HHsearch alignment for GI: 254780852 and conserved domain: PRK07928

>PRK07928 NADH dehydrogenase subunit A; Validated.
Probab=100.00  E-value=0  Score=268.48  Aligned_cols=117  Identities=38%  Similarity=0.821  Sum_probs=114.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHCHHHHHCHHCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65379999999999999999999999715678983241744431300043476--6524799999999998759999979
Q gi|254780852|r    5 LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV--KFDIRFCLVSVLFVIFDLEIAFLFP   82 (121)
Q Consensus         5 ~~~y~~ili~~~~~~~~~~~~~~~s~~l~~~~~~~~K~s~yECGf~p~~~~~~--~Fsi~fyliallFliFDvEiv~l~P   82 (121)
T Consensus         1 M~~y~~ili~~~~~~~~~~~~l~~s~ll~p~~~~~~K~spYEcG~~p~~~~~~~~rF~vrfYlvAilFliFDvE~~fL~P   80 (119)
T PRK07928          1 MNLYIPILVLGALAAAFAVVSVVIASLVGPKRYNRAKLEAYECGIEPTPQPAGGQRFPVKYYLTAMLFIVFDIEIVFLYP   80 (119)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             97389999999999999999999999947899995558867899897777776662225507799999999999999989


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             999960243899999999999999999999983575789
Q gi|254780852|r   83 WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD  121 (121)
Q Consensus        83 w~~~~~~~~~~~~~~~~~F~~iL~~gl~yew~~G~L~W~  121 (121)
T Consensus        81 wav~~~~lg~~~~~~m~iFl~iL~~Gl~Y~w~kGaL~We  119 (119)
T PRK07928         81 WAVSFDALGVFGLVEMALFMLTVFVAYAYVWRRGGLEWD  119 (119)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             999825465999999999999999999999973656889