEL [Brachyspira murdochii DSM 12563]
 gi|296017074|gb|ADG70311.1| chaperonin GroEL [Brachyspira murdochii DSM 12563]
          Length = 543

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 283/531 (53%), Positives = 381/531 (71%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +     AR A+  GV+ LA AVK TLGP+GR V+I   FG P +  DGVT+AK I
Sbjct: 1   MAAKQLLFDEEARRALMRGVDALANAVKVTLGPRGRNVVIDKKFGPPTIINDGVTIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VT+G NPM IKRGI
Sbjct: 61  ELEDPFENMGAQIVKEVATKTNDVAGDGTTTATVLAQAMVKEGLKNVTSGANPMLIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV E+V Y+K+  K++  +EEI QVATISAN D+EIG  I+ AME++G  G+IT+++A
Sbjct: 121 EKAVNEIVGYIKSEAKQIKGKEEIAQVATISANNDKEIGSLISDAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T + +V+GMQ DRGYISPYFVT+ + MTAE+E+  +LIYDKKIS ++ LLPILE  
Sbjct: 181 KSLETSLSLVEGMQFDRGYISPYFVTNGDSMTAELEDALLLIYDKKISNMKELLPILEKI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRP  IIAED+E +ALATLV+N++R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AQTGRPFIIIAEDIENEALATLVLNKMRGVLNVCAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE A+I  LG AKK+ + K++TTIV G G  E ++ R+  I+K IE+T SDY
Sbjct: 301 ISEDLGMKLENASIEQLGKAKKITVDKENTTIVEGAGSKEDVKNRVTVIKKQIEETDSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL+GGVAV+ +G  TE  + EKK R +D+L ATRAA +EG++PGGGI  +
Sbjct: 361 DREKLQERLAKLSGGVAVINIGAATEVEMKEKKARVEDALSATRAAVEEGVIPGGGITYL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A   L S+K DN D+  GI IV++A+  P R I  NAG +  ++  + +E K  N G+N
Sbjct: 421 HAQGKLDSLKADNADEQVGINIVKRAIEEPIRMIATNAGLDGSVVAIQAKEQK-GNMGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A  + + DM + GIIDP KV R+ALQ+A S+A  +L  E ++ D P+ E A
Sbjct: 480 ALTNEWVDMLKAGIIDPAKVSRSALQNAASIASQVLTAEVIITDIPEPEKA 530


>gi|319406166|emb|CBI79803.1| groEL chaperonin [Bartonella sp. AR 15-3]
          Length = 550

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 315/529 (59%), Positives = 406/529 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G  AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT L QAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGIKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+EVVE L    KK+ +  EI QV TISANG  EIG+ IA AME++G  G+IT+++A
Sbjct: 121 DAAVEEVVENLFKKAKKIQTSAEIAQVGTISANGAVEIGKMIADAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++++PYILI++KK+S LQ LLP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA +    V
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV ++K++TTI+ G G    I  R+N+I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLDMLGRAKKVNITKENTTIIDGAGRKAEITARVNQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIV GGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAA AL+VKG N DQ AGI IVR+AL  P RQI  NAG+E+ +IV K+ E+ +  +GYN 
Sbjct: 421 RAANALTVKGKNPDQEAGIHIVRRALQAPARQIAMNAGEEAAIIVGKVLENNSDTFGYNT 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               FGD+  +GI+DPVKVVR+ALQ+A S+A +++ TEA+V + PK +T
Sbjct: 481 ATGQFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAELPKKDT 529


>gi|327459195|gb|EGF05543.1| chaperone GroEL [Streptococcus sanguinis SK1057]
 gi|332358386|gb|EGJ36211.1| chaperone GroEL [Streptococcus sanguinis SK49]
          Length = 540

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAISNRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|310815425|ref|YP_003963389.1| chaperonin GroEL [Ketogulonicigenium vulgare Y25]
 gi|308754160|gb|ADO42089.1| chaperonin GroEL [Ketogulonicigenium vulgare Y25]
          Length = 547

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 400/533 (75%), Gaps = 1/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFNTEARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++++VA  T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELADKFENMGAQLVKEVAARTNDEAGDGTTTATVLAQAIIKEGLKSVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE LKA  + V   +E+ QV TISANG+  IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLATTKVVEALKAAARPVADSDEVAQVGTISANGEALIGKLIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T V VV+GMQ DRG++SPYFVT+ ++M A++++  IL+++KK+S+LQP++P+LE+ 
Sbjct: 181 KGTETSVEVVEGMQFDRGFLSPYFVTNPDKMVADLDDVLILLHEKKLSSLQPMVPLLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+D+A + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  TI  LGSAK+V ++KD TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLEGVTIDMLGSAKRVSITKDATTIVDGAGERTEIEARVGQIRTQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EGI+ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A + L  + G N DQ  GI I+R+AL  P RQI +N+G +  ++  KI+ES + ++G+N
Sbjct: 421 QATKVLDGLVGANSDQNVGIAIIRRALEAPIRQISENSGVDGAVVAGKIRESTSTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           AQ   +GDMF  G+IDP KV R AL++A S+A +++ TEA++ D P+ + A  
Sbjct: 481 AQTEEYGDMFTFGVIDPAKVTRTALENAASVASLLITTEAMIADKPEPKGAPA 533


>gi|163737788|ref|ZP_02145205.1| chaperonin GroEL [Phaeobacter gallaeciensis BS107]
 gi|163742906|ref|ZP_02150290.1| chaperonin GroEL [Phaeobacter gallaeciensis 2.10]
 gi|161383870|gb|EDQ08255.1| chaperonin GroEL [Phaeobacter gallaeciensis 2.10]
 gi|161389314|gb|EDQ13666.1| 60 kDa chaperonin [Phaeobacter gallaeciensis BS107]
          Length = 550

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 299/531 (56%), Positives = 403/531 (75%), Gaps = 1/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLNGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKAMAREVKDSAEVAQVGTISANGESEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++E+  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETTVVEGMQFDRGYLSPYFVTNADKMVADLEDCMILLHEKKLSSLQAMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKK+ ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKIEITKDETTIVDGAGEKAEIEARVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL  ++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES   N+G+N
Sbjct: 421 QAGKALEGLEGANADQNAGIVIVRKAIEAPLRQIAENAGVDGAVVAGKVRESSDNNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  + A
Sbjct: 481 AQTEEYGDMFAFGVIDPAKVARTALEDAASVAGLLITTEAMVADKPSKDGA 531


>gi|296333064|ref|ZP_06875520.1| chaperonin GroEL [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305673310|ref|YP_003864982.1| chaperonin GroEL [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296149789|gb|EFG90682.1| chaperonin GroEL [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305411554|gb|ADM36673.1| chaperonin GroEL [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 541

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/528 (51%), Positives = 369/528 (69%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 KAVAVAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G G +++I  R+ +I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQITQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++  
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENA 526


>gi|118581209|ref|YP_902459.1| chaperonin GroEL [Pelobacter propionicus DSM 2379]
 gi|166201739|sp|A1AST1|CH60_PELPD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|118503919|gb|ABL00402.1| chaperonin GroEL [Pelobacter propionicus DSM 2379]
          Length = 554

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/528 (55%), Positives = 384/528 (72%), Gaps = 1/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK IK     R+AI  GVN LA+ VK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MAAKIIKFDQEGRNAILKGVNILADTVKVTLGPKGRNVVIDKSFGAPLITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++++VA+ T D +GDGTTTAT LAQAIY +G K V AG NPM+IKRGI
Sbjct: 61  ELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  L+   K +   +EI QV TISAN D+ IG+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVETIVAELQKISKPIVDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  T +  V+GMQ DRGY+SPYFVT  ERM A +EN  ILI+DKKIS ++ LLPILE  
Sbjct: 181 KSMDTTLETVEGMQFDRGYLSPYFVTDPERMEAALENALILIHDKKISNMKDLLPILEQT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVAAVKAPGFGDRRKAMLEDIATLTGGLV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G KLE+AT+  LG AK++ + KD+TTI+ G G    I+GR+ +I+  IE+T SDY
Sbjct: 301 ISEEVGHKLEQATMDMLGRAKRITIDKDNTTIIDGEGKEADIQGRVKQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA DEG+VPGGG+A +
Sbjct: 361 DKEKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVDEGVVPGGGVAYI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R   AL       +Q  G+ +V+ AL  P RQI  NAG ++ ++V K++  K A +GY+A
Sbjct: 421 RTLSALDNLNLENEQQFGVTVVKLALEAPIRQIADNAGIDASIVVDKVRNGKDA-FGYDA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
               + DM + GIIDP KV R+ALQ+A S+AG+ML TEA++ + P++E
Sbjct: 480 ASDEYVDMLKAGIIDPTKVSRSALQNASSIAGLMLTTEALIAEKPREE 527


>gi|84686153|ref|ZP_01014048.1| chaperonin GroEL [Maritimibacter alkaliphilus HTCC2654]
 gi|84665680|gb|EAQ12155.1| chaperonin GroEL [Rhodobacterales bacterium HTCC2654]
          Length = 544

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 297/528 (56%), Positives = 404/528 (76%), Gaps = 1/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+K  T AR+A+  GVNTLA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I 
Sbjct: 1   MAKDVKFDTDARNAMLRGVNTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVTEGMKSVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA  +VVE ++A  + V   +E+ QV TISANG+  IG  IA AM+++G  G+IT+++ K
Sbjct: 121 LATTKVVEAIQAAARPVNDSDEVAQVGTISANGETAIGRFIADAMQKVGNEGVITVEENK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TEV VV+GMQ DRGY+SPYFVT+ ++M AE+++ +IL+++KK+S+LQP++P+LE   
Sbjct: 181 GMETEVDVVEGMQFDRGYLSPYFVTNADKMIAELDDCFILLHEKKLSSLQPMVPLLEQVI 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 241 QSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAVLTGGQVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SE++G+KLE  T+  LG+AK + +SK++TTIV G G    IE R+ +I+  IE+T SDYD
Sbjct: 301 SEDLGMKLENVTMDMLGTAKTINISKEETTIVDGAGDKAEIEARVAQIRTQIEETSSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ER+AKLAGGVAV++VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV+
Sbjct: 361 REKLQERVAKLAGGVAVIKVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALVQ 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
            A+AL  ++G N DQ AGI IVR+AL  P RQI +NAG +  ++  KI+ES    +G+NA
Sbjct: 421 GAKALDGLEGANSDQNAGIAIVRRALEAPLRQIAENAGVDGAVVAGKIRESDDVKFGFNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           Q   +GDMF+ G+IDP KVVR AL+ A S+AG+++ TEA+V D P+++
Sbjct: 481 QTEEYGDMFKFGVIDPAKVVRTALEDAASIAGLLITTEAMVADKPEEK 528


>gi|291295475|ref|YP_003506873.1| chaperonin GroEL [Meiothermus ruber DSM 1279]
 gi|290470434|gb|ADD27853.1| chaperonin GroEL [Meiothermus ruber DSM 1279]
          Length = 545

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 284/546 (52%), Positives = 392/546 (71%), Gaps = 4/546 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR ++  G+N +A AVK TLGP+GR V++   FG+P +TKDGV+VAK + 
Sbjct: 1   MAKMLVFDEAARRSLERGMNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVSVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++ ++A+ T D +GDGTTTAT L QAI  EG + V AG NP+D+KRGI+
Sbjct: 61  LEDHLENIGAKLMIEIASKTNDITGDGTTTATVLGQAIVREGLRNVAAGANPLDLKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   ++ ++     V  R+ I +VA++SAN D EIG  IA AME++G  G+IT++++K
Sbjct: 121 KAVDVAIKSIQELAVPVNDRKAIFEVASVSANNDAEIGNLIADAMEKVGREGVITVEESK 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE+  V+G Q D+GYISPYFV + + M A+++ P+ILI +KKIS ++ LLP+LE   
Sbjct: 181 SLDTELNFVEGYQFDKGYISPYFVNNPDTMEAQLDEPFILITEKKISNVRELLPVLEQVA 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVNR+R  L + AVKAP FGDRRKE+L+D+AA+ G TVI
Sbjct: 241 QTGKPLLIIAEDVEGEALATLVVNRLRGTLNIAAVKAPGFGDRRKEMLKDLAAITGGTVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TT+VGG G  E IE RIN I+K +E + S+Y 
Sbjct: 301 SEELGFKLENATLSMLGRAERVRINKDETTVVGGKGKKEDIEARINGIKKELETSDSEYA 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L EKK RY+D+L   RAA +EGIVPGGG+AL+R
Sbjct: 361 KEKLQERLAKLAGGVAVIRVGAATETELKEKKHRYEDALSTARAAVEEGIVPGGGVALLR 420

Query: 422 AAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A  A+   +K  + D+  G +IV +A+  P RQI  NAG E  ++V+ I   K  NYG+N
Sbjct: 421 AVPAIKNLIKELDGDEATGAKIVLRAIEEPARQIAANAGYEGSVVVNNILSKKEKNYGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    +GDM E GI+DP KV R ALQ+A S+  ++L+TEAVV + P+++ A P  PAG G
Sbjct: 481 AATGEYGDMMEWGIVDPAKVTRTALQNAASIGSLILMTEAVVAEKPEEKKA-PAAPAG-G 538

Query: 540 MGGGMG 545
           MGG M 
Sbjct: 539 MGGDMD 544


>gi|308067969|ref|YP_003869574.1| chaperonin GroEL [Paenibacillus polymyxa E681]
 gi|305857248|gb|ADM69036.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Paenibacillus
           polymyxa E681]
          Length = 542

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 266/534 (49%), Positives = 378/534 (70%), Gaps = 4/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEDARRSMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG +P+ I++GID
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQALITEGLKNVTAGASPIGIRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V  L+A  K + S++ I QVA ISA  D  +GE IA AME++G  G+IT+++++
Sbjct: 121 KAVKAAVAELQAISKPIESKQSIAQVAGISAADDE-VGELIAEAMEKVGKDGVITVEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGYISPY +T T++M A ++NPYILI DKKI+  Q +LP+LE   
Sbjct: 180 GFATELEVVEGMQFDRGYISPYMITDTDKMEAVLDNPYILITDKKITNTQEILPLLEKIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAED+EG+ALA LVVN++R     +AVKAP FGDRRK +L+DIAA+ G  VI
Sbjct: 240 QQGKPLVLIAEDIEGEALAMLVVNKLRGTFNAVAVKAPGFGDRRKAMLQDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A++  LG+A++V ++K++T +V G G    I+ R+++I+  +E+T S++D
Sbjct: 300 TEELGLDLKTASVDQLGTARQVRITKENTIVVDGAGNKADIDARVSQIRTQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E+K R +D+L+ATRAA +EGIV GGG+AL+ 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKERKLRIEDALNATRAAVEEGIVSGGGVALLN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A++      D+  G+ IV +AL  P R I  NAG+E  +IV +++  +    G+NA 
Sbjct: 420 VYKAVAAVELQGDEQTGVNIVLRALEAPIRTIAANAGEEGSVIVERLKREE-VGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M + GI+DP KV R ALQ+A S+A M L TEAV+ D P+ E A   MP
Sbjct: 479 TGDWVNMIDAGIVDPAKVTRYALQNAASVAAMFLTTEAVIADKPEPEKA--AMP 530


>gi|168492118|ref|ZP_02716261.1| chaperonin GroL [Streptococcus pneumoniae CDC0288-04]
 gi|183573691|gb|EDT94219.1| chaperonin GroL [Streptococcus pneumoniae CDC0288-04]
          Length = 540

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 275/543 (50%), Positives = 375/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS  PL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNHPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|126739873|ref|ZP_01755564.1| chaperonin GroEL [Roseobacter sp. SK209-2-6]
 gi|126719105|gb|EBA15816.1| chaperonin GroEL [Roseobacter sp. SK209-2-6]
          Length = 550

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/529 (55%), Positives = 401/529 (75%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA+ + V    E+ QV TISANG+  IG +IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKASARDVKDSAEVAQVGTISANGEEAIGSQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M A++++  IL+++KK+S+LQ ++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIADLDDCMILLHEKKLSSLQSMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTIVDGAGAKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG++ GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVIVGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL+ ++G N DQ AGI IV+KA+  P RQI +NAG +  ++  K++ES   ++G+N
Sbjct: 421 QAGKALAGLEGANADQNAGIVIVKKAIEAPLRQIAENAGVDGAVVAGKVRESDDTSFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF  G+IDP KV R AL+ A S+AG+++ TEA+V D P  +
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLITTEAMVADKPAKD 529


>gi|56962656|ref|YP_174382.1| chaperonin GroEL [Bacillus clausii KSM-K16]
 gi|59797661|sp|Q5WJN4|CH60_BACSK RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|56908894|dbj|BAD63421.1| chaperonin GroEL [Bacillus clausii KSM-K16]
          Length = 545

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 272/528 (51%), Positives = 375/528 (71%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDI+    AR ++  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIQFSEEARRSMLKGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VT+G NPM I++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMGIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A    V+ LKA  K +  RE I QVA IS+  D E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 KATAAAVKELKAISKPIEGRESIAQVAAISSA-DEEVGQIIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             +TE+ VV+GMQ DRGY SPY V+ +++M A ++NPY+LI DKKI+ +Q +LP+LE   
Sbjct: 180 GFSTELEVVEGMQFDRGYASPYMVSDSDKMEAVLDNPYVLITDKKITNIQEVLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q  RP+ IIAEDVEG+ALATLV+N++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQSRPVLIIAEDVEGEALATLVLNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATI  LG A KVV++K++TTIV G G  E+I GR+N+++  +E+T S++D
Sbjct: 300 TEDLGLDLKSATIESLGRAAKVVVTKENTTIVEGAGDPEQISGRVNQLKAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAVL+VG  TE  + E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A+       D+  G+ IV +AL  P RQI  NAG E  +IV K++  +    GYNA 
Sbjct: 420 VIKAVKAVDATGDEATGVNIVLRALEEPVRQIAHNAGLEGSIIVEKLKAEE-VGVGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DPVKV R+ALQ+A S++ M L TEAV+ D P++  
Sbjct: 479 TGEYVNMVETGILDPVKVTRSALQNAASVSAMFLTTEAVIADKPEENA 526


