BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] gi|254040528|gb|ACT57324.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] Length = 64 Score = 123 bits (310), Expect = 6e-27, Method: Composition-based stats. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM 60 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM Sbjct: 1 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM 60 Query: 61 SRVC 64 SRVC Sbjct: 61 SRVC 64 >gi|3378222|gb|AAC28473.1| T cell receptor gamma V-J region [Canis lupus familiaris] Length = 136 Score = 33.4 bits (75), Expect = 9.4, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Query: 21 NLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDMSRV 63 NL LQK+E D+ YC W W +V+G P + RV Sbjct: 44 NLLLQKLEKSDEGVYYCAAWEALRHGWYNKVLG---PGTILRV 83 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.326 0.140 0.478 Lambda K H 0.267 0.0441 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 833,075,286 Number of Sequences: 14124377 Number of extensions: 30180451 Number of successful extensions: 103627 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 103619 Number of HSP's gapped (non-prelim): 9 length of query: 64 length of database: 4,842,793,630 effective HSP length: 36 effective length of query: 28 effective length of database: 4,334,316,058 effective search space: 121360849624 effective search space used: 121360849624 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.8 bits)