RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, signal, transferase, phosphorylation, transmembrane, tyrosine- protein kinase; HET: NAG; 2.50A {Homo sapiens} Length = 536 Score = 25.8 bits (56), Expect = 2.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 34 FEYCDVWNGQTRNWLR 49 + C+V +G NWLR Sbjct: 72 YSVCNVMSGDQDNWLR 87 >3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} Length = 255 Score = 23.9 bits (51), Expect = 8.3 Identities = 13/42 (30%), Positives = 13/42 (30%), Gaps = 4/42 (9%) Query: 18 KIANLYLQKIETKDDK-FEYCDVWNGQTRNWLREVVGKIRPS 58 NLY Q D K D N V KI PS Sbjct: 14 GTENLYFQSNAMNDPKVIVALDYDN---LADALAFVDKIDPS 52 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.326 0.140 0.478 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 641,191 Number of extensions: 22181 Number of successful extensions: 98 Number of sequences better than 10.0: 1 Number of HSP's gapped: 98 Number of HSP's successfully gapped: 12 Length of query: 64 Length of database: 5,693,230 Length adjustment: 35 Effective length of query: 29 Effective length of database: 4,844,690 Effective search space: 140496010 Effective search space used: 140496010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.3 bits)