>gi|169833777|ref|YP_001695268.1| chaperonin GroEL [Streptococcus pneumoniae Hungary19A-6]
 gi|182684851|ref|YP_001836598.1| chaperonin GroEL [Streptococcus pneumoniae CGSP14]
 gi|303253870|ref|ZP_07339993.1| chaperonin GroEL [Streptococcus pneumoniae BS455]
 gi|303260698|ref|ZP_07346659.1| chaperonin GroEL [Streptococcus pneumoniae SP-BS293]
 gi|303262432|ref|ZP_07348374.1| chaperonin GroEL [Streptococcus pneumoniae SP14-BS292]
 gi|303265365|ref|ZP_07351273.1| chaperonin GroEL [Streptococcus pneumoniae BS397]
 gi|303267429|ref|ZP_07353284.1| chaperonin GroEL [Streptococcus pneumoniae BS457]
 gi|303269675|ref|ZP_07355432.1| chaperonin GroEL [Streptococcus pneumoniae BS458]
 gi|226704178|sp|B1I8B2|CH60_STRPI RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704179|sp|B2ILZ5|CH60_STRPS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|168996279|gb|ACA36891.1| chaperonin GroL [Streptococcus pneumoniae Hungary19A-6]
 gi|182630185|gb|ACB91133.1| chaperonin GroEL [Streptococcus pneumoniae CGSP14]
 gi|301802599|emb|CBW35361.1| 60 kDa chaperonin [Streptococcus pneumoniae INV200]
 gi|302599149|gb|EFL66172.1| chaperonin GroEL [Streptococcus pneumoniae BS455]
 gi|302636332|gb|EFL66825.1| chaperonin GroEL [Streptococcus pneumoniae SP14-BS292]
 gi|302638142|gb|EFL68616.1| chaperonin GroEL [Streptococcus pneumoniae SP-BS293]
 gi|302640815|gb|EFL71205.1| chaperonin GroEL [Streptococcus pneumoniae BS458]
 gi|302643058|gb|EFL73350.1| chaperonin GroEL [Streptococcus pneumoniae BS457]
 gi|302645082|gb|EFL75321.1| chaperonin GroEL [Streptococcus pneumoniae BS397]
          Length = 540

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISNRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|322387196|ref|ZP_08060806.1| chaperone GroEL [Streptococcus infantis ATCC 700779]
 gi|321141725|gb|EFX37220.1| chaperone GroEL [Streptococcus infantis ATCC 700779]
          Length = 539

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 281/545 (51%), Positives = 374/545 (68%), Gaps = 7/545 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A KV + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAAKVSVDKDSTVIVEGAGNPEAIANRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+       D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVEALELTGDEATGRSIVLRALEEPVRQIAYNAGYEGSIVIDRLKNAEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+     P  PA     
Sbjct: 479 TGEWVNMIEAGIIDPVKVSRSALQNAASVASLILTTEAVVANKPE-----PVAPAPAMDP 533

Query: 542 GGMGG 546
             MGG
Sbjct: 534 SMMGG 538


>gi|40714530|dbj|BAD06926.1| molecular chaperone GroEL [Ralstonia pickettii]
          Length = 544

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 395/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVIFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IGE+IA AM+++G  G+IT++  
Sbjct: 121 DKAVTAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   ++++P++L++DKK+S ++ LLP+LE  
Sbjct: 181 KSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSPFVLLFDKKVSNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRR  +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRNGMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EEIGL LEKAT+ DLG AK++ + K++T I+ G G +  IEGR+ +I+  IE+  SDY
Sbjct: 301 IAEEIGLTLEKATLNDLGQAKRIEIGKENTIIIDGAGDAGAIEGRVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S + G+N DQ AGI+IV +A+  P RQI+ NAG+E+ ++V+K+ E K  NYGYN
Sbjct: 421 RARAAISALTGENADQNAGIKIVLRAMEEPLRQIVLNAGEEASVVVAKVIEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V ++PK+E+A  
Sbjct: 480 AASGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAESPKEESAPA 532


>gi|325168508|ref|YP_004280298.1| chaperonin GroEL [Agrobacterium sp. H13-3]
 gi|325064231|gb|ADY67920.1| chaperonin GroEL [Agrobacterium sp. H13-3]
          Length = 542

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 306/529 (57%), Positives = 406/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K  T AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGV+VAK I
Sbjct: 1   MAAKEVKFNTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V +G+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV  VV+ LKAN +K+ S  EI QV TISANGD EIG+ +A AME++G  G+IT+++A
Sbjct: 121 DIAVDAVVKELKANARKITSNSEIAQVGTISANGDEEIGKYLAEAMEKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M  E+E PYIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEEPYILVHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VKSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKV + K++TTI+ G G    I+ R+ +I+  IE+T SDY
Sbjct: 301 ISEDVGIKLENVTLEMLGRAKKVAIEKENTTIIDGVGSKGEIDSRVAQIRAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGI+PGGG+AL+
Sbjct: 361 DRDKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +AL  +   N+DQ  GI+IVR+A+  P RQI +NAG E  ++V K++E    ++G+N
Sbjct: 421 RAVKALDGLPTANDDQRVGIDIVRRAIEAPARQIAENAGAEGSIVVGKLREKTDLSFGWN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GD++  G+IDP KVVR ALQ A S+AG+++ TEA++ + PK +
Sbjct: 481 AQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKKD 529


>gi|288554884|ref|YP_003426819.1| chaperonin GroEL [Bacillus pseudofirmus OF4]
 gi|288546044|gb|ADC49927.1| chaperonin GroEL [Bacillus pseudofirmus OF4]
          Length = 546

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/526 (50%), Positives = 372/526 (70%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRSMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VT+G NPM I++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMVIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A    V  LK   K +  +E I QVA IS+  D E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 KATAAAVTELKNIAKPIEGKESIAQVAAISSA-DEEVGQIIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             +TE+ VV+GMQ DRGY SPY VT +++M A ++NPY+LI DKKIS +Q +LP+LE   
Sbjct: 180 GFSTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYVLITDKKISNIQEVLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+P+ IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIATLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ A I  LG A KVV++K++TTIV G G +++I  R+N+I+  +E+T SD+D
Sbjct: 300 TEDLGLDLKSANITQLGRAGKVVVTKENTTIVEGAGEADQIAARVNQIKGQLEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAVL+VG  TE  + E+K R +D+L++TRAA +EGIV GGG AL+ 
Sbjct: 360 KEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A+     + D+  G+ IV +AL  P RQI  NAG E  +IV +++  +   +G+NA 
Sbjct: 420 VIKAVEAVSADGDEATGVNIVLRALEEPVRQIAHNAGLEGSVIVERLKSQE-VGFGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ A S++ M L TEAV+ D P++
Sbjct: 479 TGEWVNMVETGIVDPTKVTRSALQHAASVSAMFLTTEAVIADKPEE 524


>gi|326315731|ref|YP_004233403.1| chaperonin GroEL [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372567|gb|ADX44836.1| chaperonin GroEL [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 545

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 300/536 (55%), Positives = 396/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVAELKKASKATTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA   +KGDN DQ AGI+++ KA+  P R+I+ NAG E  ++V+ +   K  NYG+N
Sbjct: 421 RAKQAAGEIKGDNPDQDAGIKLILKAIEAPLREIVANAGGEPSVVVNAVLHGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APKDE A+P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKDEAAAPAMP 535


>gi|189425979|ref|YP_001953156.1| chaperonin GroEL [Geobacter lovleyi SZ]
 gi|226704134|sp|B3E8G0|CH60_GEOLS RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|189422238|gb|ACD96636.1| chaperonin GroEL [Geobacter lovleyi SZ]
          Length = 548

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/529 (55%), Positives = 384/529 (72%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I+     R+AI  GVN LA+AVK TLGPKGR VII  SFG+P +TKDGV+VAK +
Sbjct: 1   MSAKEIRFNEEGRNAILRGVNALADAVKVTLGPKGRNVIIEKSFGSPLITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+++++VA+ T D +GDGTTTAT LAQAIY +G K V AG NPM+IKRGI
Sbjct: 61  ELENKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYKQGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  L+   K +   +EI QV TISAN D+ IG+ IA AME++G  G+IT+++A
Sbjct: 121 DKAVEAIVAELQKISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T +  V+GMQ DRGY+SPYFV+  ERM A +EN  ILIYDKKIS ++ +LP+LE  
Sbjct: 181 KAMETSLETVEGMQFDRGYLSPYFVSDPERMEATLENATILIYDKKISNMKDMLPVLEQT 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAED+EG+ALATLVVN++R  L V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLMIIAEDIEGEALATLVVNKLRGVLNVCAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G KLE  T+  LG AK++V+ KD+TTI+ G+G    I+GR+ +I+  IEDT SDY
Sbjct: 301 ISEEMGFKLENTTMEMLGRAKRIVVDKDNTTIIDGDGSEADIQGRVKQIRAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV++VG  TE  + EKK R +D+L ATRAA DEGIVPGGG+A +
Sbjct: 361 DREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVAYI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  AL       +Q  G+ I++ +L  P RQI  NAG ++ ++V K++  K A +GYNA
Sbjct: 421 RALNALDSVVLPAEQQFGVTIIKSSLEAPIRQIADNAGIDASIVVDKVKNGKEA-FGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
               + DM E GIIDP KV R ALQ+A S+AG+ML TE ++ + PK ++
Sbjct: 480 ADDTYVDMLEAGIIDPTKVSRCALQNASSVAGLMLTTECMIAEKPKKDS 528


>gi|94987067|ref|YP_595000.1| chaperonin GroEL [Lawsonia intracellularis PHE/MN1-00]
 gi|118597116|sp|Q1MQP8|CH60_LAWIP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|94731316|emb|CAJ54679.1| GroEL/HSP60 homolog [Lawsonia intracellularis PHE/MN1-00]
          Length = 548

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 279/530 (52%), Positives = 380/530 (71%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+I     AR+ ++ GV+ LA AVK TLGPKGR V+I  SFG+P +TKDGV+VAK I
Sbjct: 1   MASKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM IKRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V + L    K    ++EI QV TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKAVVAVTKELSDITKPTRDQKEIAQVGTISANSDTTIGNIIAEAMAKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GM+ DRGY+SPYFVT+ E+M  E++NPYIL  +KKI++++ +LPILE  
Sbjct: 181 KGLETTLDVVEGMKFDRGYLSPYFVTNPEKMVCELDNPYILCNEKKITSMKDMLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL IIAEDVEG+ALATLVVN++R  L V+AVKAP FG+RRK +L DIA + G   
Sbjct: 241 AKVNRPLLIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGERRKAMLEDIAILTGGEA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I E+ G+KLE  +++ LG+AK+VV+ K++TTIV G G SE I+ R+ +I+  IE+T SDY
Sbjct: 301 IFEDRGIKLENVSLSSLGTAKRVVIDKENTTIVDGAGKSEDIKARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG A V
Sbjct: 361 DREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTAFV 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R+ + L      ++D+ AG+ I+R++L  P RQI  NAG E  ++V K++E+K   +G+N
Sbjct: 421 RSIKVLDDIKPADDDELAGLNIIRRSLEEPLRQIAANAGYEGSIVVEKVREAKD-GFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A    + D+ + G+IDP KV R ALQ+A S+A ++L TE  + + P+ + 
Sbjct: 480 AASGEYEDLIKAGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKK 529


>gi|444101|prf||1906220B groEL gene
          Length = 544

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/526 (51%), Positives = 369/526 (70%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVALAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYLVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   IA LG A KVV++K++TTIV G G +++I  R+ +I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGV V++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEE 524


>gi|302872536|ref|YP_003841172.1| chaperonin GroEL [Caldicellulosiruptor obsidiansis OB47]
 gi|312135818|ref|YP_004003156.1| chaperonin groel [Caldicellulosiruptor owensensis OL]
 gi|302575395|gb|ADL43186.1| chaperonin GroEL [Caldicellulosiruptor obsidiansis OB47]
 gi|311775869|gb|ADQ05356.1| chaperonin GroEL [Caldicellulosiruptor owensensis OL]
          Length = 539

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 287/541 (53%), Positives = 377/541 (69%), Gaps = 5/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR A+  GVN LA+ VK TLGPKGR V++   FG+P++  DGVT+AK I
Sbjct: 1   MAAKMILFDEEARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQA+  EG K + AG NPM +++GI
Sbjct: 61  ELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
             AV  VVE ++   KKV  +E+I  VA+ISA  D EIG+ +A AME++   G+IT++++
Sbjct: 121 QKAVDVVVEEIRKMSKKVRGKEDITYVASISAG-DEEIGKLVADAMEKVTNDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT  T + +V+GMQ DRGYIS Y VT TERM A +++PYILI DKKIS +Q +LP+LE  
Sbjct: 180 KTTETTLEIVEGMQFDRGYISAYMVTDTERMEAVLDDPYILITDKKISTIQDILPLLEQI 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q GR L IIAEDVEG+ALATLVVN++R  L  +AVKAP FGDRRK +L+DIA + G  V
Sbjct: 240 VQQGRKLLIIAEDVEGEALATLVVNKLRGTLQCVAVKAPGFGDRRKAMLQDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL L +  ++ LG A++V + K++T IV G G    I+ RI  I+K IE+T SD+
Sbjct: 300 ISEELGLDLREVKLSQLGRARQVKVQKENTIIVDGAGDPSEIKARIQSIKKQIEETTSDF 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L AT+AA +EGIVPGGG AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIHVGAATETELKEKKLRIEDALAATKAAVEEGIVPGGGTALI 419

Query: 421 RAAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
            A  AL    +    D+  G  IVRKAL  P RQI +NAG +  +IV+K++ES  A  G+
Sbjct: 420 NAIPALDKLIESLTGDEKTGALIVRKALEEPLRQIAENAGLDGSVIVNKVKES-PAGVGF 478

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A    F DMFE GI+DP KV R A+Q+A S A M+L TEAVV + P+ E  +P  PA  
Sbjct: 479 DALNERFVDMFEAGIVDPTKVTRTAIQNAASAAAMLLTTEAVVAEKPEKEK-NPPAPAPD 537

Query: 539 G 539
            
Sbjct: 538 M 538


>gi|83582568|dbj|BAE54309.1| HSP60 [Lawsonia intracellularis]
          Length = 548

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 279/530 (52%), Positives = 380/530 (71%), Gaps = 2/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA+K+I     AR+ ++ GV+ LA AVK TLGPKGR V+I  SFG+P +TKDGV+VAK I
Sbjct: 1   MASKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAIY EG K V AG NPM IKRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V + L    K    ++EI QV TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKAVVAVTKELSDITKPTRDQKEIAQVGTISANSDTTIGNIIAEAMAKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GM+ DRGY+SPYFVT+ E+M  E++NPYIL  +KKI++++ +LPILE  
Sbjct: 181 KGLETTLDVVEGMKFDRGYLSPYFVTNPEKMVCELDNPYILCNEKKITSMKDMLPILEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL IIAEDVEG+ALATLVVN++R  L V+AVKAP FG+RRK +L DIA + G   
Sbjct: 241 AKVNRPLLIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGERRKAMLEDIAILTGGGA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I E+ G+KLE  +++ LG+AK+VV+ K++TTIV G G SE I+ R+ +I+  IE+T SDY
Sbjct: 301 IFEDRGIKLENVSLSSLGTAKRVVIDKENTTIVDGAGKSEDIKARVKQIRAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG A V
Sbjct: 361 DREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTAFV 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R+ + L      ++D+ AG+ I+R++L  P RQI  NAG E  ++V K++E+K   +G+N
Sbjct: 421 RSIKVLDDIKPADDDELAGLNIIRRSLEEPLRQIAANAGYEGSIVVEKVREAKD-GFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           A    + D+ + G+IDP KV R ALQ+A S+A ++L TE  + + P+ + 
Sbjct: 480 AASGEYEDLIKAGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKK 529


>gi|15901732|ref|NP_346336.1| chaperonin GroEL [Streptococcus pneumoniae TIGR4]
 gi|15903764|ref|NP_359314.1| chaperonin GroEL [Streptococcus pneumoniae R6]
 gi|111657026|ref|ZP_01407826.1| hypothetical protein SpneT_02001740 [Streptococcus pneumoniae
           TIGR4]
 gi|116516636|ref|YP_817135.1| chaperonin GroEL [Streptococcus pneumoniae D39]
 gi|148985488|ref|ZP_01818677.1| chaperonin GroEL [Streptococcus pneumoniae SP3-BS71]
 gi|148993221|ref|ZP_01822787.1| chaperonin GroEL [Streptococcus pneumoniae SP9-BS68]
 gi|148998443|ref|ZP_01825884.1| chaperonin GroEL [Streptococcus pneumoniae SP11-BS70]
 gi|149007387|ref|ZP_01831030.1| chaperonin GroEL [Streptococcus pneumoniae SP18-BS74]
 gi|149023444|ref|ZP_01836033.1| chaperonin GroEL [Streptococcus pneumoniae SP23-BS72]
 gi|168484915|ref|ZP_02709860.1| chaperonin GroL [Streptococcus pneumoniae CDC1873-00]
 gi|168487170|ref|ZP_02711678.1| chaperonin GroL [Streptococcus pneumoniae CDC1087-00]
 gi|168490106|ref|ZP_02714305.1| chaperonin GroL [Streptococcus pneumoniae SP195]
 gi|168494758|ref|ZP_02718901.1| chaperonin GroL [Streptococcus pneumoniae CDC3059-06]
 gi|168576685|ref|ZP_02722551.1| chaperonin GroL [Streptococcus pneumoniae MLV-016]
 gi|194398217|ref|YP_002038500.1| chaperonin GroEL [Streptococcus pneumoniae G54]
 gi|221232640|ref|YP_002511794.1| 60 kDa chaperonin [Streptococcus pneumoniae ATCC 700669]
 gi|225855346|ref|YP_002736858.1| chaperonin GroEL [Streptococcus pneumoniae JJA]
 gi|225859672|ref|YP_002741182.1| chaperonin GroEL [Streptococcus pneumoniae 70585]
 gi|225861699|ref|YP_002743208.1| chaperonin GroEL [Streptococcus pneumoniae Taiwan19F-14]
 gi|298229950|ref|ZP_06963631.1| chaperonin GroEL [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298255173|ref|ZP_06978759.1| chaperonin GroEL [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298503643|ref|YP_003725583.1| chaperonin GroEL [Streptococcus pneumoniae TCH8431/19A]
 gi|307068526|ref|YP_003877492.1| hypothetical protein SPAP_1927 [Streptococcus pneumoniae AP200]
 gi|307128107|ref|YP_003880138.1| chaperonin GroL [Streptococcus pneumoniae 670-6B]
 gi|61220901|sp|P0A335|CH60_STRPN RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|61220902|sp|P0A336|CH60_STRR6 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|122278019|sp|Q04IQ3|CH60_STRP2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|226704177|sp|B5E223|CH60_STRP4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813900|sp|C1C9H6|CH60_STRP7 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813901|sp|B8ZNK9|CH60_STRPJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813903|sp|C1CGD7|CH60_STRZJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|254813905|sp|C1CTD6|CH60_STRZT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|18028147|gb|AAL55997.1|AF325449_1 GroEL [Streptococcus pneumoniae]
 gi|14973411|gb|AAK75976.1| chaperonin, 60 kDa [Streptococcus pneumoniae TIGR4]
 gi|15459401|gb|AAL00525.1| Chaperonin GroEL [Streptococcus pneumoniae R6]
 gi|116077212|gb|ABJ54932.1| chaperonin GroEL [Streptococcus pneumoniae D39]
 gi|147755636|gb|EDK62682.1| chaperonin GroEL [Streptococcus pneumoniae SP11-BS70]
 gi|147760959|gb|EDK67928.1| chaperonin GroEL [Streptococcus pneumoniae SP18-BS74]
 gi|147922208|gb|EDK73329.1| chaperonin GroEL [Streptococcus pneumoniae SP3-BS71]
 gi|147928195|gb|EDK79213.1| chaperonin GroEL [Streptococcus pneumoniae SP9-BS68]
 gi|147929767|gb|EDK80757.1| chaperonin GroEL [Streptococcus pneumoniae SP23-BS72]
 gi|172041934|gb|EDT49980.1| chaperonin GroL [Streptococcus pneumoniae CDC1873-00]
 gi|183569951|gb|EDT90479.1| chaperonin GroL [Streptococcus pneumoniae CDC1087-00]
 gi|183571543|gb|EDT92071.1| chaperonin GroL [Streptococcus pneumoniae SP195]
 gi|183575372|gb|EDT95900.1| chaperonin GroL [Streptococcus pneumoniae CDC3059-06]
 gi|183577599|gb|EDT98127.1| chaperonin GroL [Streptococcus pneumoniae MLV-016]
 gi|194357884|gb|ACF56332.1| chaperonin GroL [Streptococcus pneumoniae G54]
 gi|220675102|emb|CAR69683.1| 60 kDa chaperonin [Streptococcus pneumoniae ATCC 700669]
 gi|225721363|gb|ACO17217.1| chaperonin GroL [Streptococcus pneumoniae 70585]
 gi|225722720|gb|ACO18573.1| chaperonin GroL [Streptococcus pneumoniae JJA]
 gi|225726635|gb|ACO22486.1| chaperonin GroL [Streptococcus pneumoniae Taiwan19F-14]
 gi|298239238|gb|ADI70369.1| chaperonin GroEL [Streptococcus pneumoniae TCH8431/19A]
 gi|301794865|emb|CBW37324.1| 60 kDa chaperonin [Streptococcus pneumoniae INV104]
 gi|301800683|emb|CBW33329.1| 60 kDa chaperonin [Streptococcus pneumoniae OXC141]
 gi|306410063|gb|ADM85490.1| hypothetical protein SPAP_1927 [Streptococcus pneumoniae AP200]
 gi|306485169|gb|ADM92038.1| chaperonin GroL [Streptococcus pneumoniae 670-6B]
 gi|327389070|gb|EGE87416.1| chaperonin GroL [Streptococcus pneumoniae GA04375]
 gi|332071894|gb|EGI82382.1| chaperonin GroL [Streptococcus pneumoniae GA17545]
 gi|332071992|gb|EGI82479.1| chaperonin GroL [Streptococcus pneumoniae GA17570]
 gi|332072249|gb|EGI82733.1| chaperonin GroL [Streptococcus pneumoniae GA41301]
 gi|332199225|gb|EGJ13303.1| chaperonin GroL [Streptococcus pneumoniae GA41317]
 gi|332199330|gb|EGJ13407.1| chaperonin GroL [Streptococcus pneumoniae GA47368]
 gi|332199930|gb|EGJ14004.1| chaperonin GroL [Streptococcus pneumoniae GA47901]
          Length = 540

