RPSBLAST alignment for GI: 254780849 and conserved domain: COG0459

>gnl|CDD|30807 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones]. Length = 524
 Score =  431 bits (1109), Expect = e-121
 Identities = 233/550 (42%), Positives = 317/550 (57%), Gaps = 42/550 (7%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M  K+ K G  AR +       LA+AVK TLGPKGR  ++ +S G   +T DGVT+ K I
Sbjct: 1   MMGKERKFGEDARRSNIRAARALADAVKTTLGPKGRNKMLVDSGGDITITNDGVTILKEI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
             ++     GA+++ +VA   +D +GDGTTTA  LA A+  E  K + AG++P  IKRG 
Sbjct: 61  ELEH----PGAKLLVEVAKKQDDEAGDGTTTAVVLAGALLKEAEKLIAAGIHPTVIKRGY 116

Query: 121 DLAVQEVVEYLKANHKKVGSRE-----EIIQVATISANGDREIGEKIAYAMEQIGP---- 171
            LAV++ VE LK   K V   E      I  VA+ SAN D EIGE +  A+E++G     
Sbjct: 117 RLAVEKAVEELKEIAKPVSDSEEELKIAITSVASKSANSDEEIGELVVEAVEKVGKEQSD 176

Query: 172 -HGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISAL 230
             GII + ++  + TE+ VV+GM  D+GY+SPYF+         +ENP IL+ DKK+   
Sbjct: 177 LDGIIIVKESGGSETELEVVEGMVFDKGYLSPYFMPDK-----RLENPKILLLDKKLEIK 231

Query: 231 QPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLR 290
           +P LP LE    SG+PL IIAED EG+ALATLVVN +R G  V+ VKAP   D  K  L 
Sbjct: 232 KPELP-LEIVISSGKPLLIIAEDEEGEALATLVVNILRGGANVVVVKAPGIDDLAKAYLE 290

Query: 291 DIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQ 350
           DIA + G  V  E++G +L K     LG AK V + KD TTIV G G +  +E       
Sbjct: 291 DIAILTGRRVKKEDLGERLAK-----LGGAKIVSVLKDLTTIVLGEGAAGLVE------- 338

Query: 351 KAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEG 410
              E    DYD +KL+ER AK AGGVA + V   TE  L EK+ R +D+L+  RAA +EG
Sbjct: 339 ---ETKTGDYDMEKLQERKAK-AGGVATILVRGATEVELDEKERRIEDALNVVRAAVEEG 394

Query: 411 -IVPGGGIALVRAAQALSVKGDN---EDQCAGIEIVRKALSYPCRQIIKNAGDESELIVS 466
            IVPGGG A + AA  L          D+  GIE   +AL  P RQ+ +NAG +   ++S
Sbjct: 395 KIVPGGGAAEIEAALRLREYAMTVEGGDEQLGIEAFARALEAPPRQLAENAGLDPIEVLS 454

Query: 467 KIQESK-TANYGYNAQK-SVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDA 524
           K++ +  T NYG +A       DM E GIIDP+KV R+AL++A   AG++L  + ++   
Sbjct: 455 KLRSAHATTNYGIDAFTGEYEDDMIEAGIIDPLKVKRSALKNAAEAAGLLLTIDDIIAAK 514

Query: 525 PKDETASPQM 534
           P+++  +P  
Sbjct: 515 PEEKKPAPPG 524