BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] Length = 64 Score = 134 bits (336), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM 60 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM Sbjct: 1 MLFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRNWLREVVGKIRPSDM 60 Query: 61 SRVC 64 SRVC Sbjct: 61 SRVC 64 >gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] Length = 165 Score = 26.2 bits (56), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 10/60 (16%) Query: 5 RREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRN----------WLREVVGK 54 + EIYR +N +T + L ++E D F + N +N + +E+ GK Sbjct: 52 KNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGK 111 >gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 556 Score = 23.1 bits (48), Expect = 1.0, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 32 DKFEYCDVWNGQTRNWLREVVGKIRP 57 D+F Y G+ W+ E+ G + P Sbjct: 11 DRFNYLKNQRGELNYWMEELTGFLYP 36 >gi|254781043|ref|YP_003065456.1| succinate dehydrogenase flavoprotein subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 611 Score = 21.9 bits (45), Expect = 2.3, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 4 WRREIYRWVNLVTGKI 19 WR+ WV+ TGKI Sbjct: 568 WRKHSLCWVDWNTGKI 583 >gi|254780604|ref|YP_003065017.1| 5-aminolevulinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 401 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 27 IETKDDKFEYCDVWNGQTRN 46 IE FE C + G TRN Sbjct: 65 IENAQRTFEKCGIGAGGTRN 84 >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 20.8 bits (42), Expect = 5.0, Method: Compositional matrix adjust. Identities = 8/43 (18%), Positives = 24/43 (55%) Query: 2 LFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQT 44 +FW + + W++++ ++N+Y Q + +K + ++ + T Sbjct: 1 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMT 43 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.4 bits (41), Expect = 5.3, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Query: 11 WVNLVTGKIANLYLQKIETKDD 32 +VNL++G + Y QK +DD Sbjct: 724 YVNLISGTLRTNYFQK--NQDD 743 >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 20.0 bits (40), Expect = 8.4, Method: Composition-based stats. Identities = 5/10 (50%), Positives = 7/10 (70%) Query: 38 DVWNGQTRNW 47 D+WN +NW Sbjct: 175 DLWNRNNQNW 184 >gi|254780463|ref|YP_003064876.1| putative peptidoglycan binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 19.6 bits (39), Expect = 9.1, Method: Composition-based stats. Identities = 5/20 (25%), Positives = 15/20 (75%) Query: 43 QTRNWLREVVGKIRPSDMSR 62 + +NW+++V+G+ + +S+ Sbjct: 32 RIKNWIQKVIGEEKNKPLSQ 51 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.140 0.478 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,647 Number of Sequences: 1233 Number of extensions: 1346 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 64 length of database: 328,796 effective HSP length: 35 effective length of query: 29 effective length of database: 285,641 effective search space: 8283589 effective search space used: 8283589 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)