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|13488302|ref|NP_085869.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
 gi|25452871|sp|Q981J9|CH605_RHILO RecName: Full=60 kDa chaperonin 5; AltName: Full=GroEL protein 5;
           AltName: Full=Protein Cpn60 5
 gi|14028118|dbj|BAB54710.1| chaperonin GroEL [Mesorhizobium loti MAFF303099]
          Length = 549

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 311/530 (58%), Positives = 407/530 (76%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQ+I  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VV  L  N KK+ + EE+ QV TI+ NGD  +G  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVADVVATLIKNAKKIKTSEEVAQVGTIAGNGDSSVGSMIAEAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ ++M A++E+ YIL+++KK+S LQ +LPILE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNLQAMLPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+ +PL II+EDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQTSKPLVIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AKKV +SK++TTIV G G    I+GR+ +I++ IE+T SDY
Sbjct: 301 ISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKAEIQGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA+ +++  G N DQ AGI IVR+AL  P RQI  NAG E+ ++  KI E+K A YGYNA
Sbjct: 421 RASLSINAVGANSDQTAGISIVRRALQAPARQIAANAGAEASIVAGKILENKGATYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GDM  MGI+DPVKVVR ALQ A S+AG+++  EA++ +APK E+A
Sbjct: 481 QTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTAEAMIAEAPKKESA 530


>gi|163854178|ref|YP_001642221.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|218533123|ref|YP_002423939.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|254564146|ref|YP_003071241.1| 60 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|163665783|gb|ABY33150.1| chaperonin GroEL [Methylobacterium extorquens PA1]
 gi|218525426|gb|ACK86011.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4]
 gi|254271424|emb|CAX27438.1| 60 kDa chaperonin (protein Cpn60, groEL protein) [Methylobacterium
           extorquens DM4]
          Length = 546

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 311/530 (58%), Positives = 402/530 (75%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADRFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA    V+ + A  KKV S EE+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATAAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQTGKPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AK+V + K+ TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVALPMLGRAKRVRIEKETTTIIDGLGEKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
            A +A++  K D  D  AGI+IV KAL  P RQI  NAG E  ++V KI ++    +G+N
Sbjct: 421 LAKKAVAELKSDIPDVQAGIKIVLKALEAPIRQIASNAGVEGSIVVGKITDNGGETFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           AQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 AQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 530


>gi|319943073|ref|ZP_08017356.1| chaperone GroEL [Lautropia mirabilis ATCC 51599]
 gi|319743615|gb|EFV96019.1| chaperone GroEL [Lautropia mirabilis ATCC 51599]
          Length = 548

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 294/532 (55%), Positives = 398/532 (74%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK +
Sbjct: 1   MAAKQVNFGDEARAKLVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKQANMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  ++E LK   K   + +EI QV TISAN D EIG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVAALIEQLKKQSKPTTTSKEIAQVGTISANSDEEIGQIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+ + E+ VV+GMQ DRGY+SPYF+ + +R  A +E+P+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 KSLSNELDVVEGMQFDRGYLSPYFINNPDRQVAVLESPFILLCDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL I+AED+EG+ALATLVVN +R  L  +AVKAP FGDRRK +L D+A + G  V
Sbjct: 241 AKASRPLLIVAEDIEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDMAILTGGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE G+ LEKATI +LGSA +V ++K++TTI+ G+G ++ IE R+  I+  IE+  SDY
Sbjct: 301 ISEETGMSLEKATIEELGSAARVEVAKENTTIIDGSGDAKAIENRVKAIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EG+VPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA  A  ++G N DQ AGI+IV +A+  P RQI+ NAG+E+ +IV+K+ E K  N+GYNA
Sbjct: 421 RAKAAAKIEGSNPDQEAGIKIVLRAVEEPLRQIVTNAGEEASVIVAKVAEGK-GNFGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
               +GD+ EMG++DP KV R ALQ+A S+AG++L T+A++ +AP+D+ ASP
Sbjct: 480 ANGEYGDLVEMGVVDPTKVTRTALQNAASIAGLLLTTDALISEAPEDKPASP 531


>gi|325688541|gb|EGD30558.1| chaperone GroEL [Streptococcus sanguinis SK72]
 gi|325697789|gb|EGD39673.1| chaperone GroEL [Streptococcus sanguinis SK160]
          Length = 540

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|23098111|ref|NP_691577.1| chaperonin GroEL [Oceanobacillus iheyensis HTE831]
 gi|29839305|sp|Q8CXL3|CH60_OCEIH RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|22776336|dbj|BAC12612.1| class I heat shock protein (chaperonin) [Oceanobacillus iheyensis
           HTE831]
          Length = 545

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/526 (51%), Positives = 373/526 (70%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+K    AR A+  GV+TLA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDLKFSEDARRAMLRGVDTLADAVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VT+G NP+ I+RGI+
Sbjct: 61  LEDAFENMGAQLVSEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTSGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  V+ LK   + + S+E I Q+A +S+  D E+G+ IA AME++G  G+ITI+++K
Sbjct: 121 KAVELAVQELKGISQPIESKEAISQIAAVSSG-DEEVGQLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY SPY VT  ++M A +E+PYILI DKKI  +Q +LP+LE   
Sbjct: 180 GFNTELEVVEGMQFDRGYASPYMVTDQDKMEAVLEDPYILITDKKIGNIQEVLPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + GA VI
Sbjct: 240 QQGKPLLMIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGAEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ A+I  LG A KVV++K++TT+V G+G  E I  R+ +I+   E++ SD+D
Sbjct: 300 TEDLGLDLKSASIDQLGRASKVVVTKENTTVVEGSGDPEAISSRVAQIRAQAEESTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRA  +EG+VPGGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAGVEEGMVPGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + +S      D+  G  IV +AL  P RQI+ NAG E  +IV +++  +    GYNA 
Sbjct: 420 IHRQVSELTLEGDEATGASIVLRALEEPVRQIVHNAGLEGSIIVERLK-GEKVGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++
Sbjct: 479 TDEWVNMVEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEE 524


>gi|323353583|ref|ZP_08088116.1| chaperone GroEL [Streptococcus sanguinis VMC66]
 gi|322121529|gb|EFX93292.1| chaperone GroEL [Streptococcus sanguinis VMC66]
 gi|324992270|gb|EGC24192.1| chaperone GroEL [Streptococcus sanguinis SK405]
 gi|325689547|gb|EGD31552.1| chaperone GroEL [Streptococcus sanguinis SK115]
 gi|325693866|gb|EGD35785.1| chaperone GroEL [Streptococcus sanguinis SK150]
 gi|327473041|gb|EGF18468.1| chaperone GroEL [Streptococcus sanguinis SK408]
 gi|327490823|gb|EGF22604.1| chaperone GroEL [Streptococcus sanguinis SK1058]
 gi|328945366|gb|EGG39519.1| chaperone GroEL [Streptococcus sanguinis SK1087]
 gi|332358549|gb|EGJ36373.1| chaperone GroEL [Streptococcus sanguinis SK1056]
          Length = 540

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|261365720|ref|ZP_05978603.1| chaperonin GroL [Neisseria mucosa ATCC 25996]
 gi|288565742|gb|EFC87302.1| chaperonin GroL [Neisseria mucosa ATCC 25996]
          Length = 544

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 292/533 (54%), Positives = 394/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVNTLA AV+ TLGPKGR V++  +FG P +TKDGVTVAK I
Sbjct: 1   MAAKDVQFGNEVRQKMVSGVNTLANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYVTAG+NP D+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQAIVAEGMKYVTAGMNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D ++G  IA AME++G  G+IT++  
Sbjct: 121 DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++TTI+ G G + +IE R+ EI++ IE   SDY
Sbjct: 301 IAEEVGLSLEKATLEDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +   N DQ AG++IV +A+  P RQI+ NAG E  ++V+K+ E K  NYGYN
Sbjct: 421 RARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ + P+++ A P
Sbjct: 480 AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEEKPAMP 532


>gi|294497086|ref|YP_003560786.1| 60 kDa chaperonin [Bacillus megaterium QM B1551]
 gi|294347023|gb|ADE67352.1| 60 kDa chaperonin [Bacillus megaterium QM B1551]
          Length = 543

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 278/534 (52%), Positives = 379/534 (70%), Gaps = 3/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  ++ I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKDSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +++PYILI DKKI  +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDDPYILITDKKIGNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+D+A + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDVAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A+I  LG A K+V++K++TT+V G G +E I  R+N+I+  +E+T S++D
Sbjct: 300 TEELGLDLKTASIDQLGRASKIVVTKENTTVVNGAGNAEDILARVNQIKAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++    + D   GI IV +A+  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 IYNKVASIEADGDTATGINIVLRAIEEPVRQIAHNAGLEGSVIVERLK-GEAVGTGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M + GI+DP KV R+ALQ+A S+A M L TEAVV D P+ E A+P MP
Sbjct: 479 TGEWVNMLDTGIVDPTKVTRSALQNASSVAAMFLTTEAVVADKPE-ENAAPAMP 531


>gi|154250218|ref|YP_001411043.1| chaperonin GroEL [Fervidobacterium nodosum Rt17-B1]
 gi|171769400|sp|A7HNA3|CH60_FERNB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|154154154|gb|ABS61386.1| chaperonin GroEL [Fervidobacterium nodosum Rt17-B1]
          Length = 538

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 274/537 (51%), Positives = 374/537 (69%), Gaps = 4/537 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK ++    AR ++  GV+ +A AVK TLGPKGR V+I  S+G+P +T DGV++AK I 
Sbjct: 1   MAKLLRYSEEARRSLEAGVDAVANAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VA+ T D +GDGTTTAT LAQA+  EG K V AG NP+ IK+GID
Sbjct: 61  LEDKFANLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKMVAAGANPILIKKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A  +VVE +K   KK+ S E+I  VA+ISAN   EIG+ IA AME++G  G+IT++ +K
Sbjct: 121 KATSKVVEEIKKISKKLSSTEDIAHVASISAN-SEEIGKLIAEAMEKVGEDGVITVEDSK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T V   +GMQ DRGYISPYFVT  E+M      P+ILI D+K+S ++PL+PILE   
Sbjct: 180 TIDTYVEFTEGMQFDRGYISPYFVTDPEKMEVVYNEPFILITDRKLSNVKPLIPILEKVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+GRPL IIAEDVEG+ L TLV+N+++  L  +AVKAP FGDRRK +L+DIA + G  V 
Sbjct: 240 QTGRPLVIIAEDVEGEVLTTLVLNKLKGTLNTVAVKAPGFGDRRKAMLQDIAILTGGIVA 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ LE  T+ DLG A  V + KD+T IVGG G  E I+ R+ +I+  IE T S+Y+
Sbjct: 300 SEEVGINLEDLTLQDLGRADVVRVKKDETIIVGGKGKPEEIKKRVAQIKAQIEQTTSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++ L+ER+AKLAGGVAV++VG  TE  L EKK R +D+L ATRAA +EGIVPGGGI L+R
Sbjct: 360 KETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGITLLR 419

Query: 422 AAQALS--VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A + L   +     D+  G +IV  AL  P RQI  NAG +  +I+  +       YG++
Sbjct: 420 ARKVLEPVLNELTGDEKLGAQIVYNALEAPIRQIALNAGYDGAIIIHNVLSKDDVAYGFD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD-ETASPQMP 535
           A K  + +M+E GIIDP KV R+ALQ+A S+AGM+L TE +VV+ P++ + A+P+MP
Sbjct: 480 ALKGEYCNMYERGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKPAAPEMP 536


>gi|39934215|ref|NP_946491.1| chaperonin GroEL [Rhodopseudomonas palustris CGA009]
 gi|42558893|sp|P60364|CH601_RHOPA RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|39648063|emb|CAE26583.1| chaperonin GroEL1, cpn60 [Rhodopseudomonas palustris CGA009]
          Length = 547

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 306/527 (58%), Positives = 397/527 (75%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    ARD +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK +
Sbjct: 1   MAAKDVKFSGDARDRMLRGVDVLANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           ++AV  VV+ ++   K V S  EI QV TISANGD  IG+ IA AM+++G  G+IT+++ 
Sbjct: 121 EIAVAAVVKDIQKRAKPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+  TEV +V+GM+ DRGY+SPYFVT+ E+MT E+++ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDDAYILLHEKKLSGLQSMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVNR+R GL V AVKAP FGDRRK +L DIA + G  +
Sbjct: 241 VQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQL 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG AKKVV+ K++TTIV G G    IE R+++I+  IE+T SDY
Sbjct: 301 ISEDLGIKLETVTLKMLGRAKKVVIDKENTTIVNGAGKKPEIEARVSQIKAQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR +D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  DN D  AGI IV KAL  P RQI +NAG E  ++V KI E+KT  +G++
Sbjct: 421 RAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   + DM   GI+DP KVVR ALQ A S+A +++ TEA+V + PK
Sbjct: 481 AQTEEYVDMLAKGIVDPAKVVRTALQDASSVASLLVTTEAMVAELPK 527


>gi|296271249|ref|YP_003653881.1| chaperonin GroEL [Thermobispora bispora DSM 43833]
 gi|296094036|gb|ADG89988.1| chaperonin GroEL [Thermobispora bispora DSM 43833]
          Length = 539

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 280/550 (50%), Positives = 379/550 (68%), Gaps = 12/550 (2%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MAAKMIAFDEDARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NPM +KRGI
Sbjct: 61  ELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMALKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ V E L    K+V ++E+I   A+ISA     IG+ IA AM+++G  G+IT++++
Sbjct: 121 EAAVERVSEELSKLAKEVETKEQIASTASISAGDAE-IGQLIAEAMDKVGKEGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            T   E+ + +GM+ D+GY+S YFVT  ERM A  E+PYILI + K+SA + LLP+L+  
Sbjct: 180 NTFGLELELTEGMRFDKGYVSGYFVTDPERMEAVFEDPYILIVNAKVSANKDLLPLLDKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+DIA + G  V
Sbjct: 240 VQAGKPLVIIAEDVEGEALATLVVNKIRGLFKSVAVKAPGFGDRRKAMLQDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GLKLE AT+  LG A+KVV++KD+TTIV G G  E I GR+NEI+  IE T SDY
Sbjct: 300 ISEEVGLKLENATLDLLGRARKVVVTKDETTIVDGAGDPEAIAGRVNEIRAEIERTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++ G  TE  L E+K R +D++   +AA +EGIVPGGG+AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVPGGGVALL 419

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A A+A      + D+  G  IVRKAL  P +QI  NAG E  ++V K++      +G N
Sbjct: 420 QAGAKAFDKLELSGDEATGAAIVRKALEEPLKQIAINAGLEGGVVVEKVRSL-PPGHGLN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + DMFE GIIDP KV R+ALQ+A S+AG+ L TEAV+ + P+ E A+   P    
Sbjct: 479 AATGEYVDMFEAGIIDPAKVTRSALQNAASIAGLFLTTEAVIAEKPEKEKAN-ATPG--- 534

Query: 540 MGGGMGGMDM 549
                G MD 
Sbjct: 535 -----GDMDF 539


>gi|171319825|ref|ZP_02908908.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
 gi|171094920|gb|EDT39949.1| chaperonin GroEL [Burkholderia ambifaria MEX-5]
          Length = 546

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 296/528 (56%), Positives = 397/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDVARTKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   V+ LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+ENPYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+    + N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKV-AEGSGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|325133431|gb|EGC56095.1| chaperonin GroL [Neisseria meningitidis M13399]
          Length = 544

