RPSBLAST alignment for GI: 254780849 and conserved domain: TIGR02345

>gnl|CDD|131398 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit. Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT eta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 522
 Score = 58.6 bits (142), Expect = 4e-09
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 23  LAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTE 82
           +AE +K TLGP+G   +I        V+ DG T+ K +   +  H   A+ + D+A + +
Sbjct: 30  IAEILKTTLGPRGMDKLIVGK-NGATVSNDGATILKLL---DIVHPA-AKTLVDIAKSQD 84

Query: 83  DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKAN 134
              GDGTT+   LA  +  E + ++  G++P  I R    A+   +E LK  
Sbjct: 85  SEVGDGTTSVVILAGELLKEAKPFIEEGVHPQLIIRCYREALMLAIEKLKEI 136