RPSBLAST alignment for GI: 254780849 and conserved domain: TIGR02343

>gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit. Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT epsilon chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 532
 Score = 52.9 bits (127), Expect = 2e-07
 Identities = 39/149 (26%), Positives = 75/149 (50%), Gaps = 14/149 (9%)

Query: 20  VNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVAT 79
             ++A  ++ +LGPKG   ++ +  G   VT DG T+   +   N      A+++ +++ 
Sbjct: 36  AKSVASILRTSLGPKGMDKMLQSPDGDITVTNDGATILSQMDVDNPI----AKLMVELSK 91

Query: 80  NTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKV- 138
           + +D  GDGTT    LA A+  +    +  G++P+ I  G ++A +  VE+L+   +++ 
Sbjct: 92  SQDDEIGDGTTGVVVLAGALLEQAEALLDKGIHPIKIAEGFEVAARVAVEHLEEISEEIS 151

Query: 139 ---GSREEIIQVATISANGDREIGEKIAY 164
               ++E +IQ A  S      +G KI  
Sbjct: 152 DDNNNKEPLIQAAKTS------LGSKIVS 174