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/533 (54%), Positives = 393/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVN LA AV+ TLGPKGR V++  +FG P +TKDGVTVAK I
Sbjct: 1   MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG KYVTAG+NP D+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D ++G  IA AME++G  G+IT++  
Sbjct: 121 DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKAT+ DLG AK++ + K++TTI+ G G + +IEGR+ EI++ IE   SDY
Sbjct: 301 ISEEVGLSLEKATLEDLGQAKRIEIGKENTTIIDGFGDAAQIEGRVAEIRQQIEVATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +   N DQ AG++IV +A+  P RQI+ NAG E  ++V+K+ E K  NYGYN
Sbjct: 421 RARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ + P+D+ A P
Sbjct: 480 AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEDKPAMP 532


>gi|262199739|ref|YP_003270948.1| chaperonin GroEL [Haliangium ochraceum DSM 14365]
 gi|262083086|gb|ACY19055.1| chaperonin GroEL [Haliangium ochraceum DSM 14365]
          Length = 554

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 289/532 (54%), Positives = 388/532 (72%), Gaps = 1/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K+I     AR+ +  GV+TLA AVK TLGP+GR V+I  S+GAP VTKDGVTVAK I
Sbjct: 1   MAGKEIIFEENARNKVMRGVDTLANAVKVTLGPRGRNVVIEKSWGAPTVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             +N F  +GA+M+++VA+ T D++GDGTTTAT LAQAI+ EG K V AG NPM+IKRGI
Sbjct: 61  ELENKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQAIFREGSKLVAAGHNPMEIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ +V  L          +EI QV TISANGD  IG+ IA AME++G  G+IT++++
Sbjct: 121 DAAVESIVASLGELATSTKDHKEIAQVGTISANGDATIGDMIAEAMEKVGKEGVITVEES 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT  +E+ VV+GMQ DRGY+SPYFVT +ERM   +E+  +LI++KKIS ++ LLP+LE  
Sbjct: 181 KTMQSELDVVEGMQFDRGYLSPYFVTDSERMEVVLEDALVLIHEKKISNMKDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            + GRPL I+AEDV+G+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIA + G T 
Sbjct: 241 AKQGRPLLIVAEDVDGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIAVLTGGTA 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           +++++GLKLE  T+ DLG AK+V + KD+TTIV G G  E I+ R+ +I+  +E+T SDY
Sbjct: 301 VTDDLGLKLENITVNDLGIAKRVTVDKDNTTIVDGAGKKEDIDARVKQIRIQVEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKK R +D++ ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLVGGVAVIRVGAATEVEMKEKKARVEDAMHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R  + L      E+Q  G+ IVR+AL  P RQI  NAG +  ++V K++  + A +G+NA
Sbjct: 421 RCLKGLDSLNLGEEQKFGVSIVRRALEEPLRQISANAGSDGSIVVEKVKNGEGA-FGFNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
            K  F D+ + G+IDP KVVR ALQ+A S++G++L TEA++ + PK ETA  
Sbjct: 480 AKGEFEDLLKAGVIDPAKVVRTALQNAASVSGLLLTTEALIAEKPKKETAPA 531


>gi|315222108|ref|ZP_07864018.1| chaperonin GroL [Streptococcus anginosus F0211]
 gi|315188858|gb|EFU22563.1| chaperonin GroL [Streptococcus anginosus F0211]
          Length = 540

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 375/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG N + I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANSIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKAN   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 TAVATAVEALKANSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A+++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A KV + KD T IV G+G +E I  R+  I+  IE   S++D
Sbjct: 300 TEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGAAEAIANRVAVIKSQIESATSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A V 
Sbjct: 360 KEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A+     + D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLNAVEALDLSGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV   P+  + +P M     MG
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVASQPEPASPTPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|188584508|ref|YP_001927953.1| chaperonin GroEL [Methylobacterium populi BJ001]
 gi|226704150|sp|B1ZAU5|CH60_METPB RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|179348006|gb|ACB83418.1| chaperonin GroEL [Methylobacterium populi BJ001]
          Length = 546

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 313/531 (58%), Positives = 406/531 (76%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKFVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA Q  V+ + A  KKV S EE+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATQAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M AE+E+PYILI++KK+S+LQP+LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +     
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQT 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE   +  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLENVALPMLGRAKRVRIEKENTTIIDGLGEKADIEARVGQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           RA +A++  K D  D  AGI+IV KAL  P RQI +NAG E  ++V KI ++  +  YG+
Sbjct: 421 RAKKAVAELKSDVPDVQAGIKIVLKALEAPIRQIAQNAGVEGSIVVGKITDNTGSETYGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           NAQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 NAQTEEYVDMIQSGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 531


>gi|259047439|ref|ZP_05737840.1| chaperonin GroEL [Granulicatella adiacens ATCC 49175]
 gi|259035630|gb|EEW36885.1| chaperonin GroEL [Granulicatella adiacens ATCC 49175]
          Length = 539

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 278/546 (50%), Positives = 373/546 (68%), Gaps = 7/546 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
             KDIK    AR A+  GV+ LA  VK TLGPKGR V++  +FG+P +T DGVT+AK I 
Sbjct: 1   MVKDIKFAEDARSAMLRGVDVLANTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPVGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
           LA +  VE L    + V S+E I QVA IS+     +GE IA AME++G  G+ITI+++K
Sbjct: 121 LATKAAVEELHRISRPVESKEAIAQVAAISSGSAE-VGELIAEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  ++M A ++NP+ILI DKK+S +Q ++P+LE   
Sbjct: 180 GIETELDVVEGMQFDRGYLSQYMVTDNDKMIATLDNPFILITDKKVSNIQEIIPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q GR L IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + GA VI
Sbjct: 240 QQGRALLIIADDVDGEALPTLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGAQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ AT+A LG+A KVV+SKD TTIV G G  + I  R+  I+   +DT SD+D
Sbjct: 300 TEDLGLELKDATLAQLGTAGKVVVSKDSTTIVEGAGSKDLIANRVALIRAQAQDTTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL ERLAKL+GGVAV++VG  TE  L EKK R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLHERLAKLSGGVAVIKVGAATETELKEKKLRIEDALNATRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + +       D   G +IV ++L  P RQI +NAG E  +IV+ ++  +    GYNA 
Sbjct: 420 VQKVVDALELEGDLATGAKIVSRSLEEPLRQIAENAGLEGSVIVACLKSEE-KGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M E GI+DP KV R+ALQ+A S++ ++L TEAVV D P     +P  P   GM 
Sbjct: 479 TDEWVNMIEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKP-----APVAPPMPGMD 533

Query: 542 GGMGGM 547
            GMG M
Sbjct: 534 PGMGMM 539


>gi|260892086|ref|YP_003238183.1| chaperonin GroEL [Ammonifex degensii KC4]
 gi|260864227|gb|ACX51333.1| chaperonin GroEL [Ammonifex degensii KC4]
          Length = 539

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 291/545 (53%), Positives = 383/545 (70%), Gaps = 8/545 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MA K I     AR AI  GVN +A+A+K TLGP+GR V++   FG+P++  DGVT+A+ I
Sbjct: 1   MAGKQILFREDARAAIERGVNAVADAIKVTLGPRGRNVVLEKKFGSPQIVNDGVTIAREI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA++I++V+T T D +GDGTTTA  LAQAI  EG K VTAG NP+ +KRGI
Sbjct: 61  ELPDPVENLGAQLIKEVSTKTNDVAGDGTTTAALLAQAIVREGMKNVTAGANPIMLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ VVE LK   K V S+E I QVA+ISAN    IG  IA AME++G  G+IT++++
Sbjct: 121 EKAVERVVEELKKIAKPVESKEAIEQVASISANDPE-IGRLIAEAMEKVGKDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K  TT + VV+GM  DRGYISPYF+T  ERM A +E+ YIL+ DKKISA+  +LPILE  
Sbjct: 180 KGITTTLEVVEGMNFDRGYISPYFITDPERMEAVLEDAYILVTDKKISAITDILPILEKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FG+RRK +L+DIA + G  V
Sbjct: 240 LQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVCAVKAPGFGERRKAMLQDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GLKL+KAT+  LG A++V + K++T IVGG G  E I  RI +I+K IE+T S++
Sbjct: 300 ISEELGLKLDKATLEMLGRARQVRVKKEETIIVGGQGNPEDITKRIAQIKKQIEETTSEF 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKLAGGVAV++VG  TE  + EKK R +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 360 DKEKLQERLAKLAGGVAVIQVGAATETEMKEKKLRIEDALNATRAAVEEGIVPGGGTALI 419

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
               AL     D+ D   G+ IVR+AL  P RQI  NAG E  ++V +++ S+    G++
Sbjct: 420 NCIPALDELKFDDPDMQTGVRIVRRALEEPLRQIAVNAGYEGSVVVERVKASE-PGVGFD 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + +M E GIIDPVKV R ALQ+A S+AGM+L TE +V + P+ E        GGG
Sbjct: 479 ALNERYVNMIEAGIIDPVKVTRTALQNAASIAGMILTTECLVAEKPEKEKNK-----GGG 533

Query: 540 MGGGM 544
           M   M
Sbjct: 534 MSPDM 538


>gi|298290627|ref|YP_003692566.1| chaperonin GroEL [Starkeya novella DSM 506]
 gi|296927138|gb|ADH87947.1| chaperonin GroEL [Starkeya novella DSM 506]
          Length = 545

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 307/527 (58%), Positives = 403/527 (76%), Gaps = 1/527 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K    AR+ +  GV+ LA AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKEVKFAGDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRG+
Sbjct: 61  ELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGV 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV E ++ +    KKV + +E+ QV TISANGD  IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVVEAIKDISKRAKKVKNTDEVAQVGTISANGDASIGQMIAGAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M  ++E+P++LI+DKK+S LQP+LP+LE  
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFITNAEKMIVDLEDPFLLIFDKKLSGLQPILPVLEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL I+AEDVEG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 VQSGKPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+KLE   +A LG AKKV++ K+ TT+V G G  + IEGR+ +I++ IE+T SDY
Sbjct: 301 ISEELGIKLESVNLAMLGRAKKVIIEKEKTTLVDGVGKKKDIEGRVAQIKQQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGGIAL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVDDALNATRAAVEEGIVPGGGIALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +  +N D  AGI+IV +AL  P RQI +N+G E  ++V K+ ESK  N+G+N
Sbjct: 421 RAKKAVEKLTSENPDIAAGIKIVLRALEAPIRQIAENSGVEGSIVVGKVLESKDQNFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPK 526
           AQ   F DM   GI+DP KVVR ALQ A S++G+++ TEA++ D PK
Sbjct: 481 AQSEQFVDMIASGIVDPAKVVRTALQDAASVSGLLITTEAMIADLPK 527


>gi|228476476|ref|ZP_04061166.1| chaperonin GroL [Streptococcus salivarius SK126]
 gi|228251897|gb|EEK10943.1| chaperonin GroL [Streptococcus salivarius SK126]
          Length = 539

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 281/545 (51%), Positives = 380/545 (69%), Gaps = 7/545 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR A+  GV+TLA+ VK TLGPKGR V++  +FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSSDARAAMVRGVDTLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  + V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 AAVATAVEELKAIAQPVANKEAIAQVAAVSSR-SEKVGEYISEAMERVGNDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A+++NP+IL+ DKKIS +Q +LP+LE   
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLDNPFILVTDKKISNIQDVLPLLEEVL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + GATVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGATVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ AT+A LG A KV + KD T IV G G +E I  R+N I+  +E T S++D
Sbjct: 300 TEDLGLELKDATMAALGQASKVTVDKDSTVIVEGAGSTEAIANRVNLIKSQLETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE AL E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVVKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   G  IV +AL  P RQI  NAG E  +I+ K++ S     G+NA 
Sbjct: 420 VIAKVAELDLEGDDATGRNIVLRALEEPVRQIAYNAGYEGSVIIDKLKNSPVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+     P+ PA   M 
Sbjct: 479 NGEWVDMVEAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPE-----PETPAAPAMD 533

Query: 542 GGMGG 546
            GM G
Sbjct: 534 PGMMG 538


>gi|170746968|ref|YP_001753228.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
 gi|226704151|sp|B1LVA0|CH60_METRJ RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|170653490|gb|ACB22545.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831]
          Length = 546

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 311/531 (58%), Positives = 409/531 (77%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++    ARD +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA Q  V+ + A  KKV + +E+ QV TISANGD+EIGE IA+AM+++G  G+IT+++A
Sbjct: 121 DLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IEGRI++I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGVGEKSDIEGRISQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALL 420

Query: 421 RAAQALSV-KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           RA +A++  K D  D  AGI+IV KAL  P RQI +NAG E  ++V KI ++  +  +G+
Sbjct: 421 RAKKAVAELKSDIPDVQAGIKIVLKALEAPLRQIAQNAGVEGSIVVGKITDNTSSETFGF 480

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
           NAQ   + DM + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK ++
Sbjct: 481 NAQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKDS 531


>gi|220904816|ref|YP_002480128.1| chaperonin GroEL [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|254813884|sp|B8J123|CH60_DESDA RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|219869115|gb|ACL49450.1| chaperonin GroEL [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 549

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 283/536 (52%), Positives = 387/536 (72%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AK+I     AR+ ++ GV+ LA AVK TLGPKGR V I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKEIFFDVKAREKLSRGVDKLANAVKVTLGPKGRNVAIEKSFGAPVITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+++++VA+ T D++GDGTTTAT LAQAIY EG K V AG NPM IKRGI
Sbjct: 61  ELSDKFENMGAQLVKEVASKTSDAAGDGTTTATILAQAIYREGVKLVAAGRNPMAIKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ ++  L    K    ++EI Q+ TISAN D  IG  IA AM ++G  G+IT+++A
Sbjct: 121 DKAVEGLITELANLAKPTRDQKEIAQIGTISANSDTTIGNIIAEAMAKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + VV+GM+ DRGY+SPYFVT+ E+M  E++NPYIL  +KKIS+++ +LP+LE  
Sbjct: 181 KGLETTMDVVEGMRFDRGYLSPYFVTNPEKMVCEMDNPYILCTEKKISSMKDMLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +  RPL IIAEDVEG+ALATLVVN++R  L V+AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKVNRPLMIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGDRRKAMLQDIAVLTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
            S++ G KLE  T+A+LG+AK++V+ K++TT+V G G SE I+ R+ +I+  IED+ SDY
Sbjct: 301 ASDDTGSKLENMTLAELGTAKRIVIDKENTTVVDGAGKSEDIKARVKQIRAQIEDSTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKL GGVAV+ VG  TE  + EKKDR +D+L+ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLVGGVAVVHVGAATEVEMKEKKDRVEDALNATRAAVEEGIVPGGGTALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R A+ L  +K  ++D+ AG+ I+R+A+  P RQI  NAG E  ++V K++E K   +G+N
Sbjct: 421 RVAKVLCDIKPADDDELAGVNIIRRAIEEPLRQIALNAGFEGSIVVEKVREGKD-GFGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    + D+ + G+IDP KV R ALQ+A S+A ++L TE  + + P+ +  +  MP
Sbjct: 480 AATGEYEDLIKAGVIDPKKVTRTALQNAASVASLLLTTECAIAEKPEPKKDA-AMP 534


>gi|119897265|ref|YP_932478.1| chaperonin GroEL [Azoarcus sp. BH72]
 gi|187470734|sp|A1K436|CH601_AZOSB RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|119669678|emb|CAL93591.1| chaperonin GroEL [Azoarcus sp. BH72]
          Length = 549

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/531 (55%), Positives = 397/531 (74%), Gaps = 2/531 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVKFGDSARERMVAGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   +E LK   K   + +EI QV +ISAN D +IG  IA AME++G  G+IT++  
Sbjct: 121 DKAVVATIEELKKLSKPCSTNKEIAQVGSISANSDADIGGIIAQAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + ++  A +ENP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLNNELDVVEGMQFDRGYLSPYFINNPDKQVAILENPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDV+G+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++T I+ G G + RIE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLQDLGQAKRIEIGKENTIIIDGAGEASRIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  +L+ +KGDN DQ AGI+IV +A+  P R+I+ NAGDE+ ++V+K+ E  + N+GYN
Sbjct: 421 RARASLAGLKGDNHDQDAGIKIVLRAMEQPLREIVANAGDEASVVVNKVVEG-SGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           A    +GDM EMG++DP KV R ALQ+A S+A +ML T+ +V +  +D+ A
Sbjct: 480 AATGEYGDMVEMGVLDPTKVTRTALQNAASVASLMLTTDCMVGELAEDKPA 530


>gi|332995638|gb|AEF05693.1| chaperonin GroEL [Alteromonas sp. SN2]
          Length = 546

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 305/536 (56%), Positives = 399/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+++ G  AR  +  GVNTLA AVK TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVRFGNDARTKMLKGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+   D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIITEGHKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LKA        + I QV TISAN D E+G+ IA AME++G  G+IT+++ 
Sbjct: 121 DKAVIAAVEELKALSTDCADSKSIAQVGTISANSDAEVGDIIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +    E+ VV+GMQ DRGY+SPYF+ + E  T E+++P+IL+ DKKIS ++ LLP LE  
Sbjct: 181 QALQNELDVVEGMQFDRGYLSPYFINNQENGTVELDSPFILLVDKKISNIRELLPTLEGV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKAGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIGL LEK  + DLG+AK+VV++KD+TTIV GNG  E IEGR  +I+  IED+ SDY
Sbjct: 301 ISEEIGLDLEKVELEDLGTAKRVVINKDNTTIVDGNGDEEAIEGRCAQIKGQIEDSSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ERLAKL+GGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+VPGGG+ALV
Sbjct: 361 DKEKLQERLAKLSGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVPGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RAA  L S+ G+NEDQ  GI++  +A+  P RQI  NAG E+ ++V++++     NYGYN
Sbjct: 421 RAAAKLASLTGENEDQTVGIKLALRAMEAPLRQIASNAGAEASVVVNEVKNG-DGNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R+ALQ A S+A +M+ TEA++ D P+DE A+P MP
Sbjct: 480 AGNDTYGDMLEMGILDPTKVTRSALQFAASIASLMITTEAMIADIPQDE-AAPAMP 534


>gi|324990435|gb|EGC22373.1| chaperone GroEL [Streptococcus sanguinis SK353]
 gi|327466987|gb|EGF12501.1| chaperone GroEL [Streptococcus sanguinis SK330]
          Length = 540

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEGTGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEAGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|307710376|ref|ZP_07646816.1| chaperonin GroL [Streptococcus mitis SK564]
 gi|307618853|gb|EFN97989.1| chaperonin GroL [Streptococcus mitis SK564]
          Length = 540

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVADLELTGDESTGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAELGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|295702451|ref|YP_003595526.1| 60 kDa chaperonin [Bacillus megaterium DSM 319]
 gi|294800110|gb|ADF37176.1| 60 kDa chaperonin [Bacillus megaterium DSM 319]
          Length = 543

