Query gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 64 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 01:51:48 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780851.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG2704 consensus 74.1 0.5 1.3E-05 27.0 -1.2 34 19-52 305-338 (480) 2 KOG3150 consensus 61.6 2.9 7.3E-05 23.0 0.5 32 24-55 16-48 (182) 3 COG5217 BIM1 Microtubule-bindi 40.2 11 0.00029 19.8 0.8 33 3-39 7-39 (342) 4 cd07358 harmonin_N_like_1 Doma 29.1 28 0.00071 17.7 1.3 18 46-63 55-72 (78) 5 KOG4309 consensus 24.8 23 0.0006 18.1 0.3 16 24-39 109-124 (217) 6 TIGR01116 ATPase-IIA1_Ca calci 23.9 24 0.0006 18.1 0.1 10 10-19 640-649 (800) 7 smart00615 EPH_lbd Ephrin rece 20.1 30 0.00076 17.5 0.0 21 32-52 38-58 (177) 8 KOG0227 consensus 19.2 51 0.0013 16.3 1.1 20 19-38 151-170 (222) 9 PHA02078 hypothetical protein 17.9 54 0.0014 16.1 1.0 10 1-10 30-39 (57) 10 KOG1915 consensus 17.8 68 0.0017 15.6 1.4 14 2-15 359-372 (677) No 1 >KOG2704 consensus Probab=74.15 E-value=0.5 Score=27.05 Aligned_cols=34 Identities=41% Similarity=0.649 Sum_probs=29.3 Q ss_pred HHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHH Q ss_conf 5666775532243332000020771468999997 Q gi|254780851|r 19 IANLYLQKIETKDDKFEYCDVWNGQTRNWLREVV 52 (64) Q Consensus 19 ianlylqkietkddkfeycdvwngqtrnwlrevv 52 (64) +.|.-..++|+.+.--|--|.||-||--|||.+| T Consensus 305 ~~Nvd~l~vE~A~s~k~~l~~WNi~T~~WLR~~v 338 (480) T KOG2704 305 VSNVDILKVELATSVKEMLDNWNIQTNKWLRRVV 338 (480) T ss_pred HCCCCEEEEHHHHHHHHHHHHCCCCHHHHHHHHE T ss_conf 2266603350766699887614723878877546 No 2 >KOG3150 consensus Probab=61.56 E-value=2.9 Score=22.99 Aligned_cols=32 Identities=31% Similarity=0.738 Sum_probs=25.3 Q ss_pred HHHHHCCCCCEEEEECCCCC-HHHHHHHHHHHC Q ss_conf 75532243332000020771-468999997204 Q gi|254780851|r 24 LQKIETKDDKFEYCDVWNGQ-TRNWLREVVGKI 55 (64) Q Consensus 24 lqkietkddkfeycdvwngq-trnwlrevvgki 55 (64) ...|.+|+++|.||-||.-- --.||-...|.+ T Consensus 16 ~~~id~k~~rfPyCIVWTPiPvltWl~PfIGHm 48 (182) T KOG3150 16 DLEIDPKRSRFPYCIVWTPIPVLTWLFPFIGHM 48 (182) T ss_pred CCCCCCCCCCCCEEEEECCHHHHHHHHHHCCCE T ss_conf 556583337787489814727888887653401 No 3 >COG5217 BIM1 Microtubule-binding protein involved in cell cycle control [Cell division and chromosome partitioning / Cytoskeleton] Probab=40.22 E-value=11 Score=19.77 Aligned_cols=33 Identities=33% Similarity=0.488 Sum_probs=25.0 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC Q ss_conf 0278899999876423566677553224333200002 Q gi|254780851|r 3 FWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDV 39 (64) Q Consensus 3 fwrreiyrwvnlvtgkianlylqkietkddkfeycdv 39 (64) --|.|+.-|.|.|+ +|-||+||.-...|-||.. T Consensus 7 esr~ell~w~N~v~----~L~l~rIEdcg~g~am~qI 39 (342) T COG5217 7 ESREELLFWENVVV----RLDLQRIEDCGEGFAMQQI 39 (342) T ss_pred HHHHHHHHHHHHHH----HCCCEEHHHHCCCHHHHHH T ss_conf 54999999998886----3472336554144358998 No 4 >cd07358 harmonin_N_like_1 Domains similar to the N-terminal protein-binding module of harmonin. This domain is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. Harmonin (not belonging to this group) is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein, which organizes the Usher protein network of the inner ear and the retina. This domain is also related to domains found in several other PDZ domain-containing scaffold proteins which organize supramolecular complexes. This subgroup is comprised of uncharacterized PDZ-containing proteins including a protein designated Bos taurus PDZ containing 7 which has an N-terminal PDZ domain and a C-terminal harmonin_N_like domain; however the characterized human PDZ containing 7 containing two PDZ domains does not appear to contain a harmonin_N_like domain. Probab=29.10 E-value=28 Score=17.68 Aligned_cols=18 Identities=28% Similarity=0.597 Sum_probs=15.7 Q ss_pred HHHHHHHHHCCHHHHHHC Q ss_conf 899999720480045411 Q gi|254780851|r 46 NWLREVVGKIRPSDMSRV 63 (64) Q Consensus 46 nwlrevvgkirpsdmsrv 63 (64) --|||+-|-|-|+|.