RPSBLAST alignment for GI: 254780849 and conserved domain: TIGR02346

>gnl|CDD|162812 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit. Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT alpha chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 531
 Score = 45.1 bits (107), Expect = 5e-05
 Identities = 27/109 (24%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 23  LAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTE 82
           L+   + +LGP G   ++ N      VT D  T+ + +  +   H   A+++   +   E
Sbjct: 30  LSNITRTSLGPNGMNKMVINHLDKLFVTNDAATILRELEVQ---HPA-AKLLVMASEMQE 85

Query: 83  DSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYL 131
           +  GDGT     LA  + ++  + +  GL+P +I +G + A+++ +E L
Sbjct: 86  NEIGDGTNLVIVLAGELLDKAEELIRMGLHPSEIIKGYEQALKKAMEVL 134