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 277/534 (51%), Positives = 378/534 (70%), Gaps = 3/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  ++ I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKDSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +++PYILI DKKI  +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDDPYILITDKKIGNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+D+A + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDVAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A+I  LG A K+V++K++TT+V G G +E I  R+N+I+  +E+T S++D
Sbjct: 300 TEELGLDLKTASIDQLGRASKIVVTKENTTVVNGAGNAEDILARVNQIKAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++    + D   GI IV +A+  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 IYNKVASIEADGDTATGINIVLRAIEEPVRQIAHNAGLEGSVIVERLK-GEAVGTGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M + GI+DP KV R+ALQ+A S+A M L TEAVV D P+ E  +P MP
Sbjct: 479 TGEWVNMLDTGIVDPTKVTRSALQNASSVAAMFLTTEAVVADKPE-EGGAPAMP 531


>gi|326574803|gb|EGE24737.1| chaperonin GroEL [Moraxella catarrhalis O35E]
          Length = 542

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 293/528 (55%), Positives = 384/528 (72%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+  G+ AR+ +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I 
Sbjct: 1   MAKDVSFGSNAREKMIDGVNILADAVKVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LEDKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILVEGMKTVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE ++A        + I QV +ISAN D  IGE I+ AME +G  G+IT+++  
Sbjct: 121 KAVRAAVEEIRAISTPANDHKAIAQVGSISANSDATIGELISKAMETVGKQGVITVEEGS 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
                + VV+GMQ DRGYISPYF    + +T E +NP+IL+ DKKIS ++ ++P+LE   
Sbjct: 181 GFEDALEVVEGMQFDRGYISPYFANKQDSLTCEFDNPFILLVDKKISNIREIVPLLEKVM 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+ RPL IIAEDVE +ALATLVVN +R GL   AVKAP FGDRRK +L+DIA + G  VI
Sbjct: 241 QTSRPLLIIAEDVENEALATLVVNTLRGGLKTCAVKAPGFGDRRKAMLQDIAILTGGVVI 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL LE A I  LG+AKKV + K++T IV G G    IE R+  I++ +E++ SDYD
Sbjct: 301 SEEVGLSLETAEIEHLGTAKKVTIGKENTVIVDGAGDKASIEARVESIRRQVEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKL+GGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+VPGGG+ALVR
Sbjct: 361 KEKLQERVAKLSGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVPGGGVALVR 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A  ALS +KGDNEDQ AGI I+R+A+  P RQI+ NAGDE+ +IV++++   + NYGYNA
Sbjct: 421 ALSALSDLKGDNEDQNAGINILRRAMEAPLRQIVSNAGDEASVIVNEVKNG-SGNYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
               +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P  E
Sbjct: 480 ASGKYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTEVMITDKPAPE 527


>gi|297563123|ref|YP_003682097.1| chaperonin GroEL [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847571|gb|ADH69591.1| chaperonin GroEL [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 543

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 265/550 (48%), Positives = 371/550 (67%), Gaps = 8/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MAAKLIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NP+ +KRGI
Sbjct: 61  ELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPISLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV  + E L    K + ++E+I   A+ISA    +IGE IA AM+++G  G+IT+++ 
Sbjct: 121 ESAVARINEELGNLSKDIETKEQIASTASISAGDP-QIGETIAEAMDKVGKEGVITVEEG 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +T   E+ + +GM+ D+GYISPYF T  ERM   +E+PYILI + KIS     LP++E  
Sbjct: 180 QTFGLELELAEGMRFDKGYISPYFATDLERMETVLEDPYILIVNSKISNNNEFLPVVEKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL +IAED+EG AL TLVVN++R     +AVKAP FGDRRK  L DIA + G  V
Sbjct: 240 LQAGRPLVVIAEDLEGGALQTLVVNKIRGTFKSVAVKAPGFGDRRKAQLGDIAVLTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE   +  LG A+KVV++KD+TTIV G G +  I GR+NEI+  IE T SDY
Sbjct: 300 ITEEVGLKLESTELDMLGRARKVVVTKDETTIVDGAGDATAIAGRVNEIRNEIERTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLA+LAGGVAV++ G  TE  L E+K R +D++   +AA +EGI+PGGG+AL+
Sbjct: 360 DREKLQERLARLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGILPGGGVALL 419

Query: 421 RAA-QALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A+  A        D+  G +IVR+A++ P +QI  NAG E  ++  K++  +   +G N
Sbjct: 420 QASVPAFEKLELEGDEAIGADIVRRAIAEPLKQIAINAGLEGGVVAEKVKNLE-PGFGLN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+F+ G+IDP KV R+ALQ+A S+AG+ L TEAV+ + P+   A       G 
Sbjct: 479 AATGEYTDLFKDGVIDPTKVTRSALQNAASIAGLFLTTEAVIAEKPEKAAA-----PAGD 533

Query: 540 MGGGMGGMDM 549
             GGMGGMD 
Sbjct: 534 PTGGMGGMDF 543


>gi|194015865|ref|ZP_03054480.1| chaperonin GroL [Bacillus pumilus ATCC 7061]
 gi|194012220|gb|EDW21787.1| chaperonin GroL [Bacillus pumilus ATCC 7061]
          Length = 544

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 269/526 (51%), Positives = 375/526 (71%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  +E L    K +  +E I QVA+ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 EAVKVALEGLHEISKPIEGKESIAQVASISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + G  +I
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGELI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G+G S +I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGDSAQISARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + ++    + D   G+ IV ++L  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYKKVASIEADGDVQTGVNIVLRSLEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
            + + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++
Sbjct: 479 TNEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEE 524


>gi|116691621|ref|YP_837154.1| chaperonin GroEL [Burkholderia cenocepacia HI2424]
 gi|123464467|sp|A0AXY5|CH602_BURCH RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|116649621|gb|ABK10261.1| chaperonin GroEL [Burkholderia cenocepacia HI2424]
          Length = 546

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 296/528 (56%), Positives = 396/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEK T+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKTTLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+    T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKV-AEGTGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|254249098|ref|ZP_04942418.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184]
 gi|124875599|gb|EAY65589.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184]
          Length = 546

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 297/528 (56%), Positives = 397/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVTSAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+    T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKV-AEGTGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|253995801|ref|YP_003047865.1| chaperonin GroEL [Methylotenera mobilis JLW8]
 gi|253982480|gb|ACT47338.1| chaperonin GroEL [Methylotenera mobilis JLW8]
          Length = 546

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 292/532 (54%), Positives = 390/532 (73%), Gaps = 2/532 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVN LA AV+ TLGPKGR V++  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKDVRFGDDVRQKMVAGVNVLANAVRVTLGPKGRNVVLERSFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDIAGDGTTTATVLAQAIIREGMKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+  V  LKA  K   + +EI QV +ISAN D  +G+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVEAAVADLKAQSKPCTTSKEIAQVGSISANSDNSVGQIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
              + E+ VV+GMQ DRGY+SPYF+ + ER  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 SGLSNELDVVEGMQFDRGYLSPYFINNQERQIALMDNPFVLLHDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAEDV+G+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 AKAGRPLLIIAEDVDGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE  T+ DLG AK++ + K++T I+ G G  + I+ RI +I+  IE+  SDY
Sbjct: 301 IAEEVGLKLENVTLEDLGQAKRIEVGKENTIIIDGAGVEDTIKARITQIKTQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGATTEIEMKEKKARVEDALHATRAAVEEGIVAGGGVALI 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+S VKGDN DQ AGI+IV +A+  P RQI +NAG E  ++V+ +   K  NYGYN
Sbjct: 421 RARDAISKVKGDNLDQEAGIKIVLRAVEEPLRQITQNAGVEPSVVVNNVAAGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETAS 531
           A    +GDM EMG++DP KV R+ALQ+A S+AG+ML T+ +V + PKD+  +
Sbjct: 480 AANETYGDMVEMGVLDPTKVTRSALQNAASVAGLMLTTDCMVAELPKDDAPA 531


>gi|298370057|ref|ZP_06981373.1| chaperonin GroL [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281517|gb|EFI23006.1| chaperonin GroL [Neisseria sp. oral taxon 014 str. F0314]
          Length = 544

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 291/533 (54%), Positives = 393/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVNTLA AV+ TLGPKGR V++  SFG P +TKDGVTVAK I
Sbjct: 1   MAAKDVQFGNEVRQKMVNGVNTLANAVRVTLGPKGRNVVLDRSFGGPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NP D+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQAIVAEGMKYVAAGMNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D ++G  IA AME++G  G+IT++  
Sbjct: 121 DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF++  E+  A ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFISDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK++ + K++TTI+ G G + +IE R+ EI++ IE   SDY
Sbjct: 301 IAEEVGLSLEKATLEDLGQAKRIEIGKENTTIIDGFGDATQIEARVAEIRQQIETATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +   N DQ AG++IV +A+  P RQI+ NAG E  ++V+K+ E K  NYGYN
Sbjct: 421 RARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ +  +++ A P
Sbjct: 480 AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEISEEKPAMP 532


>gi|330819915|ref|YP_004348777.1| Chaperonin GroEL2 [Burkholderia gladioli BSR3]
 gi|327371910|gb|AEA63265.1| Chaperonin GroEL2 [Burkholderia gladioli BSR3]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 301/537 (56%), Positives = 398/537 (74%), Gaps = 2/537 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K   +AR  I  GVN LA+AVK TLGPKGR V+I   FGAP +TKDGV+VAK I
Sbjct: 1   MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERGFGAPTITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA++++ VA+ T D +GDGTTTAT LAQAI  EG K+V AG+NPMD+KRGI
Sbjct: 61  ELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  V++ L+   K + + +EI QV +ISAN D  IG+ IA AME++G  G+IT++  
Sbjct: 121 DKAVGAVLDELRKLSKPISTNKEIAQVGSISANSDEAIGKIIADAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A +++  IL++DKKISA++ LLPILE+A
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINDPEKQAAYLDDALILLHDKKISAIRDLLPILEAA 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL I+AED+EG+ALATLVVN +R  L V AVKAP FGDRRK +L DIA + GATV
Sbjct: 241 AKAGKPLLIVAEDIEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE G +LEKAT+ DLG AK+V + K+DT I+ G G ++RIE R+ +I+  IEDT SDY
Sbjct: 301 IAEETGKQLEKATLEDLGRAKRVEIRKEDTIIIDGAGEAKRIEARVKQIRAQIEDTTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L S+KG N +Q AGI+IV +AL  P R I  NAGDE  ++++K+ E K  N+GY+
Sbjct: 421 RARAGLSSLKGANAEQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGK-GNFGYD 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           A    +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKDE A P    
Sbjct: 480 AASGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKDEKAVPATAP 536


>gi|271965918|ref|YP_003340114.1| chaperonin GroEL [Streptosporangium roseum DSM 43021]
 gi|270509093|gb|ACZ87371.1| chaperonin GroEL [Streptosporangium roseum DSM 43021]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 263/541 (48%), Positives = 376/541 (69%), Gaps = 3/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M AK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MTAKMIAFDEDARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NPM +K+GI
Sbjct: 61  ELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMSLKKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV+ V E L    K V ++E+I   A+ISA     IG  IA AM+++G  G+IT++++
Sbjct: 121 EAAVERVSEELSNLAKDVETKEQIASTASISAADPE-IGSLIAEAMDKVGKEGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
            T   E+ + +GM+ D+GYISP F+T  +R+ A ++ PY+L+   K++A + +LP+L+  
Sbjct: 180 NTFGLELELTEGMRFDKGYISPIFITDPDRLEAVLDEPYVLLVSGKVAANREVLPVLDKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPL +IAED+EG+ALATLVVN+++     +AVKAP FGDRRK +L DI  + GA V
Sbjct: 240 VQSGRPLLVIAEDIEGEALATLVVNKMKGLFRSVAVKAPGFGDRRKAMLGDIGILTGAQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++GLKLE  T+  LG A++V+++KD+TTIV G G +E+I GR+N+I+  I++T SDY
Sbjct: 300 ISEDLGLKLESTTLDQLGRARQVIVTKDETTIVDGGGDAEQIAGRVNQIRAEIDNTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV++ G  TE  L E+K R +D++   +AA +EGIVPGGG+AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVPGGGVALL 419

Query: 421 RA-AQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A A+A      + D+  G  IV+KAL  P +QI  NAG E  ++V K++   T   G N
Sbjct: 420 QAGAKAFDKLELSGDEATGAAIVKKALEEPLKQIAVNAGLEGGVVVEKVRNL-TPGEGLN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + +MFE GIIDP KV R+ALQ+A S+A + L TEAV+ + P+   A+P MP GG 
Sbjct: 479 AATGEYVNMFESGIIDPAKVTRSALQNAASIAALFLTTEAVIAEKPEKAGAAPAMPGGGD 538

Query: 540 M 540
           M
Sbjct: 539 M 539


>gi|39095|emb|CAA48331.1| groEL [Agrobacterium tumefaciens str. C58]
          Length = 544

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 314/530 (59%), Positives = 415/530 (78%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++K G +AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I
Sbjct: 1   MAAKEVKPGASAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPPITKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV EVV+ L+A  KK+ + EE+ QV TISANG+R+IG  IA AM+++G  G+IT+++A
Sbjct: 121 DLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYFVT+ E+M A++E+ YIL+++KK+S LQ +LP+LE+ 
Sbjct: 181 KTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL IIAEDVEG+ LATLVVN++R GL + AVKAP FGDRRK +L DIA + G TV
Sbjct: 241 VQTGKPLVIIAEDVEGERLATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG +KKV +SK++TTIV G G    IEGR+ +I+  IE+T SDY
Sbjct: 301 ISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L+ATRAA  EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           R++  ++VKG N+DQ AGI IVRKAL    RQI +NAGDE+ ++V KI +    NYGYNA
Sbjct: 421 RSSTKITVKGVNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
           Q   +GD+  +GI+DPVKVVR ALQ+A S+A +++ TEA++ + PK E+A
Sbjct: 481 QTGEYGDLIALGIVDPVKVVRTALQNAASVASVLITTEAMIAELPKKESA 530


>gi|222530103|ref|YP_002573985.1| chaperonin GroEL [Caldicellulosiruptor bescii DSM 6725]
 gi|312126855|ref|YP_003991729.1| chaperonin groel [Caldicellulosiruptor hydrothermalis 108]
 gi|312621604|ref|YP_004023217.1| chaperonin groel [Caldicellulosiruptor kronotskyensis 2002]
 gi|312792683|ref|YP_004025606.1| chaperonin groel [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876534|ref|ZP_07736517.1| chaperonin GroEL [Caldicellulosiruptor lactoaceticus 6A]
 gi|254813868|sp|B9MLY9|CH60_ANATD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|222456950|gb|ACM61212.1| chaperonin GroEL [Caldicellulosiruptor bescii DSM 6725]
 gi|311776874|gb|ADQ06360.1| chaperonin GroEL [Caldicellulosiruptor hydrothermalis 108]
 gi|311796745|gb|EFR13091.1| chaperonin GroEL [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179823|gb|ADQ39993.1| chaperonin GroEL [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312202071|gb|ADQ45398.1| chaperonin GroEL [Caldicellulosiruptor kronotskyensis 2002]
          Length = 539

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 287/541 (53%), Positives = 377/541 (69%), Gaps = 5/541 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR A+  GVN LA+ VK TLGPKGR V++   FG+P++  DGVT+AK I
Sbjct: 1   MAAKMILFDEEARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+++R+VA+ T D +GDGTTTAT LAQA+  EG K + AG NPM +++GI
Sbjct: 61  ELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRKGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
             AV  VVE ++   KKV  +E+I  VA+ISA  D EIG+ +A AME++   G+IT++++
Sbjct: 121 QKAVDVVVEEIRKMSKKVRGKEDITYVASISAG-DEEIGKLVADAMEKVTNDGVITVEES 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KT  T + +V+GMQ DRGYIS Y VT TERM A +++PYILI DKKIS +Q +LP+LE  
Sbjct: 180 KTTETTLEIVEGMQFDRGYISAYMVTDTERMEAVLDDPYILITDKKISTIQDILPLLEQI 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q GR L IIAEDVEG+ALATLVVN++R  L  +AVKAP FGDRRK +L+DIA + G  V
Sbjct: 240 VQQGRKLLIIAEDVEGEALATLVVNKLRGTLQCVAVKAPGFGDRRKAMLQDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL L +  ++ LG A++V + K++T IV G G    I+ RI  I+K IE+T SD+
Sbjct: 300 ISEELGLDLREVKLSQLGRARQVKVQKENTIIVDGAGDPSEIKARIQSIKKQIEETTSDF 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  L EKK R +D+L AT+AA +EGIVPGGG AL+
Sbjct: 360 DREKLQERLAKLAGGVAVIHVGAATETELKEKKLRIEDALAATKAAVEEGIVPGGGTALI 419

Query: 421 RAAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
            A  AL    +    D+  G  IVRKAL  P RQI +NAG +  +IV+K++ES  A  G+
Sbjct: 420 NAIPALDKLIESLTGDEKTGAMIVRKALEEPLRQIAENAGLDGSVIVNKVKES-PAGVGF 478

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A    F DMFE GI+DP KV R A+Q+A S A M+L TEAVV + P+ E  +P  PA  
Sbjct: 479 DALNERFVDMFEAGIVDPTKVTRTAIQNAASAAAMLLTTEAVVAEKPEKEK-NPPAPAPD 537

Query: 539 G 539
            
Sbjct: 538 M 538


>gi|170740040|ref|YP_001768695.1| chaperonin GroEL [Methylobacterium sp. 4-46]
 gi|168194314|gb|ACA16261.1| chaperonin GroEL [Methylobacterium sp. 4-46]
          Length = 545

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 308/529 (58%), Positives = 407/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++  + AR+ +  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVRFASDAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              + F  +GA+M+R+VA+ T D +GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV  VV+ ++   KKV + EEI QV TISANGD++IG+ IA AM+++G  G+IT+++A
Sbjct: 121 DLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTA TE+ VV+GMQ DRGY+SPYF+T+ E+M AE+E+PYILI++KK+S+LQ +LP+LE+ 
Sbjct: 181 KTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+G+PL I+AED+EG+ALATLVVN++R GL V AVKAP FGDRRK +L DIA +    +
Sbjct: 241 VQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQM 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+E++G+KLE  T+  LG AK+V + K++TTI+ G G    IE R+ +I+  IE+T SDY
Sbjct: 301 IAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGDKADIEARVAQIKAQIEETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVAV+ VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG AL+
Sbjct: 361 DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGIVPGGGAALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA +A+  +K DN D  AGI+IV KAL  P RQI  NAG E  ++V K+ E+ +A +G++
Sbjct: 421 RAREAIKDLKSDNADVQAGIKIVLKALEAPIRQIAANAGVEGSIVVGKVAENGSATFGFD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   + D+ + GI+DP KVVR ALQ A S+AG+++ TEA+V DAPK E
Sbjct: 481 AQNETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVADAPKKE 529