+|. T Consensus 55 lLLreIR~~isP~DL~~F 72 (78) T cd07358 55 LLLRDIRSVVTPTDLGRF 72 (78) T ss_pred HHHHHHHCCCCHHHHHHH T ss_conf 999999704787468786 No 5 >KOG4309 consensus Probab=24.77 E-value=23 Score=18.10 Aligned_cols=16 Identities=44% Similarity=1.014 Sum_probs=13.7 Q ss_pred HHHHHCCCCCEEEEEC Q ss_conf 7553224333200002 Q gi|254780851|r 24 LQKIETKDDKFEYCDV 39 (64) Q Consensus 24 lqkietkddkfeycdv 39 (64) -.|||+....|+|||- T Consensus 109 a~KIE~rG~ry~Y~Df 124 (217) T KOG4309 109 ASKIETRGTRYQYCDF 124 (217) T ss_pred CCCEEECCCEEEECCE T ss_conf 5404661433443115 No 6 >TIGR01116 ATPase-IIA1_Ca calcium-translocating P-type ATPase, SERCA-type; InterPro: IPR005782 This model describes Ca2+ ATPases (3.6.3.8 from EC) from eukaryotes and includes significant representatives from plants. Plasma membrane Ca2+ ATPases are primarily responsible for extrusion of calcium from cytoplasmic milieu to outside, coupled to the hydrolyis of ATP. Besides Ca2+ ATPases, Na+/Ca2+ exchangers are also involved in the maintenance of Ca2+ homestasis in the cell. ; GO: 0005388 calcium-transporting ATPase activity, 0006816 calcium ion transport, 0016021 integral to membrane. Probab=23.86 E-value=24 Score=18.07 Aligned_cols=10 Identities=60% Similarity=1.029 Sum_probs=6.2 Q ss_pred HHHHHHHHHH Q ss_conf 9998764235 Q gi|254780851|r 10 RWVNLVTGKI 19 (64) Q Consensus 10 rwvnlvtgki 19 (64) -||||||--. T Consensus 640 LWVNLVTDGL 649 (800) T TIGR01116 640 LWVNLVTDGL 649 (800) T ss_pred HHHHHHCCCC T ss_conf 0011111777 No 7 >smart00615 EPH_lbd Ephrin receptor ligand binding domain. Probab=20.09 E-value=30 Score=17.54 Aligned_cols=21 Identities=33% Similarity=0.839 Sum_probs=17.1 Q ss_pred CCEEEEECCCCCHHHHHHHHH Q ss_conf 332000020771468999997 Q gi|254780851|r 32 DKFEYCDVWNGQTRNWLREVV 52 (64) Q Consensus 32 dkfeycdvwngqtrnwlrevv 52 (64) --|.-|+|-++...||||--- T Consensus 38 rtyqvC~v~~~~qnNWLrT~~ 58 (177) T smart00615 38 RTYQVCNVQEGNQNNWLRTNF 58 (177) T ss_pred EEEEECCCCCCCCCCCCCCCC T ss_conf 899878889888875311477 No 8 >KOG0227 consensus Probab=19.18 E-value=51 Score=16.27 Aligned_cols=20 Identities=30% Similarity=0.504 Sum_probs=15.7 Q ss_pred HHHHHHHHHHCCCCCEEEEE Q ss_conf 56667755322433320000 Q gi|254780851|r 19 IANLYLQKIETKDDKFEYCD 38 (64) Q Consensus 19 ianlylqkietkddkfeycd 38 (64) +.+-|.|++|++|.+|.|-- T Consensus 151 fmssyeq~ve~~dk~~qyLv 170 (222) T KOG0227 151 FMSSYEQKVEPPDKSWQYLV 170 (222) T ss_pred HHHHHHHHCCCCCCCCEEEE T ss_conf 24566762577566503899 No 9 >PHA02078 hypothetical protein Probab=17.88 E-value=54 Score=16.14 Aligned_cols=10 Identities=60% Similarity=1.245 Sum_probs=8.3 Q ss_pred CCCHHHHHHH Q ss_conf 9302788999 Q gi|254780851|r 1 MLFWRREIYR 10 (64) Q Consensus 1 mlfwrreiyr 10 (64) |+-|.||||- T Consensus 30 MiPWEReiYv 39 (57) T PHA02078 30 MMPWEREIYA 39 (57) T ss_pred CCCHHHHHHH T ss_conf 2748999999 No 10 >KOG1915 consensus Probab=17.81 E-value=68 Score=15.62 Aligned_cols=14 Identities=50% Similarity=1.298 Sum_probs=11.8 Q ss_pred CCHHHHHHHHHHHH Q ss_conf 30278899999876 Q gi|254780851|r 2 LFWRREIYRWVNLV 15 (64) Q Consensus 2 lfwrreiyrwvnlv 15 (64) -+|+|-||-|.|.. T Consensus 359 r~W~RYIYLWinYa 372 (677) T KOG1915 359 RYWRRYIYLWINYA 372 (677) T ss_pred HHHHHHHHHHHHHH T ss_conf 88999999999999 Done!