RPSBLAST alignment for GI: 254780849 and conserved domain: cd03335

>gnl|CDD|48152 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.. Length = 527
 Score = 58.7 bits (142), Expect = 4e-09
 Identities = 125/562 (22%), Positives = 212/562 (37%), Gaps = 117/562 (20%)

Query: 9   GTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHE 68
           G   R         +A  VK +LGP G   ++ +  G   +T DG T+ K +  ++    
Sbjct: 6   GQDVRTQNVTAAMAIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP--- 62

Query: 69  VGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVV 128
             A+++ ++A   +   GDGTT+   +A  +     + V   ++P  I  G  LA +E V
Sbjct: 63  -AAKILVELAQLQDKEVGDGTTSVVIIAAELLKRANELVKQKIHPTTIISGYRLACKEAV 121

Query: 129 EYLKANHKKVGS---REEIIQVATIS-----ANGDREIGEKIAY----AMEQIGPHG--- 173
           +Y+K +         +E +I VA  S        D +    +      A++     G   
Sbjct: 122 KYIKEHLSISVDNLGKESLINVAKTSMSSKIIGADSDFFANMVVDAILAVKTTNEKGKTK 181

Query: 174 --IITIDQAKT---ATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKIS 228
             I  ++  K    +  E  +V G  ++    S       + M   V+N  I   D  + 
Sbjct: 182 YPIKAVNILKAHGKSAKESYLVNGYALNCTRAS-------QGMPTRVKNAKIACLDFNLQ 234

Query: 229 ALQPLLPI---------LESATQSGRPLCIIAEDVEG--DALATLVVNRVRCGLPVLAVK 277
             +  L +         LE   Q  R   I  E ++    A A +V+     G+  + +K
Sbjct: 235 KTKMKLGVQVVVTDPEKLEKIRQ--RESDITKERIKKILAAGANVVL--TTGGIDDMCLK 290

Query: 278 ----APAFGDRR--KEVLRDIAAVVGATVISEEIGLKLEKA-TIADLGSAKKVVMSK--D 328
               A A   RR  KE LR IA   GAT++S    L+ E+    + LG A++VV  +  D
Sbjct: 291 YFVEAGAMAVRRVKKEDLRRIAKATGATLVSTLANLEGEETFDPSYLGEAEEVVQERIGD 350

Query: 329 DTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAA 388
           D  I+   G  +R    I      I    +D+  D+++  L                   
Sbjct: 351 DELIL-IKGTKKRSSASI------ILRGANDFMLDEMERSL------------------- 384

Query: 389 LGEKKDRYQDSLDA-TRAASDEGIVPGGGIALVRAAQALSVKGDN-------EDQCAGIE 440
                    D+L    R      +VPGGG        ALS+  +N        +Q A  E
Sbjct: 385 --------HDALCVVKRTLESNSVVPGGGAVET----ALSIYLENFATTLGSREQLAIAE 432

Query: 441 IVRKALSYPCRQIIKNAGDESELIVSKI-----------QESKTANYGYNAQKSVFGDMF 489
                L  P + +  NA  ++  +V+K+            +     YG +       D  
Sbjct: 433 FAEALLVIP-KTLAVNAAKDATELVAKLRAYHAAAQVKPDKKHLKWYGLDLINGKVRDNL 491

Query: 490 EMGIIDP----VKVVRNALQSA 507
           E G+++P    +K ++ A ++A
Sbjct: 492 EAGVLEPTVSKIKSLKFATEAA 513