>gi|224477024|ref|YP_002634630.1| chaperonin GroEL [Staphylococcus carnosus subsp. carnosus TM300]
 gi|254813898|sp|B9DMM2|CH60_STACT RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|222421631|emb|CAL28445.1| GroEL protein [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/543 (49%), Positives = 374/543 (68%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR ++  GV+ LA AVK T+GPKGR V++   +GAP +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEDARQSMLRGVDQLANAVKVTIGPKGRNVVLDKEYGAPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +  +GA+++++VA  T + +GDGTTTAT LAQA+  EG K VT+G NP+ +++GID
Sbjct: 61  LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRKGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV E V+ L    +KV ++ EI QV  ISA  D EIG+ I+ AM+++G  G+I+I+++ 
Sbjct: 121 KAVTEAVKSLHEQSQKVENKNEIAQVGAISAA-DEEIGQYISEAMDKVGNDGVISIEESN 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY SPY VT +E+M A++E PYIL+ DKKIS+ Q +LP+LE   
Sbjct: 180 GFNTELEVVEGMQFDRGYQSPYMVTDSEKMEADLERPYILVTDKKISSFQDILPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RP+ IIA++VEGDAL  +V+NR+R     +AVKAP FGDRRK +L DIA + GA  I
Sbjct: 240 QSNRPILIIADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKSMLEDIAILTGAQFI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++G  L+ AT+  LG+A KV ++KD+TTIV G+G    I+ R+ +++  IE+T SD+D
Sbjct: 300 TDDLGYDLKDATVDMLGTANKVEVTKDNTTIVNGDGDKNSIDARVTQLKSQIEETNSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL GGVAV++VG  +E  L E+K R +D+L++TRAA  EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLTGGVAVIKVGAASETELKERKLRIEDALNSTRAAVGEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + +S      D   GI IV KAL  P RQI +NAG E  +IV K++ ++    GYNA 
Sbjct: 420 VYKQVSEIEAEGDVETGINIVLKALEAPVRQIAENAGLEGSIIVEKLKHAE-PGIGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GI+DP KV R+ALQ+A S+A M L TEAVV   P++   +   PA GGM 
Sbjct: 479 TDEWVNMLDAGIVDPTKVTRSALQNAASVAAMFLTTEAVVAKLPEENNDAGG-PAMGGMS 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|16077670|ref|NP_388484.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. 168]
 gi|221308436|ref|ZP_03590283.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. 168]
 gi|221312758|ref|ZP_03594563.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221317681|ref|ZP_03598975.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221321957|ref|ZP_03603251.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. SMY]
 gi|116230|sp|P28598|CH60_BACSU RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60; AltName: Full=Stress
           protein H5
 gi|143027|gb|AAA22503.1| heat shock protein [Bacillus subtilis]
 gi|143063|gb|AAA22531.1| heat shock protein [Bacillus subtilis]
 gi|2521994|dbj|BAA22747.1| chaperonin [Bacillus subtilis]
 gi|2632916|emb|CAB12422.1| chaperonin large subunit [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 544

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 271/526 (51%), Positives = 370/526 (70%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVAVAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   IA LG A KVV++K++TTIV G G +++I  R+ +I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEE 524


>gi|118465277|ref|YP_883834.1| chaperonin GroEL [Mycobacterium avium 104]
 gi|254777145|ref|ZP_05218661.1| chaperonin GroEL [Mycobacterium avium subsp. avium ATCC 25291]
 gi|187470695|sp|A0QLP6|CH602_MYCA1 RecName: Full=60 kDa chaperonin 2; AltName: Full=GroEL protein 2;
           AltName: Full=Protein Cpn60 2
 gi|118166564|gb|ABK67461.1| chaperonin GroL [Mycobacterium avium 104]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 265/548 (48%), Positives = 371/548 (67%), Gaps = 7/548 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I 
Sbjct: 1   MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NP+ +KRGI+
Sbjct: 61  LEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV++V E L  + K+V ++++I   A ISA     IG+ IA AM+++G  G+IT++++ 
Sbjct: 121 KAVEKVTETLLKSAKEVETKDQIAATAAISAGDQ-SIGDLIAEAMDKVGNEGVITVEESN 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T   ++ + +GM+ D+GYIS YFVT  ER  A +E+P+IL+   K+S ++ LLP+LE   
Sbjct: 180 TFGLQLELTEGMRFDKGYISGYFVTDAERQEAVLEDPFILLVSSKVSTVKDLLPLLEKVI 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+AL+TLVVN++R     +AVKAP FGDRRK +L+D+A + G  VI
Sbjct: 240 QAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL LE A I+ LG A+KVV++KD+TTIV G G S+ I GR+ +I+  IE++ SDYD
Sbjct: 300 SEEVGLSLESADISLLGKARKVVVTKDETTIVEGAGDSDAIAGRVAQIRTEIENSDSDYD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++ G  TE  L E+K R +D++   +AA +EGIV GGG+AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLH 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL       D+  G  IVR AL  P +QI  N G E  ++  K++ S     G NA 
Sbjct: 420 AIPALDELKLEGDEATGANIVRVALEAPLKQIAFNGGLEPGVVAEKVRNSPAGT-GLNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + D+ + G+ DPVKV R+ALQ+A S+AG+ L TEAVV D P+   A       G   
Sbjct: 479 TGEYEDLLKAGVADPVKVTRSALQNAASIAGLFLTTEAVVADKPEKAAA-----PAGDPT 533

Query: 542 GGMGGMDM 549
           GGMGGMD 
Sbjct: 534 GGMGGMDF 541


>gi|134095720|ref|YP_001100795.1| chaperonin GroEL [Herminiimonas arsenicoxydans]
 gi|166198467|sp|A4G837|CH60_HERAR RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|133739623|emb|CAL62674.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Herminiimonas
           arsenicoxydans]
          Length = 546

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 291/530 (54%), Positives = 394/530 (74%), Gaps = 1/530 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK++  G AAR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE L    K   + +EI QV  ISAN D  IGE+IA AME++G  G+IT++  
Sbjct: 121 DKAVAATVEQLALIAKPCTTTKEIAQVGAISANSDYSIGERIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ +V+GMQ DRGY+SPYF+ + E+ TA +ENP+IL+ DKKIS ++ LLP+LE  
Sbjct: 181 KSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAED+EG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ++EE+GL LEK T+ +LG AK++ + K++TT++ GNG +  IE R+ +I+  IE+  SDY
Sbjct: 301 VAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAINIEARVKQIRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RA   ++VKGDN DQ AGI IV +A+  P R I++NAG+E+ ++V+K+ E K  N+GYNA
Sbjct: 421 RARANINVKGDNSDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGK-GNFGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
              ++GDM EMG++DP KV R+ALQ+A S+A ++L T+ +V +  +++ A
Sbjct: 480 ANGIYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEEKPA 529


>gi|254509859|ref|ZP_05121926.1| chaperonin GroL [Rhodobacteraceae bacterium KLH11]
 gi|221533570|gb|EEE36558.1| chaperonin GroL [Rhodobacteraceae bacterium KLH11]
          Length = 547

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 304/534 (56%), Positives = 408/534 (76%), Gaps = 1/534 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVN LA+AVK TLGPKGR V++  SFGAPR+TKDGV+VAK +
Sbjct: 1   MAAKDVKFDTDARNRMLAGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEV 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG K V AGLNPMD+KRGI
Sbjct: 61  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVKEGLKQVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +KA  ++V    E+ QV TISANG+ EIG++IA AM+++G  G+IT+++ 
Sbjct: 121 DLATAKVVEGIKAASREVKDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEEN 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++M AE+E+  IL+++KK+S+LQP++P+LE  
Sbjct: 181 KGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELEDCMILLHEKKLSSLQPMVPLLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QS +PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 IQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE++G+KLE  T+  LG+AKKV ++KD+TT+V G G    IE R+ +I+  IE+T SDY
Sbjct: 301 ISEDLGMKLESVTMDMLGTAKKVEITKDETTVVDGAGEKAEIEARVAQIRTQIEETSSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG +TE  + E+KDR  D+L+ATRAA  EG+V GGG+ALV
Sbjct: 361 DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALV 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A +AL S++G N DQ AGI IVRKA+  P RQI +NAG +  ++  K++ES  A +G+N
Sbjct: 421 QAGKALESLEGGNADQNAGINIVRKAIESPLRQIAENAGVDGAVVAGKVRESSDAAFGFN 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQ 533
           AQ   +GDMF  G+IDP KVVR AL+ A S+AG+++ TEA+V D P  E A+P 
Sbjct: 481 AQTEEYGDMFSFGVIDPAKVVRTALEDAASVAGLLVTTEAMVADKPAKEGAAPA 534


>gi|257453400|ref|ZP_05618695.1| chaperonin GroL [Enhydrobacter aerosaccus SK60]
 gi|257449152|gb|EEV24100.1| chaperonin GroL [Enhydrobacter aerosaccus SK60]
          Length = 546

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 292/528 (55%), Positives = 386/528 (73%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKD+K G  AR  +  GVN LA AVK TLGPKGR V+I  SFGAP +TKDGV+VAK I 
Sbjct: 1   MAKDVKFGIDARAKMIDGVNVLANAVKVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
             + F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGID
Sbjct: 61  LDDKFENMGAQLVREVASKTNDVAGDGTTTATVLAQAILQEGMKSVAAGMNPMDLKRGID 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
             V+ VV  + A        + I QV +ISAN D+ IG+ IA AME++G  G+IT+++  
Sbjct: 121 KGVRAVVAQIHAFSTPANDTKAIAQVGSISANSDQTIGDLIAQAMEKVGKEGVITVEEGS 180

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
                + VV+GMQ DRGYISPYF    + +TAE+ENP IL+ DKKIS ++ L+P+LE+  
Sbjct: 181 GFEDTLEVVEGMQFDRGYISPYFANKADTLTAELENPLILLVDKKISNIRELIPLLENVM 240

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           +SG+ L IIAEDVE +ALATLVVN +R GL V AVKAP FGDRRK +L+DIA + G TV+
Sbjct: 241 KSGKALLIIAEDVENEALATLVVNNMRGGLKVCAVKAPGFGDRRKAMLQDIAILTGGTVV 300

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ LE A ++ LG+AKKV + K++T IV G G    I+ R+  I++ +E++ SDYD
Sbjct: 301 SEELGMSLETADLSVLGTAKKVTVGKENTVIVDGAGQKTEIDDRVASIRRQVEESTSDYD 360

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALVR
Sbjct: 361 KEKLQERIAKLAGGVAVIKVGAATETEMKEKKDRVDDALHATRAAVEEGVVAGGGVALVR 420

Query: 422 AAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           A  AL  V GDN+DQ AGI I+R+A+  P RQI+ NAGDE+ ++V++++     NYGYNA
Sbjct: 421 AISALDNVNGDNDDQAAGINILRRAMEAPLRQIVTNAGDEASVVVNQVK-GGQGNYGYNA 479

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
               +GDM EMGI+DP KV R+AL++A S+AG+ML TEA++ D PKD+
Sbjct: 480 ATGEYGDMLEMGILDPAKVTRSALENAASVAGLMLTTEAMITDLPKDD 527


>gi|324994352|gb|EGC26266.1| chaperone GroEL [Streptococcus sanguinis SK678]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/535 (50%), Positives = 372/535 (69%), Gaps = 2/535 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR ++  GV+ LA  VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK+N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI+++K
Sbjct: 121 AAVATAVEALKSNSVPVSNKEAIAQVAAVSSR-SEKVGEYISEAMEKVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE++NPYILI DKKIS +Q +LP+LE+  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL I+A+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           ++++GL+L+ ATI  LG A KV + KD T IV G+G  E I  R+  I+  IE + S++D
Sbjct: 300 TDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAISNRVAVIKSQIESSTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG A + 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ S+    G+NA 
Sbjct: 420 VLDAVAGLELAGDEGTGRNIVLRALEEPVRQIALNAGFEGSIVIDRLKNSEVGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
              + +M E GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+  + +P M  
Sbjct: 479 TGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANQPEPASPAPAMDP 533


>gi|206889461|ref|YP_002248448.1| chaperonin GroL [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226704186|sp|B5YJN3|CH60_THEYD RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|206741399|gb|ACI20456.1| chaperonin GroL [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 311/540 (57%), Positives = 395/540 (73%), Gaps = 2/540 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK +  G AAR +I  GV  L +AVK TLGP+GR V+I   FG+P VTKDGVTVAK I
Sbjct: 1   MAAKQLIFGDAARQSILKGVTLLTDAVKATLGPRGRNVVIERKFGSPNVTKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K  F  +GA+++R+VA+ T D +GDGTTTAT LA AIY EG KYV+AG N MD+KRGI
Sbjct: 61  DLKEPFENMGAQLVREVASKTSDVAGDGTTTATVLAYAIYKEGLKYVSAGANSMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV+ VVE LK   K V  ++EI QV TISAN D  IGE IA AM+++G  G+IT+++A
Sbjct: 121 DKAVEAVVEELKKISKPVVDKKEIAQVGTISANNDVSIGELIAEAMDKVGKDGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   T + +V+GMQ DRGYISPYF+T  ER+   +E+ ++LI+DKKIS ++ LLPILE  
Sbjct: 181 KGMATTLDIVEGMQFDRGYISPYFITDPERLECILEDAFVLIHDKKISTMKDLLPILEQI 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            + GRPL IIAEDVEG+ALATLVVN++R  L V AVKAP FG+RRK +L DIA + G TV
Sbjct: 241 ARMGRPLLIIAEDVEGEALATLVVNKLRGVLQVCAVKAPGFGERRKAMLEDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISE+IGLKLE   + DLG AKK+++ KD+TTIV G G  ++I+ RI +I+  I++T SDY
Sbjct: 301 ISEDIGLKLENVKVEDLGKAKKIIIDKDNTTIVEGAGDPQKIQARIKQIKVQIDETTSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLAKLAGGVA + VG  TEA + EKK R +D+L+ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERLAKLAGGVARINVGAATEAEMKEKKARVEDALNATRAAVEEGIVPGGGVALL 420

Query: 421 RAAQALSVKG-DNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  +AL     +N DQ  G EIV+KAL  P +QII NAG E+ LIV K++E+K  NYGY+
Sbjct: 421 RCQKALEKIKFENHDQQLGAEIVKKALEEPIKQIIANAGVEATLIVEKVKENKNINYGYD 480

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    F DM E GIIDP KV R ALQ+A S+AG+ML TE +V + P++E   P MP+   
Sbjct: 481 AYAEKFVDMMEAGIIDPTKVTRTALQNAASVAGLMLTTEVLVAEIPEEEKK-PPMPSPDM 539


>gi|72160632|ref|YP_288289.1| chaperonin GroEL [Thermobifida fusca YX]
 gi|119366195|sp|Q47TE8|CH601_THEFY RecName: Full=60 kDa chaperonin 1; AltName: Full=GroEL protein 1;
           AltName: Full=Protein Cpn60 1
 gi|71914364|gb|AAZ54266.1| chaperonin Cpn60/TCP-1 [Thermobifida fusca YX]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/550 (48%), Positives = 373/550 (67%), Gaps = 10/550 (1%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR  +  G+N LA+AVK TLGPKGR V++   +GAP +T DGV++AK I
Sbjct: 1   MAAKLIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NP+ +KRGI
Sbjct: 61  ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPIGLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  + E L    K+V ++E+I   A+ISA    +IGE IA AM+++G  G+IT+++ 
Sbjct: 121 DAAVARISEELANLSKEVETKEQIASTASISAGDP-QIGEYIAEAMDKVGKEGVITVEEG 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           +T   E+ + +GM+ D+GYISPYF T  ERM   +E+PYILI ++KIS     LP++E  
Sbjct: 180 QTFGLELELAEGMRFDKGYISPYFATDLERMETVLEDPYILIANQKISNNNEFLPVIEKV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            Q+GRPL +IAEDVEG AL TLVVN++R     +A+KAP FGDRRK +L+DIA + G  V
Sbjct: 240 LQAGRPLVVIAEDVEGTALQTLVVNKIRGTFKSVAIKAPGFGDRRKAMLQDIAILTGGQV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GLKLE   +  LG A+KVV++KD+TTIV G G +  I GR+NEI+  IE T SDY
Sbjct: 300 ITEEVGLKLENTELDMLGRARKVVVTKDETTIVDGAGDASAIAGRVNEIRAEIERTDSDY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ERLA+LAGGVAV++ G  TE  L E+K R +D++   +AA +EGI+PGGG+AL+
Sbjct: 360 DREKLQERLARLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGILPGGGVALL 419

Query: 421 RAA-QALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +A+  A        D+  G  IVR+A+  P +QI  NAG E  ++V K++  +    G N
Sbjct: 420 QASIAAFEKLELEGDEAIGASIVRRAVEEPLKQIAINAGYEGGVVVEKVKSLE-PGIGLN 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + D+F+ G+IDP KV R+ALQ+A S+AG+ L TEAV+ + P+        PA   
Sbjct: 479 AATGEYTDLFKDGVIDPTKVTRSALQNAASIAGLFLTTEAVIAEKPEK-------PAANN 531

Query: 540 MGGGMGGMDM 549
            GG MGGMD 
Sbjct: 532 AGGDMGGMDF 541


>gi|7144497|gb|AAA99670.2| PTB65K [Mycobacterium avium subsp. paratuberculosis]
          Length = 582

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 262/548 (47%), Positives = 371/548 (67%), Gaps = 7/548 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK I     AR  +  G+N LA+AVK TLGPKGR V++   +G+P +T DGV++AK I 
Sbjct: 42  MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGSPTITNDGVSIAKEIE 101

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ + ++GA ++++VA  T+D +GDGTTTAT LAQA+  EG + V AG NP+ +KRGI+
Sbjct: 102 LEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIE 161

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV++V E L  + K+V ++++I   A ISA     IG+ IA AM+++G  G+IT++++ 
Sbjct: 162 KAVEKVTETLLKSAKEVETKDQIAATAAISAGDQ-SIGDLIAEAMDKVGNEGVITVEESN 220

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T   ++ + +GM+ D+GYIS YFVT  ER  A +E+P+IL+   K+S ++ LLP+LE   
Sbjct: 221 TFGLQLELTEGMRFDKGYISGYFVTDAERQEAVLEDPFILLVSSKVSTVKDLLPLLEKVI 280

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+AL+TLVVN++R     +AVKAP FGDRRK +L+D+A + G  VI
Sbjct: 281 QAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVI 340

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+GL LE A I+ LG A+KVV++KD+TTIV G G S+ I GR+ +I+  IE++ SDYD
Sbjct: 341 SEEVGLSLESADISLLGKARKVVVTKDETTIVEGAGDSDAIAGRVAQIRTEIENSDSDYD 400

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++ G  TE  L E+K R +D++   +AA +EGIV GGG+AL+ 
Sbjct: 401 REKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLH 460

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
           A  AL       ++  G  IVR AL  P +QI  N G E  ++  K++ S     G NA 
Sbjct: 461 AIPALDELKLEGEEATGANIVRVALERPLKQIAFNGGLEPGVVAEKVRNSPAGT-GLNAA 519

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + D+ + GI +PVKV R+ALQ+A S++G+ L TEAVV D P+        P  G   
Sbjct: 520 TGKYEDLLKAGITEPVKVTRSALQNAASISGLFLTTEAVVADKPEKT-----APPAGDPT 574

Query: 542 GGMGGMDM 549
           GGMGGMD 
Sbjct: 575 GGMGGMDF 582


>gi|120609639|ref|YP_969317.1| chaperonin GroEL [Acidovorax citrulli AAC00-1]
 gi|166198427|sp|A1TKQ5|CH60_ACIAC RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|120588103|gb|ABM31543.1| chaperonin GroEL [Acidovorax citrulli AAC00-1]
          Length = 545

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 298/536 (55%), Positives = 395/536 (73%), Gaps = 2/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G  AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG KYV AGLNPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +V  LK   K   + +EI QV +ISAN D  IG+ IA AM+++G  G+IT++  
Sbjct: 121 DKAVTALVAELKKASKATTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+  A ++NP++L++DKKIS ++ LLP LE  
Sbjct: 181 KSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNPFVLLFDKKISNIRDLLPTLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL IIAE+VEG+ALATLVVN +R  L V+AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIIAEEVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEK T+ADLG AK++ + K++TTI+ G G +  IE R+ +I+  IE+  SDY
Sbjct: 301 IAEEVGLTLEKVTLADLGQAKRIEVGKENTTIIDGAGAAADIEARVKQIRIQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA QA   +KGDN DQ AGI+++ KA+  P R+I+ NAG E  ++V+ +   K  NYG+N
Sbjct: 421 RAKQAAGDIKGDNPDQDAGIKLILKAIEAPLREIVANAGGEPSVVVNAVLNGK-GNYGFN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
           A    +GDM EMGI+DP KV R ALQ+A S+A ++L TEA+V +APKD+  +P MP
Sbjct: 480 AANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMVAEAPKDDAPAPAMP 535


>gi|149012507|ref|ZP_01833538.1| chaperonin GroEL [Streptococcus pneumoniae SP19-BS75]
 gi|225857494|ref|YP_002739005.1| chaperonin GroEL [Streptococcus pneumoniae P1031]
 gi|254813904|sp|C1CML7|CH60_STRZP RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|147763563|gb|EDK70499.1| chaperonin GroEL [Streptococcus pneumoniae SP19-BS75]
 gi|225725100|gb|ACO20952.1| chaperonin GroL [Streptococcus pneumoniae P1031]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNAIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEVTGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|321314258|ref|YP_004206545.1| chaperonin GroEL [Bacillus subtilis BSn5]
 gi|291483040|dbj|BAI84115.1| chaperonin GroEL [Bacillus subtilis subsp. natto BEST195]
 gi|320020532|gb|ADV95518.1| chaperonin GroEL [Bacillus subtilis BSn5]
          Length = 543

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 271/528 (51%), Positives = 370/528 (70%), Gaps = 2/528 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   +E LK   K +  +E I QVA ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 QAVAVAIENLKEISKPIEGKESIAQVAAISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DIA + G  VI
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   IA LG A KVV++K++TTIV G G +++I  R+ +I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++      D   GI IV +AL  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET 529
              + +M E GI+DP KV R+ALQ+A S+A M L TEAVV D P++  
Sbjct: 479 TGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENA 526


>gi|325478255|gb|EGC81374.1| chaperonin GroL [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/548 (48%), Positives = 387/548 (70%), Gaps = 10/548 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR  +  G++ LA AVK TLGPKGR V++  ++GAP +T DGVT+A+ I 
Sbjct: 1   MAKDIKFSSDARAGLEAGIDKLANAVKVTLGPKGRNVVLDKAYGAPTITNDGVTIAQDIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LA AI  EG K + AG NP+ +++G+ 
Sbjct: 61  LEDRFENMGAQLVKEVATKTNDVAGDGTTTATVLAHAIIKEGLKNLAAGANPVVLQKGLK 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A  EVV+Y+K N + V  ++ I  V TIS+     IG+ IA AME++G  G+IT++++K
Sbjct: 121 KATDEVVDYIKENSRDVEDKQAIENVGTISSADPE-IGKFIADAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T +T + VV+GMQ D+GY+SPY  T  E+M A++++PYIL+ DKKIS +Q +LP+LE   
Sbjct: 180 TTSTYLDVVEGMQFDKGYLSPYMATDNEKMVADLDDPYILLTDKKISNIQEILPLLEEVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS +PL IIA+DV+G+AL TL++N++R    V+AVKAP +GDRRK +L DIA + GA V+
Sbjct: 240 QSSKPLLIIADDVDGEALTTLILNKLRGTFNVVAVKAPGYGDRRKAMLEDIAILTGAKVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G+ L+  T+  LGSAKKV + KD+TTIV G G    +E R++ I++ ++   S+Y+
Sbjct: 300 SEELGMDLKDTTLDMLGSAKKVKVDKDNTTIVEGKGDKNALEERVSVIRQQLDAEDSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIV GGG+ L+ 
Sbjct: 360 KEKLQERVAKLAGGVAVINVGAATETEMQEKKYRIEDALSATRAAVEEGIVAGGGVVLIG 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A + ++   ++   D+  G  I++KAL  P RQI++NAG +  +IV K+++S   + GY+
Sbjct: 420 AIEKVAKLEESLKGDEKTGAVIIKKALEAPLRQIVENAGMDGSVIVEKVKQS-AKDEGYD 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + +MFE GI++P KV R+ALQ+A S+AGM+L TEA V D PK+E A PQMP    
Sbjct: 479 AYNDEYVNMFEKGIVEPTKVTRSALQNAVSVAGMILTTEAAVADLPKEEEAMPQMP---- 534

Query: 540 MGGGMGGM 547
             GGM GM
Sbjct: 535 --GGMPGM 540


>gi|170736378|ref|YP_001777638.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3]
 gi|169818566|gb|ACA93148.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3]
          Length = 546

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 297/528 (56%), Positives = 397/528 (75%), Gaps = 2/528 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK+I     AR  +  GVN LA AVK TLGPKGR V++  SFGAP VTKDGV+VAK I
Sbjct: 1   MAAKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
              +    +GA+++++VA+ T D++GDGTTTAT LAQAI  EG+KYV AGLNP+D+KRGI
Sbjct: 61  ELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QVATISANG+  IG++IA A++++G  G+IT++  
Sbjct: 121 DKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+G+Q DRGY+SPYF+ + ++  AE+E+PYIL++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE GL LEKAT+A+LG AK++ + K++TT++ G G ++ IE R+ +I+  IE+  SDY
Sbjct: 301 IAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKKDR  D+L ATRAA +EGIVPGGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALI 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           R  QA+  +KG N DQ AGI+IV +AL  P RQI+ NAG+E+ ++V+K+    T N+GYN
Sbjct: 421 RVRQAIRELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKV-AEGTGNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
           AQ   +GD+ E G++DP KV R ALQ+A S+AG++L T+A V +APKD
Sbjct: 480 AQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527


>gi|226952456|ref|ZP_03822920.1| chaperonin GroEL [Acinetobacter sp. ATCC 27244]
 gi|294649742|ref|ZP_06727148.1| chaperone GroEL [Acinetobacter haemolyticus ATCC 19194]
 gi|226836778|gb|EEH69161.1| chaperonin GroEL [Acinetobacter sp. ATCC 27244]
 gi|292824373|gb|EFF83170.1| chaperone GroEL [Acinetobacter haemolyticus ATCC 19194]
          Length = 544

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 294/533 (55%), Positives = 399/533 (74%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKD+K G +AR  +  GVN LA+AVK TLGPKGR V+I  SFGAP +TKDGVTVAK I
Sbjct: 1   MSAKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           S K+ F  +GA+++R+V++ T D +GDGTTTAT LAQAI NEG K VTAG+NPMD+KRGI
Sbjct: 61  SLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D+AV+ VVE ++AN K     + I QV +ISAN D  +G+ IA AME++G  G+IT+++ 
Sbjct: 121 DIAVKTVVENIRANAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
                 + VV+GMQ DRGYISPYF    + +TAE+ENP+IL+ DKKI  ++ L+ +LE+ 
Sbjct: 181 SGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENPFILLVDKKIGNIRELITVLEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G+PL IIAEDVEG+ALATLVVN +R  + V AVKAP FGDRRK +L+DIA + G TV
Sbjct: 241 AKTGKPLLIIAEDVEGEALATLVVNNMRGIIKVCAVKAPGFGDRRKAMLQDIAILTGGTV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEEIG+ L++ T+  LG+A KV +SK++T IV G G + +I  R+ +I+  IE++ S+Y
Sbjct: 301 ISEEIGMALDQTTLEHLGTAHKVTVSKENTVIVDGAGNAAQIAERVQQIRAQIEESTSEY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV+++G  TE  + EKKDR  D+L ATRAA +EG+V GGG+ALV
Sbjct: 361 DKEKLQERVAKLAGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALV 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   L  +KG NEDQ AGI I+R+A+  P RQI+ NAGDE  ++++ ++  +  N+GYN
Sbjct: 421 RAVNVLDGLKGANEDQTAGINILRRAIEAPLRQIVSNAGDEPSVVINAVKAGE-GNFGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMGI+DP KV R+AL+ A S+AG+ML TE ++ D P+D+ A+P
Sbjct: 480 AATGEYGDMLEMGILDPAKVTRSALEHAASVAGLMLTTECMITDIPEDKPAAP 532


>gi|168182077|ref|ZP_02616741.1| chaperonin GroEL [Clostridium botulinum Bf]
 gi|237796738|ref|YP_002864290.1| chaperonin GroEL [Clostridium botulinum Ba4 str. 657]
 gi|259585898|sp|C3KUC8|CH60_CLOB6 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|182674890|gb|EDT86851.1| chaperonin GroEL [Clostridium botulinum Bf]
 gi|229261779|gb|ACQ52812.1| chaperonin GroEL [Clostridium botulinum Ba4 str. 657]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/547 (49%), Positives = 373/547 (68%), Gaps = 8/547 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +  G  AR ++  GV+ LA+ V+ TLGPKGR V++   FG+P +T DGVT+A+ I 
Sbjct: 1   MAKSLLFGEQARRSMEAGVDKLADTVRVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ +  +GA+++++VAT T D +GDGTTTAT LAQAI  EG K VTAG NP+ I+ GI 
Sbjct: 61  LEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPIQIRTGIR 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV++ VE +K   K V  +E+I +VA ISA    E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVEKAVEEIKVISKPVNGKEDIARVAAISAA-SEEVGKLIADAMERVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  T++ VV+GMQ DRGY+S Y VT TE+M A +++ YILI DKKIS +Q +LPILE   
Sbjct: 180 SMGTDLEVVEGMQFDRGYVSAYMVTDTEKMEAVLDDVYILITDKKISNIQEILPILEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+ L II+ED+EG+AL+TLV+N++R     + VKAP FGDRRKE+L+DIA + G  VI
Sbjct: 240 QQGKKLLIISEDIEGEALSTLVLNKLRGTFTCVGVKAPGFGDRRKEMLQDIAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G  L+  TI  LG+A  V ++K++TTIV G G    I+ R+++I+  IEDT S++D
Sbjct: 300 SEELGRDLKDVTIDMLGTADSVKVTKENTTIVNGKGDKVAIKERVSQIRVQIEDTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV+ VG  TE  L E+K R +D+L AT+AA +EGIVPGGG A + 
Sbjct: 360 KEKLQERLAKLAGGVAVIRVGAATETELKEEKLRIEDALAATKAAVEEGIVPGGGTAYID 419

Query: 422 AAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
               +  +  D  D   GI+I+RKAL  P RQI  NAG E  +I+ K++ S+    GY+A
Sbjct: 420 IIPKIADLTSDIIDVKLGIDIIRKALEEPVRQIANNAGVEGSVIIEKVKASEA-GVGYDA 478

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGM 540
               + DM + GI+DP KV R+ALQ+A S+A   L TEA V D P+ E   P  P     
Sbjct: 479 LNDKYVDMLKTGIVDPTKVTRSALQNAASIASTFLTTEAAVADIPEKENTPPMAP----- 533

Query: 541 GGGMGGM 547
           G GM GM
Sbjct: 534 GMGMDGM 540


>gi|126733621|ref|ZP_01749368.1| 60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
 gi|126716487|gb|EBA13351.1| 60 kDa chaperonin 1, putative [Roseobacter sp. CCS2]
          Length = 549

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 301/529 (56%), Positives = 404/529 (76%), Gaps = 1/529 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K  T AR+ +  GVNTLA AVK TLGPKGR V++  SFGAPR+TKDGV+VAK I
Sbjct: 3   MAAKDVKFDTDARNRMLTGVNTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI 62

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ F  +GA+M+++VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 63  ELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGMKSVAAGMNPMDLKRGI 122

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLA  +VVE +K+  + V   +E+ QV TISANG+ EIG +IA AM+++G  G+IT+++ 
Sbjct: 123 DLATLKVVEAIKSASRPVSDSDEVAQVGTISANGEEEIGRQIADAMQKVGNEGVITVEEN 182

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K   TE  VV+GMQ DRGY+SPYFVT+ ++MT E+E+P IL+++KK+S+LQP++P+LES 
Sbjct: 183 KGLETETDVVEGMQFDRGYLSPYFVTNPDKMTTELEDPIILLHEKKLSSLQPMVPLLESV 242

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSG+PL IIAEDVEG+ALATLVVN++R GL + AVKAP FGDRRK +L+DIA + G  V
Sbjct: 243 IQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV 302

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+++G+KLE  TI  LG+AK+V ++KD+TTIV G G    IE R+ +I+  IE+T SDY
Sbjct: 303 ISDDLGMKLESVTIDMLGTAKRVAITKDETTIVDGAGDKAEIEARVGQIRGQIEETTSDY 362

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV+ VG ++E  + E+KDR  D+L+ATRAA  EG+V GGG+AL+
Sbjct: 363 DREKLQERVAKLAGGVAVIRVGGMSEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALI 422

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           +  +AL  ++G N DQ  GI IVRKA+  P RQI +N+G +  ++  KI+ES    +G+N
Sbjct: 423 QGGKALDGLEGANSDQNVGISIVRKAIEAPLRQIAENSGVDGSVVAGKIRESDDKAFGFN 482

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDE 528
           AQ   +GDMF+ G+IDP KVVR ALQ A S+AG+++ TEA+V D P  E
Sbjct: 483 AQTEEYGDMFKFGVIDPAKVVRTALQDAASVAGLLITTEAMVADKPAKE 531


>gi|303239060|ref|ZP_07325590.1| chaperonin GroEL [Acetivibrio cellulolyticus CD2]
 gi|302593398|gb|EFL63116.1| chaperonin GroEL [Acetivibrio cellulolyticus CD2]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/542 (49%), Positives = 373/542 (68%), Gaps = 5/542 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAK I     AR +I  GVN LA+AVK TLGPKGR V++   +G+P +T DGVT+AK I
Sbjct: 1   MAAKIIAFDEKARRSIEAGVNKLADAVKVTLGPKGRNVVLEKKYGSPTITNDGVTIAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++ +  +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V +G NP+ +K+G+
Sbjct: 61  ELEDPYENMGAQLVKEVASKTNDIAGDGTTTATLLAQAIVREGLKNVASGANPIILKKGM 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           + AV++ VE +K N +K+  ++++  VATIS+  D +IG+ IA AME++   G+ITI++ 
Sbjct: 121 EKAVEKAVESIKKNSQKLKGKDDMAFVATISSG-DEKIGQLIADAMEKVTAEGVITIEEN 179

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K + T + VV+GMQ D+GY+SPY VT  E+M A +E+PYILI DKKI+ +Q LLP LE  
Sbjct: 180 KASDTIIEVVEGMQFDKGYVSPYMVTDNEKMEALLEDPYILITDKKINNVQDLLPALELV 239

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++G  + +IAEDVEGDALATLVVN++R     +AVKAP FGDRRKE+LRDIA + G  V
Sbjct: 240 VKNGGKMLLIAEDVEGDALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLRDIAILTGGEV 299

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+G+ +++  +   G AK V + K++T IV G G S+ I  R+  I+K IE T S Y
Sbjct: 300 ISEEVGMNIKEIKLEWFGKAKSVKVQKENTIIVNGAGNSKAIRDRVESIKKQIELTTSSY 359

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL ERLAKLAGGVAV+ VG  TE  + EKK R +D+L+ATRAA +EGIVPGGG A +
Sbjct: 360 DKEKLNERLAKLAGGVAVIRVGAATETEMKEKKYRVEDALNATRAAVEEGIVPGGGTAYI 419

Query: 421 RAAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGY 478
                +       + D+  G  I+ +AL  P RQI  NAG +  +IV K++ +     G+
Sbjct: 420 NTLPDIKELVNTLHGDEKTGASIILRALEEPLRQIAINAGIDGSVIVEKVKNN-DKGIGF 478

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           +A K  + DMF+ GI+DPVKV R+ALQ+A S+A M+L TE+ V + P+ + A P MPAG 
Sbjct: 479 DAAKEEYVDMFKAGIVDPVKVTRSALQNAASVAAMILTTESAVAEKPEKKKA-PSMPAGD 537

Query: 539 GM 540
             
Sbjct: 538 MD 539


>gi|304405156|ref|ZP_07386816.1| chaperonin GroEL [Paenibacillus curdlanolyticus YK9]
 gi|304346035|gb|EFM11869.1| chaperonin GroEL [Paenibacillus curdlanolyticus YK9]
          Length = 544

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 267/529 (50%), Positives = 378/529 (71%), Gaps = 2/529 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK G  AR A+  GV+ LA AVK TLGPKGR V++   FG+P +T DGV++AK I 
Sbjct: 1   MAKEIKFGEDARRAMLRGVDALANAVKVTLGPKGRNVVLEKKFGSPLITNDGVSIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LAQA+  EG K VTAG NPM I++GI+
Sbjct: 61  LEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMVIRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  +  L++  K +  ++ I QVA+IS+  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVRAAITELQSIAKPIEGKQSIAQVASISSA-DEEVGQLIAEAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+SPY +T T++M A ++NPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFATELEVVEGMQFDRGYLSPYMITDTDKMEAVLDNPYILITDKKITNIQEILPVLEKVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QSG+ L II+ED+EG+ALATL+VNR+R     + VKAP FGDRRK +L DIAA+ G  VI
Sbjct: 240 QSGKQLLIISEDIEGEALATLLVNRLRGTFTCVGVKAPGFGDRRKAMLGDIAALTGGQVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL+L+  T+  LG+A+++ ++K++T IV G G    I+ R+++I+  +E+T SD+D
Sbjct: 300 TEELGLELKSTTVDQLGTARQIRVTKENTIIVDGAGDKADIDVRVSQIRAQLEETTSDFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             +A++      D+  G+ IV ++L  P R I  NAG E  +IV +++  K    GYNA 
Sbjct: 420 VYKAVAAVAAVGDEQTGVNIVLRSLEEPIRTIAANAGQEGSVIVERLKNEK-IGVGYNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETA 530
              + +MFE GI+DP KV R+ALQ+A S+A M L TEAVV D P+ + A
Sbjct: 479 TGEWVNMFEAGIVDPAKVTRSALQNAASVAAMFLTTEAVVADKPEPKGA 527


>gi|225869679|ref|YP_002745626.1| 60 kDa chaperonin [Streptococcus equi subsp. equi 4047]
 gi|254813899|sp|C0M7S3|CH60_STRE4 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|225699083|emb|CAW92231.1| 60 kDa chaperonin [Streptococcus equi subsp. equi 4047]
          Length = 541

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 280/545 (51%), Positives = 380/545 (69%), Gaps = 5/545 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR+++  GV+ LA+ VK TLGPKGR V++  +FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSADARESMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A    VE LKA  + V  +E I QVA++S+    ++G+ I+ AME++G  G+ITI++++
Sbjct: 121 AATTTAVEALKAVAQPVSGKEAIAQVASVSSR-SEKVGDYISEAMERVGNDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M A++ENP+ILI DKKIS +Q +LP+LE   
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKISNIQDILPLLEEVL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           ++ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 KTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ AT+A LG A KV + KD+T IV G G SE I  R++ I+  +E T S++D
Sbjct: 300 TEDLGLELKDATMAALGQAAKVTVDKDNTVIVEGAGSSEAISNRVSLIKSQLETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL+ 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALIN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++    + D   G  IV +AL  P RQI  NAG E  +I+ K++ S  A  G+NA 
Sbjct: 420 VMDKVAALELDGDAATGRNIVLRALEEPVRQIAYNAGYEGSVIIDKLKNS-AAGIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + DM   GIIDPVKV R+ALQ+A S+AG++L TEAVV   P+   A+P MP  G   
Sbjct: 479 TGEWVDMIATGIIDPVKVTRSALQNAASVAGLILTTEAVVATKPE--PAAPAMP-QGMDP 535

Query: 542 GGMGG 546
           G MGG
Sbjct: 536 GMMGG 540


>gi|237650935|ref|ZP_04525187.1| chaperonin GroEL [Streptococcus pneumoniae CCRI 1974]
 gi|237820809|ref|ZP_04596654.1| chaperonin GroEL [Streptococcus pneumoniae CCRI 1974M2]
          Length = 540

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 276/543 (50%), Positives = 376/543 (69%), Gaps = 3/543 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            +K+IK  + AR A+  GV+ LA+ VK TLGPKGR V++  SFG+P +T DGVT+AK I 
Sbjct: 1   MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LK N   V ++E I QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 TAVAAAVEALKNNVIPVANKEAIAQVAAVSSR-SEKVGEYISEAMEKVGKDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT +E+M A++ENPYILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL+L+ ATI  LG A +V + KD T IV G G  E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG AL  
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALAN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              A++      D+  G  IV +AL  P RQI  NAG E  +++ +++ ++    G+NA 
Sbjct: 420 VIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAEL-GIGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+    +P M     MG
Sbjct: 479 TGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPS-MMG 537

Query: 542 GGM 544
           G M
Sbjct: 538 GMM 540


>gi|227501198|ref|ZP_03931247.1| chaperone GroEL [Anaerococcus tetradius ATCC 35098]
 gi|227216599|gb|EEI82003.1| chaperone GroEL [Anaerococcus tetradius ATCC 35098]
          Length = 539

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 272/548 (49%), Positives = 385/548 (70%), Gaps = 12/548 (2%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK  + AR ++  G++ LA AVK TLGPKGR V++  ++GAP +T DGVT+A+SI 
Sbjct: 1   MAKDIKFSSDARASLEAGIDKLANAVKVTLGPKGRNVVLDKAYGAPTITNDGVTIAQSIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++++VAT T D +GDGTTTAT LA AI  EG K + AG NP+ +++G+ 
Sbjct: 61  LEDRFENMGAQLVKEVATKTNDVAGDGTTTATVLAHAIIKEGLKNLAAGANPVVLQKGLK 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            A  EVV Y+K N ++V  ++ I  V TIS+     IG+ IA AME++G  G+IT++++K
Sbjct: 121 KATCEVVSYIKENSREVEDKQAIQNVGTISSADPE-IGKFIADAMEKVGNDGVITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           T  T + VV+GMQ DRGY+SPY  T  E+M AE+++PYIL+ DKKIS +Q +LP+LE   
Sbjct: 180 TTDTHLDVVEGMQFDRGYLSPYMATDNEKMIAELDDPYILLTDKKISNIQEILPLLEQIV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           QS +PL IIA+DV+G+AL TL++N++R    V+AVKAP +GDRRK +L DIA + GATV+
Sbjct: 240 QSTKPLLIIADDVDGEALTTLILNKLRGTFNVVAVKAPGYGDRRKAMLEDIAILTGATVV 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G++L+   I  LGSAKK+ + KD+TTIV G G  E +E R+  I+K +E   S+Y+
Sbjct: 300 SEELGMELKDTAIDMLGSAKKIKVDKDNTTIVEGKGSKESLEERVAHIRKQVETEDSEYE 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ER+AKLAGGVAV+ VG  TE  + EKK R +D+L ATRAA +EGIV GGG+ L+ 
Sbjct: 360 KEKLQERVAKLAGGVAVINVGAATETEMQEKKYRIEDALSATRAAVEEGIVAGGGVVLIG 419

Query: 422 AAQALSVKGDN--EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           A + +    ++   D+  G  I+ KAL  P RQI +NAG +  +IV +++ S   + GY+
Sbjct: 420 AIEKIKKLSESLKGDEKTGAIIIEKALEAPLRQIAENAGMDGSVIVERVKHS-AKDEGYD 478

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGG 539
           A    + +MFE GI++P KV R+ALQ+A S+AGM+L TEA V D PK+E  +PQMPA   
Sbjct: 479 AYNDEYVNMFEKGIVEPTKVTRSALQNAVSVAGMILTTEAAVADIPKEE--APQMPA--- 533

Query: 540 MGGGMGGM 547
              GM GM
Sbjct: 534 ---GMPGM 538


>gi|207728090|ref|YP_002256484.1| 60 kda chaperonin [Ralstonia solanacearum MolK2]
 gi|206591335|emb|CAQ56947.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum MolK2]
          Length = 550

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 391/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKNISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+ +   K  N+GYN
Sbjct: 421 RARAAISSLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVANVIAGK-GNHGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A  
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAAPA 532


>gi|83747556|ref|ZP_00944593.1| 60 kDa chaperonin GROEL [Ralstonia solanacearum UW551]
 gi|207742485|ref|YP_002258877.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum IPO1609]
 gi|83725736|gb|EAP72877.1| 60 kDa chaperonin GROEL [Ralstonia solanacearum UW551]
 gi|206593876|emb|CAQ60803.1| 60 kda chaperonin (protein cpn60) (groel protein) [Ralstonia
           solanacearum IPO1609]
          Length = 547

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/533 (55%), Positives = 391/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG++IA AM+++G  G+IT++  
Sbjct: 121 DKAVAAAVEELKNISKPTTTSKEIAQVGAISANSDESIGQRIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            +SGRPL IIAEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKSGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQAL-SVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  A+ S+KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+ +   K  N+GYN
Sbjct: 421 RARAAISSLKGANADQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVANVIAGK-GNHGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+A V + PKD+ A  
Sbjct: 480 AATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDAAVAELPKDDAAPA 532


>gi|149776882|gb|ABR28463.1| chaperonin GroEL [Bacillus megaterium]
          Length = 543

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 277/534 (51%), Positives = 377/534 (70%), Gaps = 3/534 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+TLA AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NPM I++G++
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGME 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA  K +  ++ I QVA ISA  D E+G+ IA AME++G  G+IT++++K
Sbjct: 121 KAVAVAVEELKAISKPIQGKDSIAQVAAISAA-DEEVGQLIAEAMERVGNDGVITLEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +++PYILI DKKI  +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDDPYILITDKKIGNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL IIAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L+D+A + G  VI
Sbjct: 240 QQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDVAILTGGEVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +EE+GL L+ A I  LG A K+V++K++TT+V G G +E I  R+N+I+  +E+T S++D
Sbjct: 300 TEELGLDLKTAGIDQLGRASKIVVTKENTTVVNGAGNAEDILARVNQIKAQLEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
               ++    + D   GI IV +A+  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 IYNKVASIEADGDTATGINIVLRAIEEPVRQIAHNAGLEGSVIVERLK-GEAVGTGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMP 535
              + +M + GI+DP KV R+ALQ+A S+A M L TEAVV D P+ E  +P MP
Sbjct: 479 TGEWVNMLDTGIVDPTKVTRSALQNASSVAAMFLTTEAVVADKPE-EGGAPAMP 531


>gi|330831996|ref|YP_004400821.1| 60 kDa chaperonin [Streptococcus suis ST3]
 gi|329306219|gb|AEB80635.1| 60 kDa chaperonin [Streptococcus suis ST3]
          Length = 540

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 282/544 (51%), Positives = 380/544 (69%), Gaps = 5/544 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK+IK    AR+++  GV+ LA+ VK TLGPKGR V++  ++G+P +T DGVT+AK I 
Sbjct: 1   MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++HF  +GA+++ +VA+ T D +GDGTTTAT L QAI  EG K VTAG NP+ I+RGI+
Sbjct: 61  LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV   VE LKA    V ++ EI QVA +S+    ++GE I+ AME++G  G+ITI++++
Sbjct: 121 AAVATAVESLKAQASPVSNKAEIAQVAAVSSR-SEKVGEYISEAMERVGTDGVITIEESR 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
              TE+ VV+GMQ DRGY+S Y VT  E+M AE+ENP+ILI DKKIS +Q +LP+LES  
Sbjct: 180 GMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFILITDKKISHIQDILPLLESIL 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+ RPL IIA+DV+G+AL TLV+N++R    V+AVKAP FGDRRK +L DIA + G TVI
Sbjct: 240 QTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+ ATI  LG A KVV+ KD TTIV G G +E I  R+  I+  IE T S++D
Sbjct: 300 TEDLGLDLKDATIEALGQAAKVVVDKDGTTIVEGVGNAEAIANRVAVIKSQIEGTTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKL+GGVAV++VG  TE  L E K R +D+L+ATRAA +EGIV GGG ALV 
Sbjct: 360 REKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
              +++      D   G  IV +AL  P RQI  NAG E  +I+ K++ S+    G+NA 
Sbjct: 420 VIDSVAKLELKGDDETGRNIVLRALEEPVRQIAYNAGYEGSVIIDKLKNSELGT-GFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMG 541
              + +M + GIIDPVKV R+ALQ+A S+A ++L TEAVV + P+   A+P MP  G  G
Sbjct: 479 TGEWVNMMDAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPE--PAAPAMP-QGMDG 535

Query: 542 GGMG 545
            GMG
Sbjct: 536 MGMG 539


>gi|157691328|ref|YP_001485790.1| chaperonin GroEL [Bacillus pumilus SAFR-032]
 gi|167008690|sp|A8FAG3|CH60_BACP2 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|157680086|gb|ABV61230.1| chaperone GroEL [Bacillus pumilus SAFR-032]
          Length = 544

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 269/526 (51%), Positives = 375/526 (71%), Gaps = 2/526 (0%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AKDIK    AR A+  GV+ LA+AVK TLGPKGR V++   FG+P +T DGVT+AK I 
Sbjct: 1   MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++ F  +GA+++ +VA+ T D +GDGTTTAT LAQA+  EG K VTAG NP+ +++GI+
Sbjct: 61  LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  +E L    K +  +E I QVA+ISA  D E+G  IA AME++G  G+ITI+++K
Sbjct: 121 EAVKVALEGLHEISKPIEGKESIAQVASISAA-DEEVGSLIAEAMERVGNDGVITIEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
             TTE+ VV+GMQ DRGY SPY VT +++M A +ENPYILI DKKI+ +Q +LP+LE   
Sbjct: 180 GFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITNIQEILPVLEQVV 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q G+PL +IAEDVEG+ALATLVVN++R     +AVKAP FGDRRK +L DI+ + G  +I
Sbjct: 240 QQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGELI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           +E++GL L+   I  LG A KVV++K++TTIV G+G S +I  R+N+I+  +E+T S++D
Sbjct: 300 TEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGDSAQIAARVNQIRAQVEETTSEFD 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           ++KL+ERLAKLAGGVAV++VG  TE  L E+K R +D+L++TRAA +EGIV GGG ALV 
Sbjct: 360 KEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVN 419

Query: 422 AAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQ 481
             + ++    + D   G+ IV ++L  P RQI  NAG E  +IV +++  +    G+NA 
Sbjct: 420 VYKKVASIEADGDVQTGVNIVLRSLEEPIRQIAHNAGLEGSVIVERLKNEE-IGVGFNAA 478

Query: 482 KSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKD 527
            + + +M E GI+DP KV R+ALQ+A S+A M+L TEAVV D P++
Sbjct: 479 TNEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVADKPEE 524


>gi|299067817|emb|CBJ39028.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Ralstonia
           solanacearum CMR15]
          Length = 547

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 292/533 (54%), Positives = 388/533 (72%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+  G AAR  +  GVN LA AVK TLGPKGR V++  SFG P VTKDGV+VAK I
Sbjct: 1   MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+    +GA+M+++VA+ T D++GDGTTTAT LAQ+I  EG KYV AG+NPMD+KRGI
Sbjct: 61  ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV   VE LK   K   + +EI QV  ISAN D  IG +IA AM+++G  G+IT++  
Sbjct: 121 DKAVASAVEELKKISKPTTTSKEIAQVGAISANSDESIGARIAEAMDKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+ + E+   +++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLEDELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++GRPL I+AEDVEG+ALATLVVN +R  L   AVKAP FGDRRK +L DIA + G  V
Sbjct: 241 AKAGRPLLIVAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAILTGGQV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           I+EE+GL LEKAT+ DLG AK+V + K++TTI+ G G +  IE R+ +++  IE+  SDY
Sbjct: 301 IAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDARNIEARVKQVRAQIEEATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DR+KL+ER+AKLAGGVAV++VG  TE  + EKK R +D+L ATRAA +EGIV GGG+AL+
Sbjct: 361 DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA   +S +KG N DQ AGI+IV +A+  P RQI+ NAGDE+ ++V+ +   K  NYGYN
Sbjct: 421 RARALISGLKGANPDQDAGIKIVLRAMEEPLRQIVTNAGDEASVVVANVIAGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GD+ EMG++DP KV R ALQ+A S+A +ML T+  V + PKD+ A  
Sbjct: 480 ASTGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTTDCAVAELPKDDAAPA 532


>gi|161869236|ref|YP_001598403.1| chaperonin GroEL [Neisseria meningitidis 053442]
 gi|189082357|sp|A9M0Q6|CH60_NEIM0 RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|161594789|gb|ABX72449.1| chaperonin 60kD subunit [Neisseria meningitidis 053442]
 gi|325206877|gb|ADZ02330.1| chaperonin GroL [Neisseria meningitidis M04-240196]
          Length = 544

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 291/533 (54%), Positives = 392/533 (73%), Gaps = 2/533 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD++ G   R  +  GVN LA AV+ TLGPKGR V++  +FG P +TKDGVTVAK I
Sbjct: 1   MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+M+++VA+ T D +GDGTTTAT LAQ+I  EG KYVTAG+NP D+KRGI
Sbjct: 61  ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           D AV  +VE LK   K   + +EI QV +ISAN D ++G  IA AME++G  G+IT++  
Sbjct: 121 DKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDG 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K+   E+ VV+GMQ DRGY+SPYF+   E+  A ++NP++L++DKKIS ++ LLP+LE  
Sbjct: 181 KSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            ++ RPL IIAEDVEG+ALATLVVN +R  L  +AVKAP FGDRRK +L+DIA + G  V
Sbjct: 241 AKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGVV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           ISEE+GL LEKAT+ DLG AK++ + K++TTI+ G G + +IE R+ EI++ IE   SDY
Sbjct: 301 ISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           D++KL+ER+AKLAGGVAV++VG  TE  + EKKDR +D+L ATRAA +EG+V GGG+AL+
Sbjct: 361 DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALL 420

Query: 421 RAAQALS-VKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYN 479
           RA  AL  +   N DQ AG++IV +A+  P RQI+ NAG E  ++V+K+ E K  NYGYN
Sbjct: 421 RARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGK-GNYGYN 479

Query: 480 AQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASP 532
           A    +GDM EMG++DP KV R+ALQ A S+AG+ML T+ ++ + P+D+ A P
Sbjct: 480 AGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEDKPAVP 532


>gi|148556278|ref|YP_001263860.1| chaperonin GroEL [Sphingomonas wittichii RW1]
 gi|166201753|sp|A5VBQ6|CH60_SPHWW RecName: Full=60 kDa chaperonin; AltName: Full=GroEL protein;
           AltName: Full=Protein Cpn60
 gi|148501468|gb|ABQ69722.1| chaperonin GroEL [Sphingomonas wittichii RW1]
          Length = 549

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 306/536 (57%), Positives = 401/536 (74%), Gaps = 3/536 (0%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           MAAKD+K    AR+ I  GV+ LA+AVK TLGPKGR V+I  SFGAPR+TKDGVTVAK I
Sbjct: 1   MAAKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             K+ F  +GA+++R+VA+ T D +GDGTTTAT LAQAI  EG K V AG+NPMD+KRGI
Sbjct: 61  ELKDKFENIGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGLKSVAAGMNPMDLKRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           DLAV +VVE LKA  K V    E+ QV  ISANGD+E+GEKIA AM+++G  G+IT+++A
Sbjct: 121 DLAVTKVVENLKARSKPVAGSNEVAQVGIISANGDKEVGEKIAEAMDKVGKEGVITVEEA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           K    E+ VV+GMQ DRGY+SPYF+T+ E+M  E+ +PYILI++KK+S LQ +LPILE+ 
Sbjct: 181 KGLEFELDVVEGMQFDRGYLSPYFITNPEKMQVELTDPYILIHEKKLSNLQSILPILEAV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKE