BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (121 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040529|gb|ACT57325.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 121

 Score =  239 bits (611), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD
Sbjct: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW
Sbjct: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|315122726|ref|YP_004063215.1| NADH dehydrogenase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496128|gb|ADR52727.1| NADH dehydrogenase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 121

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/121 (90%), Positives = 117/121 (96%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLLTSYAPILVF+AIASAIVI LMISPF+VAFKSPDPEKLSTYECGFDPFD A +KFD
Sbjct: 1   MNDLLTSYAPILVFIAIASAIVIALMISPFLVAFKSPDPEKLSTYECGFDPFDSAHMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RFCLVSVLF+IFDLEIAFLFPWAVYFK+I WLGFGSMMVFLGILTVGFIYEWKKGALEW
Sbjct: 61  VRFCLVSVLFIIFDLEIAFLFPWAVYFKKIGWLGFGSMMVFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|110633376|ref|YP_673584.1| NADH dehydrogenase subunit A [Mesorhizobium sp. BNC1]
 gi|110284360|gb|ABG62419.1| NADH dehydrogenase subunit A [Chelativorans sp. BNC1]
          Length = 121

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/121 (72%), Positives = 109/121 (90%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLL+SY PI++FM +A AI +VL+I+PFIVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNDLLSSYLPIIIFMGVALAICLVLLIAPFIVAYRNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F +I W GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWFGFWSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|153009752|ref|YP_001370967.1| NADH dehydrogenase subunit A [Ochrobactrum anthropi ATCC 49188]
 gi|239831686|ref|ZP_04680015.1| NADH-quinone oxidoreductase subunit A [Ochrobactrum intermedium LMG
           3301]
 gi|151561640|gb|ABS15138.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ochrobactrum
           anthropi ATCC 49188]
 gi|239823953|gb|EEQ95521.1| NADH-quinone oxidoreductase subunit A [Ochrobactrum intermedium LMG
           3301]
          Length = 121

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 106/121 (87%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ IA  I + L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGIAMVIGVALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F +I W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWFGFASMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254501694|ref|ZP_05113845.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Labrenzia alexandrii DFL-11]
 gi|222437765|gb|EEE44444.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Labrenzia alexandrii DFL-11]
          Length = 127

 Score =  186 bits (473), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ IA  I + L+ISPF++A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 7   MEELLREYIPIVVFIGIALVIGLALLISPFLIAYKNPDPEKLSAYECGFNAFDDARMKFD 66

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLE+AFLFPWAV F ++ W G+GSMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 67  IRFYLVAILFIIFDLEVAFLFPWAVSFGELGWYGYGSMMVFLGVLTVGFIYEWKKGALEW 126

Query: 121 D 121
           D
Sbjct: 127 D 127


>gi|17987441|ref|NP_540075.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|62289751|ref|YP_221544.1| NADH dehydrogenase subunit A [Brucella abortus bv. 1 str. 9-941]
 gi|82699679|ref|YP_414253.1| NADH dehydrogenase subunit A [Brucella melitensis biovar Abortus
           2308]
 gi|148560084|ref|YP_001258780.1| NADH dehydrogenase subunit A [Brucella ovis ATCC 25840]
 gi|189023996|ref|YP_001934764.1| NADH dehydrogenase subunit A [Brucella abortus S19]
 gi|225627299|ref|ZP_03785336.1| NADH-quinone oxidoreductase subunit A [Brucella ceti str. Cudo]
 gi|225852318|ref|YP_002732551.1| NADH dehydrogenase subunit A [Brucella melitensis ATCC 23457]
 gi|237815238|ref|ZP_04594236.1| NADH-quinone oxidoreductase subunit A [Brucella abortus str. 2308
           A]
 gi|254689058|ref|ZP_05152312.1| NADH dehydrogenase subunit A [Brucella abortus bv. 6 str. 870]
 gi|254693540|ref|ZP_05155368.1| NADH dehydrogenase subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|254697192|ref|ZP_05159020.1| NADH dehydrogenase subunit A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701570|ref|ZP_05163398.1| NADH dehydrogenase subunit A [Brucella suis bv. 5 str. 513]
 gi|254706983|ref|ZP_05168811.1| NADH dehydrogenase subunit A [Brucella pinnipedialis M163/99/10]
 gi|254709910|ref|ZP_05171721.1| NADH dehydrogenase subunit A [Brucella pinnipedialis B2/94]
 gi|254713911|ref|ZP_05175722.1| NADH dehydrogenase subunit A [Brucella ceti M644/93/1]
 gi|254717031|ref|ZP_05178842.1| NADH dehydrogenase subunit A [Brucella ceti M13/05/1]
 gi|254718911|ref|ZP_05180722.1| NADH dehydrogenase subunit A [Brucella sp. 83/13]
 gi|254730088|ref|ZP_05188666.1| NADH dehydrogenase subunit A [Brucella abortus bv. 4 str. 292]
 gi|256031403|ref|ZP_05445017.1| NADH dehydrogenase subunit A [Brucella pinnipedialis M292/94/1]
 gi|256044481|ref|ZP_05447385.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060914|ref|ZP_05451072.1| NADH dehydrogenase subunit A [Brucella neotomae 5K33]
 gi|256113332|ref|ZP_05454194.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 3 str. Ether]
 gi|256159524|ref|ZP_05457292.1| NADH dehydrogenase subunit A [Brucella ceti M490/95/1]
 gi|256254811|ref|ZP_05460347.1| NADH dehydrogenase subunit A [Brucella ceti B1/94]
 gi|256257307|ref|ZP_05462843.1| NADH dehydrogenase subunit A [Brucella abortus bv. 9 str. C68]
 gi|256264183|ref|ZP_05466715.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369234|ref|YP_003106742.1| NADH dehydrogenase alpha subunit [Brucella microti CCM 4915]
 gi|260168537|ref|ZP_05755348.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|260545499|ref|ZP_05821240.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella abortus NCTC
           8038]
 gi|260563835|ref|ZP_05834321.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260754556|ref|ZP_05866904.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 6 str. 870]
 gi|260757777|ref|ZP_05870125.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 4 str. 292]
 gi|260761602|ref|ZP_05873945.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260883583|ref|ZP_05895197.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 9 str. C68]
 gi|261213805|ref|ZP_05928086.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 3 str. Tulya]
 gi|261218838|ref|ZP_05933119.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M13/05/1]
 gi|261221992|ref|ZP_05936273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           B1/94]
 gi|261314446|ref|ZP_05953643.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261317456|ref|ZP_05956653.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis B2/94]
 gi|261321663|ref|ZP_05960860.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M644/93/1]
 gi|261324914|ref|ZP_05964111.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           neotomae 5K33]
 gi|261752123|ref|ZP_05995832.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 5 str. 513]
 gi|261758010|ref|ZP_06001719.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|265983898|ref|ZP_06096633.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella sp.
           83/13]
 gi|265988492|ref|ZP_06101049.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M292/94/1]
 gi|265990905|ref|ZP_06103462.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265994742|ref|ZP_06107299.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 3 str. Ether]
 gi|265997956|ref|ZP_06110513.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M490/95/1]
 gi|297248156|ref|ZP_06931874.1| NADH dehydrogenase I subunit A [Brucella abortus bv. 5 str. B3196]
 gi|306838241|ref|ZP_07471093.1| NADH dehydrogenase subunit A [Brucella sp. NF 2653]
 gi|306841960|ref|ZP_07474637.1| NADH dehydrogenase subunit A [Brucella sp. BO2]
 gi|306843739|ref|ZP_07476338.1| NADH dehydrogenase subunit A [Brucella sp. BO1]
 gi|17983134|gb|AAL52339.1| NADH-quinone oxidoreductase chain a [Brucella melitensis bv. 1 str.
           16M]
 gi|62195883|gb|AAX74183.1| NuoA, NADH dehydrogenase I, A subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615780|emb|CAJ10778.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           melitensis biovar Abortus 2308]
 gi|148371341|gb|ABQ61320.1| NADH dehydrogenase I, A subunit [Brucella ovis ATCC 25840]
 gi|189019568|gb|ACD72290.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           abortus S19]
 gi|225617304|gb|EEH14349.1| NADH-quinone oxidoreductase subunit A [Brucella ceti str. Cudo]
 gi|225640683|gb|ACO00597.1| NADH-quinone oxidoreductase subunit A [Brucella melitensis ATCC
           23457]
 gi|237790075|gb|EEP64285.1| NADH-quinone oxidoreductase subunit A [Brucella abortus str. 2308
           A]
 gi|255999394|gb|ACU47793.1| NADH dehydrogenase alpha subunit [Brucella microti CCM 4915]
 gi|260096906|gb|EEW80781.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella abortus NCTC
           8038]
 gi|260153851|gb|EEW88943.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260668095|gb|EEX55035.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 4 str. 292]
 gi|260672034|gb|EEX58855.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260674664|gb|EEX61485.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 6 str. 870]
 gi|260873111|gb|EEX80180.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 9 str. C68]
 gi|260915412|gb|EEX82273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 3 str. Tulya]
 gi|260920576|gb|EEX87229.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           B1/94]
 gi|260923927|gb|EEX90495.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M13/05/1]
 gi|261294353|gb|EEX97849.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M644/93/1]
 gi|261296679|gb|EEY00176.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis B2/94]
 gi|261300894|gb|EEY04391.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           neotomae 5K33]
 gi|261303472|gb|EEY06969.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261737994|gb|EEY25990.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|261741876|gb|EEY29802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 5 str. 513]
 gi|262552424|gb|EEZ08414.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M490/95/1]
 gi|262765855|gb|EEZ11644.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001689|gb|EEZ14264.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094401|gb|EEZ18246.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660689|gb|EEZ30950.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M292/94/1]
 gi|264662490|gb|EEZ32751.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella sp.
           83/13]
 gi|297175325|gb|EFH34672.1| NADH dehydrogenase I subunit A [Brucella abortus bv. 5 str. B3196]
 gi|306275930|gb|EFM57643.1| NADH dehydrogenase subunit A [Brucella sp. BO1]
 gi|306287951|gb|EFM59362.1| NADH dehydrogenase subunit A [Brucella sp. BO2]
 gi|306406685|gb|EFM62912.1| NADH dehydrogenase subunit A [Brucella sp. NF 2653]
 gi|326408825|gb|ADZ65890.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           melitensis M28]
 gi|326538541|gb|ADZ86756.1| NADH-quinone oxidoreductase subunit A [Brucella melitensis M5-90]
          Length = 121

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|23501689|ref|NP_697816.1| NADH dehydrogenase subunit A [Brucella suis 1330]
 gi|161618766|ref|YP_001592653.1| NADH dehydrogenase subunit A [Brucella canis ATCC 23365]
 gi|163843075|ref|YP_001627479.1| NADH dehydrogenase subunit A [Brucella suis ATCC 23445]
 gi|254704117|ref|ZP_05165945.1| NADH dehydrogenase subunit A [Brucella suis bv. 3 str. 686]
 gi|260566634|ref|ZP_05837104.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella suis bv. 4
           str. 40]
 gi|261754783|ref|ZP_05998492.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 3 str. 686]
 gi|23347611|gb|AAN29731.1| NADH dehydrogenase I, A subunit [Brucella suis 1330]
 gi|161335577|gb|ABX61882.1| NADH-quinone oxidoreductase chain A [Brucella canis ATCC 23365]
 gi|163673798|gb|ABY37909.1| NADH-quinone oxidoreductase chain A [Brucella suis ATCC 23445]
 gi|260156152|gb|EEW91232.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella suis bv. 4
           str. 40]
 gi|261744536|gb|EEY32462.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 3 str. 686]
          Length = 121

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF++A++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLIAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|222148274|ref|YP_002549231.1| NADH dehydrogenase subunit A [Agrobacterium vitis S4]
 gi|221735262|gb|ACM36225.1| NADH ubiquinone oxidoreductase chain A [Agrobacterium vitis S4]
          Length = 124

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 88/121 (72%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI+VF+ IA  I I L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 4   MTELLSSYLPIVVFVGIAMVIGIALLVTPFAVAFKAPDSEKLSAYECGFNAFDDARIKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 64  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|294852159|ref|ZP_06792832.1| NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-0026]
 gi|294820748|gb|EFG37747.1| NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-0026]
          Length = 121

 Score =  183 bits (465), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKG LEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGVLEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254469811|ref|ZP_05083216.1| NADH-quinone oxidoreductase chain a [Pseudovibrio sp. JE062]
 gi|211961646|gb|EEA96841.1| NADH-quinone oxidoreductase chain a [Pseudovibrio sp. JE062]
          Length = 121

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI+VF+ +A  I + L+I+PFIVAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYIPIVVFIGVALVIGLALLIAPFIVAFKNPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVAFGDLGWFGFVSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|118590039|ref|ZP_01547443.1| NADH dehydrogenase subunit A [Stappia aggregata IAM 12614]
 gi|118437536|gb|EAV44173.1| NADH dehydrogenase subunit A [Stappia aggregata IAM 12614]
          Length = 121

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ IA  I + L+ISPFI+A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYVPIVVFIGIALVIGLALLISPFILAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWATVFGDLGWYGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|163759543|ref|ZP_02166628.1| NADH dehydrogenase subunit A [Hoeflea phototrophica DFL-43]
 gi|162283140|gb|EDQ33426.1| NADH dehydrogenase subunit A [Hoeflea phototrophica DFL-43]
          Length = 121

 Score =  181 bits (459), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL +Y PI +F+ +A  I + L+I+PF +A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGAYVPIAIFIGLALVIGLALLIAPFAIAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F +I W+GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWIGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|222085575|ref|YP_002544105.1| NADH-ubiquinone oxidoreductase chain A protein [Agrobacterium
           radiobacter K84]
 gi|221723023|gb|ACM26179.1| NADH-ubiquinone oxidoreductase chain A protein [Agrobacterium
           radiobacter K84]
          Length = 122

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTGLLSSYIPIAIFIGIAVVIGLALLITPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I WLGF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFSAIGWLGFWSMMVFLAVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|307942117|ref|ZP_07657468.1| NADH-quinone oxidoreductase subunit a 1 [Roseibium sp. TrichSKD4]
 gi|307774403|gb|EFO33613.1| NADH-quinone oxidoreductase subunit a 1 [Roseibium sp. TrichSKD4]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ I+  I + L+ISPFIVA+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEELLRDYIPIVVFIGISLVIGLALLISPFIVAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  + W GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVVFGDLGWYGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|75676079|ref|YP_318500.1| NADH dehydrogenase subunit A [Nitrobacter winogradskyi Nb-255]
 gi|74420949|gb|ABA05148.1| NADH dehydrogenase subunit A [Nitrobacter winogradskyi Nb-255]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ IA+AI + L+++PFIVA+K PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGIAAAIGVALLVAPFIVAYKQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLGVAGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|319408579|emb|CBI82234.1| NADH dehydrogenase I chain A [Bartonella schoenbuchensis R1]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I   L+I+P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTHLLSSYLPVLIFIIVSAVIAGALLITPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLEIAFLFPWAV F  I  LGF SMM+FL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEIAFLFPWAVSFGSIGMLGFWSMMMFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|304391398|ref|ZP_07373340.1| NADH-quinone oxidoreductase subunit a 1 [Ahrensia sp. R2A130]
 gi|303295627|gb|EFL89985.1| NADH-quinone oxidoreductase subunit a 1 [Ahrensia sp. R2A130]
          Length = 121

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL SY P+L+FM +A  I + L+ISPFI+A ++PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MDDLLYSYLPVLIFMGVALFIGLALLISPFIIAHRAPDDEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  + W GF SMM FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSFGTLGWFGFWSMMTFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|15965017|ref|NP_385370.1| NADH dehydrogenase subunit A [Sinorhizobium meliloti 1021]
 gi|307301089|ref|ZP_07580858.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
 gi|307317823|ref|ZP_07597261.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|6647654|sp|O68852|NUOA1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|3025801|gb|AAC12754.1| NADH-ubiquinone oxidoreductase subunit NuoA [Sinorhizobium
           meliloti]
 gi|5650734|emb|CAB51620.1| nuoA1 [Sinorhizobium meliloti]
 gi|15074196|emb|CAC45843.1| NADH dehydrogenase I chain A [Sinorhizobium meliloti 1021]
 gi|306896585|gb|EFN27333.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|306904044|gb|EFN34630.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
          Length = 121

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK++ W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|150396111|ref|YP_001326578.1| NADH dehydrogenase subunit A [Sinorhizobium medicae WSM419]
 gi|150027626|gb|ABR59743.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           medicae WSM419]
          Length = 121

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK I W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFKAIGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|328543685|ref|YP_004303794.1| NADH-quinone oxidoreductase subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326413429|gb|ADZ70492.1| NADH-quinone oxidoreductase subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 121

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI VF+ I+  I + L++SPF++A+  PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLRDYLPIAVFIGISLVIGLALLVSPFLLAYSKPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVVFGDLGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|15888597|ref|NP_354278.1| NADH dehydrogenase subunit A [Agrobacterium tumefaciens str. C58]
 gi|15156317|gb|AAK87063.1| NADH ubiquinone oxidoreductase chain A [Agrobacterium tumefaciens
           str. C58]
          Length = 121

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 103/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VA+K+PDPEKLS +ECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAYKAPDPEKLSAFECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F ++ W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGEMGWFGFWSMMVFLAVLTIGFIYEWKKGALEW 120


>gi|227821617|ref|YP_002825587.1| NADH dehydrogenase subunit A [Sinorhizobium fredii NGR234]
 gi|227340616|gb|ACP24834.1| NADH dehydrogenase I chain A [Sinorhizobium fredii NGR234]
          Length = 121

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F ++ W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGELGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|163850517|ref|YP_001638560.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium extorquens PA1]
 gi|188580285|ref|YP_001923730.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium populi BJ001]
 gi|218529214|ref|YP_002420030.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium chloromethanicum CM4]
 gi|240137582|ref|YP_002962053.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens AM1]
 gi|163662122|gb|ABY29489.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium extorquens PA1]
 gi|179343783|gb|ACB79195.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium populi BJ001]
 gi|218521517|gb|ACK82102.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium chloromethanicum CM4]
 gi|240007550|gb|ACS38776.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens AM1]
          Length = 121

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L+I+PFIVA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIIFLGVSLFIAVALLIAPFIVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F ++ W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGELGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|170742511|ref|YP_001771166.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium sp. 4-46]
 gi|168196785|gb|ACA18732.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium sp. 4-46]
          Length = 121

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LLT Y P+++F+ ++  I + L+++PF+VA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGLLTDYLPLVIFIGVSLVIALALLVAPFLVAYNSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|327188487|gb|EGE55701.1| NADH ubiquinone oxidoreductase chain A [Rhizobium etli CNPAF512]
          Length = 124

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 4   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 64  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|190891285|ref|YP_001977827.1| NADH-ubiquinone oxidoreductase, chain A [Rhizobium etli CIAT 652]
 gi|190696564|gb|ACE90649.1| NADH-ubiquinone oxidoreductase protein, chain A [Rhizobium etli
           CIAT 652]
          Length = 121

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|163868373|ref|YP_001609582.1| NADH dehydrogenase subunit A [Bartonella tribocorum CIP 105476]
 gi|161018029|emb|CAK01587.1| NADH dehydrogenase I chain A [Bartonella tribocorum CIP 105476]
          Length = 121

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I  VL+I+P+IVA++SPDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MAYLLSSYLPVLIFIIVSAVIAGVLLITPYIVAYRSPDPEKLSAYECGFNSFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV FK I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFKSIGMFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|325292632|ref|YP_004278496.1| NADH dehydrogenase I, A subunit [Agrobacterium sp. H13-3]
 gi|325060485|gb|ADY64176.1| NADH dehydrogenase I, A subunit [Agrobacterium sp. H13-3]
          Length = 121

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VA+K+PDPEKLS +ECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAYKAPDPEKLSAFECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGDMGWFGFWSMMVFLAVLTIGFIYEWKKGALEW 120


>gi|254560053|ref|YP_003067148.1| NADH-quinone oxidoreductase subunit A [Methylobacterium extorquens
           DM4]
 gi|254267331|emb|CAX23163.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens DM4]
          Length = 121

 Score =  175 bits (444), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I   L+I+PFIVA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIIFLGVSLFIAAALLIAPFIVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F ++ W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGELGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|85717030|ref|ZP_01047992.1| NADH dehydrogenase alpha subunit [Nitrobacter sp. Nb-311A]
 gi|85696154|gb|EAQ34050.1| NADH dehydrogenase alpha subunit [Nitrobacter sp. Nb-311A]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ IA+ I  VL+I+PF+VA+K PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGIAAVIGAVLLIAPFVVAYKQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLGVTGFWSMIVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|170748478|ref|YP_001754738.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655000|gb|ACB24055.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium radiotolerans JCM 2831]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P++VF+ +A  I   L++ PF+VAFKSPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIVFIGVALFIATALLVVPFLVAFKSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SM+VFLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMIVFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|114707367|ref|ZP_01440264.1| NADH dehydrogenase alpha subunit [Fulvimarina pelagi HTCC2506]
 gi|114537248|gb|EAU40375.1| NADH dehydrogenase alpha subunit [Fulvimarina pelagi HTCC2506]
          Length = 121

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LLTSY PI++F+ I   I + L++SPF++A+KSPD EKLS YECGFD FDD+R+KFD
Sbjct: 1   MEELLTSYLPIVIFVGICLVIGLALLVSPFLLAYKSPDDEKLSAYECGFDAFDDSRMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F ++ W G  SMM FLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAASFGEVGWFGLWSMMFFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|13471407|ref|NP_102973.1| NADH dehydrogenase subunit A [Mesorhizobium loti MAFF303099]
 gi|260462230|ref|ZP_05810474.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|319782981|ref|YP_004142457.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|14022149|dbj|BAB48759.1| NADH-ubiquinone dehydrogenase chain A 1 [Mesorhizobium loti
           MAFF303099]
 gi|259032090|gb|EEW33357.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|317168869|gb|ADV12407.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 121

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY PI++F+ +A  + + L+ +PF+VA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNALLSSYLPIVLFIGVALVVGLALLAAPFLVAYRNPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F +I  LGF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFSKIGMLGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|240850583|ref|YP_002971983.1| NADH dehydrogenase I subunit A [Bartonella grahamii as4aup]
 gi|240267706|gb|ACS51294.1| NADH dehydrogenase I subunit A [Bartonella grahamii as4aup]
          Length = 121

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I  VL+I+P+IVA++SPDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MAYLLSSYLPVLIFIIVSAVIAGVLLITPYIVAYRSPDPEKLSAYECGFNSFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F+ I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFESIGMFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|217979049|ref|YP_002363196.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocella
           silvestris BL2]
 gi|217504425|gb|ACK51834.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocella
           silvestris BL2]
          Length = 121

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P++VFMAIA  I   L+++PF+VAFK+PD EKLS YECGF+ FDDAR++FD
Sbjct: 1   MPSLLDQYLPLVVFMAIAGVISGALLVAPFLVAFKAPDSEKLSAYECGFNAFDDARMQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F Q+   GF +MM+FLGILTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVALLFIIFDLEVAFLFPWAVAFHQVGLFGFWAMMLFLGILTVGFVYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|298291847|ref|YP_003693786.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Starkeya
           novella DSM 506]
 gi|296928358|gb|ADH89167.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Starkeya
           novella DSM 506]
          Length = 121

 Score =  174 bits (440), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS LL  Y P+++F+ I++ I + L+++PF+VAF  PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MSSLLQDYLPVVIFIGISAVIGLALLVAPFLVAFSRPDPEKMSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA+ F+++   GF SMMVFL +LTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAITFRELGGFGFWSMMVFLAVLTVGFVYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|49475658|ref|YP_033699.1| NADH dehydrogenase subunit A [Bartonella henselae str. Houston-1]
 gi|49238465|emb|CAF27693.1| NADH dehydrogenase I, A subunit [Bartonella henselae str.
           Houston-1]
          Length = 121

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLL+SY P+L+F+ +++ I   L++ P+IVA++SPDPEKLS YECGF+ F+DAR+KFD
Sbjct: 1   MNDLLSSYLPVLIFIVVSAVIAGGLLVIPYIVAYRSPDPEKLSAYECGFNSFNDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGSIGMFGFWSMIIFLALLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|220924005|ref|YP_002499307.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium nodulans ORS 2060]
 gi|219948612|gb|ACL59004.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium nodulans ORS 2060]
          Length = 121

 Score =  173 bits (439), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+ Y P+++F+ ++  I + L+++PF+VA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGLLSDYLPLVIFIGVSLVIALALLVAPFLVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SMM FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMMFFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|209885051|ref|YP_002288908.1| NADH-quinone oxidoreductase subunit a [Oligotropha carboxidovorans
           OM5]
 gi|209873247|gb|ACI93043.1| NADH-quinone oxidoreductase subunit a [Oligotropha carboxidovorans
           OM5]
          Length = 121

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +L +Y P++VF+ +A+ I + L+I+PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGILQNYLPLVVFIGVAAVIGLALLIAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAAGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254510683|ref|ZP_05122750.1| NADH-quinone oxidoreductase chain 7 [Rhodobacteraceae bacterium
           KLH11]
 gi|221534394|gb|EEE37382.1| NADH-quinone oxidoreductase chain 7 [Rhodobacteraceae bacterium
           KLH11]
          Length = 121

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYLPILVFLAVAIGLGIVLILAAIVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|121602445|ref|YP_989070.1| NADH dehydrogenase subunit A [Bartonella bacilliformis KC583]
 gi|120614622|gb|ABM45223.1| NADH dehydrogenase (quinone), A subunit [Bartonella bacilliformis
           KC583]
          Length = 121

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL SY P+LVF+ +++ IV VL++ P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTHLLGSYLPVLVFIIVSAVIVGVLLVMPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL IL +GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFHSIGMFGFWSMILFLAILMIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|92117744|ref|YP_577473.1| NADH dehydrogenase subunit A [Nitrobacter hamburgensis X14]
 gi|91800638|gb|ABE63013.1| NADH dehydrogenase subunit A [Nitrobacter hamburgensis X14]
          Length = 121

 Score =  172 bits (437), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y P++VF+ IA+ I  VL+I+PFIVA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MGGILQNYLPLVVFIGIAAVIGAVLLIAPFIVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLDATGFWSMIVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|300023457|ref|YP_003756068.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525278|gb|ADJ23747.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 121

 Score =  172 bits (437), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DL + Y PI +F+ +A  I   LM++PF+VA+++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MVDLTSHYLPIAIFIGVALLIGAALMVAPFLVAYRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF++FDLEIAFLFPWAV FK I   GF SMM FLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIVFDLEIAFLFPWAVAFKDIGVFGFWSMMAFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|27380030|ref|NP_771559.1| NADH dehydrogenase subunit A [Bradyrhizobium japonicum USDA 110]
 gi|27353184|dbj|BAC50184.1| NADH ubiquinone oxidoreductase chain A [Bradyrhizobium japonicum
           USDA 110]
          Length = 121

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ +A  I +VL+I+PFIVAF+ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGVAGLIGLVLLIAPFIVAFQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMVVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|323138145|ref|ZP_08073218.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocystis
           sp. ATCC 49242]
 gi|322396607|gb|EFX99135.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocystis
           sp. ATCC 49242]
          Length = 121

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P+++F+A+++ I   L+++PF+ AFK+PDPEKLS YECGF+PF+D+R+KFD
Sbjct: 1   MPMLLEQYLPLVIFIALSAIIAGALLVAPFLFAFKAPDPEKLSAYECGFNPFNDSRMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF++FDLE+AFLFPWAV FK+    GF SMMVFLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVSLLFIVFDLEVAFLFPWAVAFKEAGAFGFWSMMVFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|49474177|ref|YP_032219.1| NADH dehydrogenase subunit A [Bartonella quintana str. Toulouse]
 gi|49239681|emb|CAF26056.1| NADH dehydrogenase I, A subunit [Bartonella quintana str. Toulouse]
          Length = 121

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+ +F+ +++ I  VL+I P++VA++SPDPEKLS YECGF+ F+DAR+KFD
Sbjct: 1   MTHLLSSYLPVFIFIVVSAVIAGVLLIMPYLVAYRSPDPEKLSAYECGFNSFNDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGSIGMFGFWSMIIFLALLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|299135033|ref|ZP_07028224.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Afipia sp.
           1NLS2]
 gi|298590010|gb|EFI50214.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Afipia sp.
           1NLS2]
          Length = 121

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y P++VF+ +A+ I + L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MGGILQNYLPLVVFIGVAAIIGLALLVAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++  +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|163732067|ref|ZP_02139513.1| NADH dehydrogenase subunit A [Roseobacter litoralis Och 149]
 gi|161394365|gb|EDQ18688.1| NADH dehydrogenase subunit A [Roseobacter litoralis Och 149]
          Length = 121

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|39936017|ref|NP_948293.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris CGA009]
 gi|192291672|ref|YP_001992277.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris TIE-1]
 gi|39649871|emb|CAE28393.1| NADH-ubiquinone dehydrogenase chain A [Rhodopseudomonas palustris
           CGA009]
 gi|192285421|gb|ACF01802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodopseudomonas palustris TIE-1]
          Length = 121

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L++Y PI+VF+ +A+ +  VL+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILSNYLPIVVFIIVAAGLSFVLLVAPFAVAYQQPDPEKLSAYECGFNAFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|316933891|ref|YP_004108873.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Rhodopseudomonas palustris DX-1]
 gi|315601605|gb|ADU44140.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodopseudomonas palustris DX-1]
          Length = 121

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L++Y PI+VF+ +A+ + + L+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILSNYLPIVVFIIVAAGLSLALLVAPFAVAYQQPDPEKLSAYECGFNAFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|319898882|ref|YP_004158975.1| NADH dehydrogenase I chain A [Bartonella clarridgeiae 73]
 gi|319402846|emb|CBI76397.1| NADH dehydrogenase I chain A [Bartonella clarridgeiae 73]
          Length = 121

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL+SY P+L+F+ +++ I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIDLLSSYLPVLIFITVSAIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASIGIFGFWSMILFLVILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|296444794|ref|ZP_06886757.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylosinus
           trichosporium OB3b]
 gi|296257742|gb|EFH04806.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylosinus
           trichosporium OB3b]
          Length = 121

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P+++F+A+A+ I   L+++PF++AFK+PDPEKLS YECGF+PF DAR+KFD
Sbjct: 1   MPGLLDQYLPLVIFIALAAIISGALLVAPFLIAFKAPDPEKLSAYECGFNPFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF++FDLE+AFLFPWAV FK+    GF SMM FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVALLFIVFDLEVAFLFPWAVAFKEAGAFGFWSMMFFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|146341115|ref|YP_001206163.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. ORS278]
 gi|148255915|ref|YP_001240500.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. BTAi1]
 gi|146193921|emb|CAL77938.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [Bradyrhizobium sp. ORS278]
 gi|146408088|gb|ABQ36594.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +L +Y P++VF+ +A+ I +VL+I+PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGILQNYLPLVVFIGVAAIIGVVLLIAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAAGFWSMLVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|110680472|ref|YP_683479.1| NADH dehydrogenase subunit A [Roseobacter denitrificans OCh 114]
 gi|109456588|gb|ABG32793.1| NADH-quinone oxidoreductase chain A [Roseobacter denitrificans OCh
           114]
          Length = 121

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|260434182|ref|ZP_05788153.1| NADH-quinone oxidoreductase chain 7 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418010|gb|EEX11269.1| NADH-quinone oxidoreductase chain 7 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 121

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDLSDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|56697624|ref|YP_167993.1| NADH dehydrogenase subunit A [Ruegeria pomeroyi DSS-3]
 gi|56679361|gb|AAV96027.1| NADH dehydrogenase I, A subunit [Ruegeria pomeroyi DSS-3]
          Length = 121

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+A+A+ + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAVAAGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|115524526|ref|YP_781437.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisA53]
 gi|115518473|gb|ABJ06457.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisA53]
          Length = 121

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y PI++F+ +A+A+  VL+++PFIVA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MGGILPNYLPIVIFIMVAAALSFVLLLAPFIVAYQQPDPEKLSAYECGFNAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMM+FLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMIFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|319404259|emb|CBI77852.1| NADH dehydrogenase I chain A [Bartonella rochalimae ATCC BAA-1498]
          Length = 121

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL SY P+L+F+ ++  I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLNSYLPVLIFIIVSVIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFSSIGIFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|259419080|ref|ZP_05742997.1| NADH-quinone oxidoreductase, a subunit [Silicibacter sp. TrichCH4B]
 gi|259345302|gb|EEW57156.1| NADH-quinone oxidoreductase, a subunit [Silicibacter sp. TrichCH4B]
          Length = 121

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254465758|ref|ZP_05079169.1| NADH dehydrogenase i, a subunit [Rhodobacterales bacterium Y4I]
 gi|206686666|gb|EDZ47148.1| NADH dehydrogenase i, a subunit [Rhodobacterales bacterium Y4I]
          Length = 121

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PI+VF+A+A+ + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPIMVFLAVAAGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|86749690|ref|YP_486186.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris HaA2]
 gi|91977357|ref|YP_570016.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisB5]
 gi|86572718|gb|ABD07275.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris HaA2]
 gi|91683813|gb|ABE40115.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisB5]
          Length = 121

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y PI+VF+ +A+ +  VL+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILPNYLPIVVFILVAAGLSFVLLVAPFAVAYQQPDPEKLSAYECGFNAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|99080582|ref|YP_612736.1| NADH dehydrogenase subunit A [Ruegeria sp. TM1040]
 gi|99036862|gb|ABF63474.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ruegeria sp.
           TM1040]
          Length = 121

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDAGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|319405698|emb|CBI79321.1| NADH dehydrogenase I chain A [Bartonella sp. AR 15-3]
          Length = 121

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL+SY PIL+F+AI+  I  VL+I P++VA+++PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLSSYLPILIFIAISVIITGVLLIIPYMVAYRAPDAEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASIGIFGFLSMIVFLTILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|163746196|ref|ZP_02153555.1| NADH dehydrogenase subunit A [Oceanibulbus indolifex HEL-45]
 gi|161380941|gb|EDQ05351.1| NADH dehydrogenase subunit A [Oceanibulbus indolifex HEL-45]
          Length = 121

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDHMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVSMVGFWSMMVFLGVLTAGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|126736074|ref|ZP_01751818.1| NADH-quinone oxidoreductase chain A [Roseobacter sp. CCS2]
 gi|126714631|gb|EBA11498.1| NADH-quinone oxidoreductase chain A [Roseobacter sp. CCS2]
          Length = 121

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L+ Y PI++F+ +A A+ ++L+++  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MQDMLSEYLPIMIFLGLAIALGLILILAAAIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F+ ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFQDVSMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|90423900|ref|YP_532270.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisB18]
 gi|90105914|gb|ABD87951.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y PI++F+ +A+ + + ++++PF+VA++ PDPEKLS YECGF  F DAR+KFD
Sbjct: 1   MSGILPNYLPIVIFIMVAAGLSVAMLVAPFVVAYQQPDPEKLSAYECGFTAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|114764718|ref|ZP_01443903.1| NADH dehydrogenase alpha subunit [Pelagibaca bermudensis HTCC2601]
 gi|114542918|gb|EAU45939.1| NADH dehydrogenase alpha subunit [Roseovarius sp. HTCC2601]
          Length = 121

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+ IA A+  +L+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLGIAVALGAILILAAVVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVSMVGFWSMMVFLGVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|158423291|ref|YP_001524583.1| NADH-ubiquinone dehydrogenase chain A 1 precursor [Azorhizobium
           caulinodans ORS 571]
 gi|158330180|dbj|BAF87665.1| NADH-ubiquinone dehydrogenase chain A 1 precursor [Azorhizobium
           caulinodans ORS 571]
          Length = 121

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L+++PFIVA+++PDPEKLS YECGF+ FDDAR+ FD
Sbjct: 1   MNALLMDYLPVVIFIGVSLVIGLALLVAPFIVAYQNPDPEKLSAYECGFNAFDDARMTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  +  LGF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGGLGDLGFWSMMLFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254476759|ref|ZP_05090145.1| NADH-quinone oxidoreductase chain a [Ruegeria sp. R11]
 gi|214031002|gb|EEB71837.1| NADH-quinone oxidoreductase chain a [Ruegeria sp. R11]
          Length = 121

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDAGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|126727141|ref|ZP_01742978.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126703569|gb|EBA02665.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 121

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +A  + +VL+ +  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDQLLAEYLPILVFLGLAIGLGLVLIFAALIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWAV FK +  LGF SM+VFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEIAFLFPWAVAFKDVGLLGFWSMIVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|86137601|ref|ZP_01056178.1| NADH dehydrogenase alpha subunit [Roseobacter sp. MED193]
 gi|85825936|gb|EAQ46134.1| NADH dehydrogenase alpha subunit [Roseobacter sp. MED193]
          Length = 121

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+ +A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLVVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|163738797|ref|ZP_02146211.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis BS107]
 gi|163741492|ref|ZP_02148883.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161385226|gb|EDQ09604.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161388125|gb|EDQ12480.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis BS107]
          Length = 121

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++  GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDAGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|154248552|ref|YP_001419510.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xanthobacter
           autotrophicus Py2]
 gi|154162637|gb|ABS69853.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xanthobacter
           autotrophicus Py2]
          Length = 121

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L++SPF+VA+++PDPEKLS YECGF+ FDDAR+ FD
Sbjct: 1   MNALLMDYLPVVIFIGVSLVIGLALLVSPFLVAYQNPDPEKLSAYECGFNAFDDARMTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            RF LV++LF+IFDLE+AFLFPWA+ F  +  LGF SMM FLG+LTVGFIYEW+KGALEW
Sbjct: 61  ARFYLVAILFIIFDLEVAFLFPWAIMFGGLGDLGFWSMMTFLGVLTVGFIYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|260427484|ref|ZP_05781463.1| NADH-quinone oxidoreductase, a subunit [Citreicella sp. SE45]
 gi|260421976|gb|EEX15227.1| NADH-quinone oxidoreductase, a subunit [Citreicella sp. SE45]
          Length = 121

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A A+  +L+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIALGAILILAAVVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWA  FK ++ +GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWATAFKDVSMVGFWSMMVFLAVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|159043856|ref|YP_001532650.1| NADH dehydrogenase subunit A [Dinoroseobacter shibae DFL 12]
 gi|157911616|gb|ABV93049.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Dinoroseobacter shibae DFL 12]
          Length = 121

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+AIA  + +VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAIAIGLGLVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F+ +  +GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFQDVGVVGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|83951738|ref|ZP_00960470.1| NADH dehydrogenase I, A subunit [Roseovarius nubinhibens ISM]
 gi|83836744|gb|EAP76041.1| NADH dehydrogenase I, A subunit [Roseovarius nubinhibens ISM]
          Length = 121

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+ +  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLIFAAIIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV FK ++ +GF SMMVFL +LT GF YEWKKGA+EW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFKDVSMVGFWSMMVFLAVLTAGFAYEWKKGAMEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254460751|ref|ZP_05074167.1| NADH-quinone oxidoreductase chain a [Rhodobacterales bacterium
           HTCC2083]
 gi|206677340|gb|EDZ41827.1| NADH-quinone oxidoreductase chain a [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 132

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           + D+   Y PIL+F+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 12  VEDIAREYLPILIFLAVAIGLGLVLILAAIVIAVRNPDPEKVSAYECGFNAFDDARMKFD 71

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMM+FL +LT GF YEWKKGALEW
Sbjct: 72  VRFYLVSILFIIFDLEIAFLFPWAVAFKDISMVGFWSMMIFLAVLTAGFAYEWKKGALEW 131

Query: 121 D 121
           +
Sbjct: 132 E 132


>gi|89053645|ref|YP_509096.1| NADH dehydrogenase subunit A [Jannaschia sp. CCS1]
 gi|88863194|gb|ABD54071.1| NADH dehydrogenase subunit A [Jannaschia sp. CCS1]
          Length = 121

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LLT YAPIL+F+ +A  + +VL+++  +VA  +PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MTELLTEYAPILIFLGLAIGLALVLILAAVVVAVSNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA  F  ++ L F SMMVFLG+LT+GF YEWKKGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEIAFLFPWATAFPGLSDLAFWSMMVFLGVLTIGFAYEWKKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|84502604|ref|ZP_01000723.1| NADH dehydrogenase alpha subunit [Oceanicola batsensis HTCC2597]
 gi|84388999|gb|EAQ01797.1| NADH dehydrogenase alpha subunit [Oceanicola batsensis HTCC2597]
          Length = 121

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y PILVF+A+A  + +V +I+  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEVMLREYLPILVFLAVAIGLGLVFIIAAVIIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV FK I+ +GF SMMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFKDISMVGFWSMMVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|83942675|ref|ZP_00955136.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. EE-36]
 gi|83953914|ref|ZP_00962635.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841859|gb|EAP81028.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83846768|gb|EAP84644.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. EE-36]
          Length = 121

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D++  Y PIL+F+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMMREYLPILLFLAVAIVLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDVSMAGFWSMMVFLAVLTAGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|254487784|ref|ZP_05100989.1| NADH-quinone oxidoreductase chain a [Roseobacter sp. GAI101]
 gi|214044653|gb|EEB85291.1| NADH-quinone oxidoreductase chain a [Roseobacter sp. GAI101]
          Length = 121

 Score =  165 bits (418), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +++  Y PIL+F+A+A  + +VL++S  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDEMMREYLPILIFLAVAVGLGLVLILSAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDVSMAGFWSMMVFLAVLTAGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|119384982|ref|YP_916038.1| NADH dehydrogenase subunit A [Paracoccus denitrificans PD1222]
 gi|119374749|gb|ABL70342.1| NADH dehydrogenase subunit A [Paracoccus denitrificans PD1222]
          Length = 121

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +ASA+ IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F  MMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASLSDVAFWGMMVFLAVLTVGFAYEWKKGALEW 120


>gi|310816716|ref|YP_003964680.1| NADH dehydrogenase subunit A [Ketogulonicigenium vulgare Y25]
 gi|308755451|gb|ADO43380.1| NADH dehydrogenase subunit A [Ketogulonicigenium vulgare Y25]
          Length = 121

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+F+ +A+ + I+L+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MGQLLQDYLPILIFLGLATVLGIILILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F SMMVFL +LT+GF+YEW+KGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFAGMSMVSFWSMMVFLAVLTIGFVYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|126729548|ref|ZP_01745361.1| NADH dehydrogenase subunit A [Sagittula stellata E-37]
 gi|126709667|gb|EBA08720.1| NADH dehydrogenase subunit A [Sagittula stellata E-37]
          Length = 121

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+AIA  I +V + +  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAIAIVIGLVFIFAAILVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV F+ I+   F +MMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFQHISMTAFWAMMVFLGVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|90417844|ref|ZP_01225756.1| NADH-ubiquinone oxidoreductase chain 7 [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337516|gb|EAS51167.1| NADH-ubiquinone oxidoreductase chain 7 [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 117

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (81%), Gaps = 4/121 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL SY PI++F+ +A  I + L++SPF++AFK+PD EKL    CGFD FDD+R+KFD
Sbjct: 1   MPELLASYLPIVIFVGVALLIGLALLVSPFLLAFKAPDDEKL----CGFDAFDDSRMKFD 56

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 57  VRFYLVSILFIIFDLEVAFLFPWAATFGTLGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 116

Query: 121 D 121
           D
Sbjct: 117 D 117


>gi|319407267|emb|CBI80906.1| NADH dehydrogenase I chain A [Bartonella sp. 1-1C]
          Length = 121

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL SY P+L+F+ I+  I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLNSYLPVLIFIIISVIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFSSIGIFGFWSMIVFLAILTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|126740376|ref|ZP_01756064.1| NADH dehydrogenase subunit A [Roseobacter sp. SK209-2-6]
 gi|126718512|gb|EBA15226.1| NADH dehydrogenase subunit A [Roseobacter sp. SK209-2-6]
          Length = 118

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (84%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A+ + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAAGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT+GF YEWKKGALEW+
Sbjct: 61  YLVSILFIIFDLEIAFLFPWAVGFQDMSDTGFWSMMVFLAVLTIGFAYEWKKGALEWE 118


>gi|89067782|ref|ZP_01155236.1| NADH dehydrogenase alpha subunit [Oceanicola granulosus HTCC2516]
 gi|89046752|gb|EAR52807.1| NADH dehydrogenase alpha subunit [Oceanicola granulosus HTCC2516]
          Length = 121

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M + L  Y PILVF+ +A A+ ++ + +  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEFLREYLPILVFLGLAIALGVIFIGAAALIAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFKDMSMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|154253665|ref|YP_001414489.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Parvibaculum
           lavamentivorans DS-1]
 gi|154157615|gb|ABS64832.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Parvibaculum
           lavamentivorans DS-1]
          Length = 121

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PIL+FM ++  + + L+I+PF++A   PDPEKL+ YECGFD FDDAR+KFD
Sbjct: 1   MEDLLLEYLPILIFMGLSLVVGLALLIAPFVIAPSKPDPEKLAAYECGFDAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LF+IFDLE+AFLFPWAV    +   GF SMMVFLG+LT+GF YEW+KGALEW
Sbjct: 61  VKYYLVAILFIIFDLEVAFLFPWAVSLGDVGGFGFWSMMVFLGVLTIGFTYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|114771816|ref|ZP_01449209.1| NADH dehydrogenase subunit A [alpha proteobacterium HTCC2255]
 gi|114547632|gb|EAU50523.1| NADH dehydrogenase subunit A [alpha proteobacterium HTCC2255]
          Length = 121

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL +Y PILVF+ +A+ + +VL+++  IVA ++PD EK S YECGF+ FDDAR+KFD
Sbjct: 1   MQDLLMNYLPILVFLGVAAGLGLVLILAAIIVAVRNPDAEKTSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F+    LGF SMM+FL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWATSFQYQGMLGFWSMMIFLVVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|255263222|ref|ZP_05342564.1| NADH-quinone oxidoreductase subunit a [Thalassiobium sp. R2A62]
 gi|255105557|gb|EET48231.1| NADH-quinone oxidoreductase subunit a [Thalassiobium sp. R2A62]
          Length = 121

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PI+VF+ +A A+ ++L+ +  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEALLAEYLPIIVFLGLAIALGLILIAAAAVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK+I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFKEISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|266657|sp|P29919|NQO7_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 7; AltName:
           Full=NADH dehydrogenase I subunit 7; AltName: Full=NDH-1
           subunit 7
 gi|150620|gb|AAA03035.1| NADH dehydrogenase [Paracoccus denitrificans]
          Length = 121

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 98/120 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +ASA+ IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F  +MVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASLSDVAFWGLMVFLAVLTVGFAYEWKKGALEW 120


>gi|218661623|ref|ZP_03517553.1| NADH dehydrogenase subunit A [Rhizobium etli IE4771]
          Length = 121

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|116251466|ref|YP_767304.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241204086|ref|YP_002975182.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|115256114|emb|CAK07195.1| putative transmembrane NADH-quinone oxidoreductase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240857976|gb|ACS55643.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 122

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|209548862|ref|YP_002280779.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534618|gb|ACI54553.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 122

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLFVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|86357236|ref|YP_469128.1| NADH dehydrogenase subunit A [Rhizobium etli CFN 42]
 gi|86281338|gb|ABC90401.1| NADH-ubiquinone oxidoreductase chain A protein [Rhizobium etli CFN
           42]
          Length = 121

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLFVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|182679353|ref|YP_001833499.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182635236|gb|ACB96010.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 121

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +L   Y P++VF  +A+ I   L+I+PF+VAFKSPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MLNLFDQYLPLVVFAGVAAFIAAALLIAPFLVAFKSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF++FDLE+AFLFPWA+ F+ I  LGF SM++FLGILTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVALLFIVFDLEVAFLFPWAIAFRTIGDLGFWSMIIFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|163793187|ref|ZP_02187163.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [alpha
           proteobacterium BAL199]
 gi|159181833|gb|EDP66345.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [alpha
           proteobacterium BAL199]
          Length = 121

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+ Y PILVF+A+A  + I ++++ F+V  + PD EKLS YECGF+ FDD+R +FD
Sbjct: 1   MNELLSEYLPILVFLAVAVGLAIAMVVASFVVGTQRPDSEKLSAYECGFEAFDDSRRQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+    I   GF SM+VFLG+LT+GF+YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAISLGDIGLFGFWSMVVFLGVLTIGFVYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254450468|ref|ZP_05063905.1| NADH-quinone oxidoreductase chain a [Octadecabacter antarcticus
           238]
 gi|198264874|gb|EDY89144.1| NADH-quinone oxidoreductase chain a [Octadecabacter antarcticus
           238]
          Length = 121

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PI++F+ +A  +  VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDEMLREYLPIIIFLGLAIVLGAVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F  I+   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFGDISMAAFWSMMVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254438072|ref|ZP_05051566.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Octadecabacter antarcticus 307]
 gi|198253518|gb|EDY77832.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Octadecabacter antarcticus 307]
          Length = 118

 Score =  159 bits (403), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 73/118 (61%), Positives = 98/118 (83%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PI++F+ +A  +  VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPIIIFLGLAIVLGAVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV F +I+ +GF SMM+FL +LTVGF YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVAFGEISMVGFWSMMIFLAVLTVGFAYEWKKGALEWE 118


>gi|85703213|ref|ZP_01034317.1| NADH dehydrogenase alpha subunit [Roseovarius sp. 217]
 gi|85672141|gb|EAQ26998.1| NADH dehydrogenase alpha subunit [Roseovarius sp. 217]
          Length = 118

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/118 (61%), Positives = 96/118 (81%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A  + +VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAIGLGLVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLEIA LFPWAV F+ ++   F SMMVFLG+LT GF YEW+KGA+EW 
Sbjct: 61  YLVSILFIIFDLEIAMLFPWAVAFQDLSMAAFWSMMVFLGVLTAGFAYEWRKGAMEWQ 118


>gi|16126199|ref|NP_420763.1| NADH dehydrogenase subunit A [Caulobacter crescentus CB15]
 gi|221234970|ref|YP_002517406.1| NADH dehydrogenase subunit A [Caulobacter crescentus NA1000]
 gi|13423415|gb|AAK23931.1| NADH dehydrogenase I, A subunit [Caulobacter crescentus CB15]
 gi|220964142|gb|ACL95498.1| NADH-quinone oxidoreductase chain A [Caulobacter crescentus NA1000]
          Length = 125

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 98/125 (78%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+AI IV +++  ++A K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTAFLLQYLPIVIFLGIAAAIGIVFLLAAAVLAPKAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV      + +    F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVTLMKLPQDVAQFAFWSMMTFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|295689629|ref|YP_003593322.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Caulobacter
           segnis ATCC 21756]
 gi|295431532|gb|ADG10704.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Caulobacter
           segnis ATCC 21756]
          Length = 125

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 97/125 (77%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+AI IV +++  ++A K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTAFLLQYLPIVIFLGIAAAIGIVFLLAAAVLAPKAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV        +    F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVTLMKLPHDVAQFAFWSMMAFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|312116342|ref|YP_004013938.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221471|gb|ADP72839.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 121

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL  Y P+++F+ ++  I + L+++PF VA  +PDPEK++ YECGF  FDDAR+KFD
Sbjct: 1   MTELLQQYFPLVIFLGVSLIIGLGLLVAPFFVAPNNPDPEKVAAYECGFPAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV FK+    GF +MM FL +LT+GFIYEWKKGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFKEAGVAGFWAMMAFLSVLTIGFIYEWKKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|149202674|ref|ZP_01879646.1| NADH dehydrogenase subunit A [Roseovarius sp. TM1035]
 gi|149143956|gb|EDM31990.1| NADH dehydrogenase subunit A [Roseovarius sp. TM1035]
          Length = 118

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 95/118 (80%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLEIA LFPWAV F+ ++   F SMMVFL +LT GF YEW+KGA+EW 
Sbjct: 61  YLVSILFIIFDLEIALLFPWAVAFQDLSMTAFWSMMVFLAVLTAGFAYEWRKGAMEWQ 118


>gi|288958989|ref|YP_003449330.1| NADH dehydrogenase I chain A [Azospirillum sp. B510]
 gi|288911297|dbj|BAI72786.1| NADH dehydrogenase I chain A [Azospirillum sp. B510]
          Length = 122

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 74/120 (61%), Positives = 96/120 (80%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+  Y PILVF+ I  A+  V++ + ++++ K+PD EKLS YECGF+PF+DAR KFD+
Sbjct: 3   TPLIIEYLPILVFLLIGIALAAVMVGASYVISPKNPDAEKLSPYECGFEPFEDARTKFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LVS+LF+IFDLE+AFLFPWA+    I   GF SMM+FLGILT+GFIYEWKKGALEW+
Sbjct: 63  RFYLVSILFIIFDLEVAFLFPWAIALGDIGLFGFWSMMLFLGILTIGFIYEWKKGALEWE 122


>gi|254455324|ref|ZP_05068753.1| NADH dehydrogenase i chain a [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082326|gb|EDZ59752.1| NADH dehydrogenase i chain a [Candidatus Pelagibacter sp. HTCC7211]
          Length = 122

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +SD L  Y PI++F+ IA  +    ++  FI++ K PDPEKLS YECGF+PF+D+R++FD
Sbjct: 2   LSDFLKDYLPIIIFLIIALGLSCAFVVINFILSPKRPDPEKLSAYECGFEPFEDSRMEFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA+    I  LGF SMM+FL ILT+GFIYEWKKGAL+W
Sbjct: 62  VRFYLVAILFIIFDLEIAFLFPWAISLGNIGLLGFSSMMIFLFILTIGFIYEWKKGALDW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|209964550|ref|YP_002297465.1| NADH-quinone oxidoreductase chain A [Rhodospirillum centenum SW]
 gi|209958016|gb|ACI98652.1| NADH-quinone oxidoreductase chain A [Rhodospirillum centenum SW]
          Length = 122

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (77%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++ L+  Y PIL+F+ IA+ + I +M + ++V  ++PD EKLS YECGF+PF DAR KFD
Sbjct: 2   LNPLIVEYLPILIFICIAAGVAISMMAAAYLVGRQNPDSEKLSPYECGFEPFADARSKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV    I   GF SMMVF+GIL +GF YEWKKGALEW
Sbjct: 62  VRFYLVSILFIIFDLEVAFLFPWAVALGDIGMFGFWSMMVFIGILLIGFAYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|167646798|ref|YP_001684461.1| NADH dehydrogenase subunit A [Caulobacter sp. K31]
 gi|167349228|gb|ABZ71963.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Caulobacter
           sp. K31]
          Length = 125

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (77%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+ I IV +++  ++A ++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLQYLPIVIFLGIAAVIGIVFLLAAAVLAPRAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV        +    F SM+VFLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVALMKLPHDVAAFAFWSMLVFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|294677054|ref|YP_003577669.1| NADH-quinone oxidoreductase subunit A [Rhodobacter capsulatus SB
           1003]
 gi|294475874|gb|ADE85262.1| NADH-quinone oxidoreductase, A subunit [Rhodobacter capsulatus SB
           1003]
          Length = 126

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 93/117 (79%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILV +A+A  + ++L+    I+A+++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 9   MLREYLPILVLLAMAIGLALILIPPAAIIAYRNPDPEKVSAYECGFNAFDDARMKFDVRF 68

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+I DLE+AFLFPWAV F  ++   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 69  YLVSILFIISDLEVAFLFPWAVAFGDMSMTAFWSMMVFLSVLTVGFAYEWKKGALEW 125


>gi|260574758|ref|ZP_05842761.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodobacter
           sp. SW2]
 gi|259023175|gb|EEW26468.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodobacter
           sp. SW2]
          Length = 121

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+ +A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDALLREYLPILILLALAIGLGLVLILAAVVLAIRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F QI+ LGF SMM+FL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGQISMLGFWSMMIFLTVLTVGFAYEWKKGALEW 120


>gi|83592890|ref|YP_426642.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575804|gb|ABC22355.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodospirillum rubrum ATCC 11170]
          Length = 121

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PIL+F+ IA+ + +  + + ++V  ++PD EK S YECGF+ FDDAR KF 
Sbjct: 1   MQDLLLEYLPILIFIGIATLVAVAAIGTSYLVVRQNPDSEKDSAYECGFEAFDDARSKFQ 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV    I   GF SM+VFLG+LTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLGAIGVFGFWSMVVFLGVLTVGFVYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|71083582|ref|YP_266301.1| NADH dehydrogenase I subunit A [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91761997|ref|ZP_01263962.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|123646647|sp|Q4FM91|NUOA_PELUB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|71062695|gb|AAZ21698.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717799|gb|EAS84449.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 122

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +S+ L  Y PI++F+ IA  +    ++   I++ K PDPEKLS YECGF+PF+D+R++FD
Sbjct: 2   LSEFLKDYLPIIIFLIIALGLSCAFVVVNLILSPKHPDPEKLSAYECGFEPFEDSRMEFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA+    I  LGF SMM+FL ILTVGFIYEWKKGAL+W
Sbjct: 62  VRFYLVAILFIIFDLEIAFLFPWAISLGNIGGLGFTSMMIFLFILTVGFIYEWKKGALDW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|144899465|emb|CAM76329.1| NADH-ubiquinone oxidoreductase chain 3 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 122

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/121 (58%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA A+ ++ + + ++V  + PDPEK + YECGF+ F DAR KFD
Sbjct: 2   MEAWLLEYLPILIFIGIAVAVSVIAVGASWLVGRQKPDPEKNAAYECGFEAFGDARSKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 62  VRFYLVAILFIIFDLEVAFLFPWAVSLGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|84516743|ref|ZP_01004101.1| NADH dehydrogenase alpha subunit [Loktanella vestfoldensis SKA53]
 gi|84509211|gb|EAQ05670.1| NADH dehydrogenase alpha subunit [Loktanella vestfoldensis SKA53]
          Length = 121

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D++++Y PI++F+ +A A+ ++L+I+  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MPDIVSNYLPIMIFLGLAIALGLLLIIAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMM+FLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMIFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|114327966|ref|YP_745123.1| NADH-quinone oxidoreductase chain A [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316140|gb|ABI62200.1| NADH-quinone oxidoreductase chain A [Granulibacter bethesdensis
           CGDNIH1]
          Length = 121

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 92/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +LT Y PILVF+ IA+ I   ++   ++ A + P  EKL+ YECGFD FDDAR +FD
Sbjct: 1   MQPVLTEYFPILVFIGIATVIACAMVGGSYLAARQKPYAEKLAPYECGFDAFDDARSRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ LV++LF+IFDLE+AFLFPWAV   +I   GF SMM FLG+LTVGFIYEW+KGALEW
Sbjct: 61  VRYYLVAILFIIFDLEVAFLFPWAVSLSRIGMFGFFSMMGFLGVLTVGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|30249737|ref|NP_841807.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           europaea ATCC 19718]
 gi|81722162|sp|Q82TU3|NUOA_NITEU RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|30180774|emb|CAD85688.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           europaea ATCC 19718]
          Length = 122

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++ +L +Y PIL+F+ +  AI ++ M++ +++A   PD EKLS YECGF  F+DAR+KFD
Sbjct: 2   LNTMLGNYFPILLFILVGLAIGVLSMLAGWLLAPNKPDAEKLSPYECGFGAFEDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ L+++LF++FDLEIAFLFPWAV  K+I W GF +M+VFLG+L VGFIYEW KGALEW
Sbjct: 62  VRYYLIAILFILFDLEIAFLFPWAVVLKEIGWFGFVAMLVFLGLLVVGFIYEWVKGALEW 121

Query: 121 D 121
           D
Sbjct: 122 D 122


>gi|254419969|ref|ZP_05033693.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Brevundimonas sp. BAL3]
 gi|196186146|gb|EDX81122.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Brevundimonas sp. BAL3]
          Length = 125

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 96/125 (76%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y P+++F  IA+ I ++ +  P ++A KSPD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLEYLPVIIFAGIAAFIGVLFIALPMLLAPKSPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG----FGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV    ++  G    F SMMVFLG+LT+GFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSMFDLSHAGMIFAFWSMMVFLGVLTIGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|114569905|ref|YP_756585.1| NADH dehydrogenase subunit A [Maricaulis maris MCS10]
 gi|114340367|gb|ABI65647.1| NADH dehydrogenase subunit A [Maricaulis maris MCS10]
          Length = 122

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 96/122 (78%), Gaps = 1/122 (0%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+F AIA+ I I  M++ F++A   PDPEK+STYECGF+ FDDAR+KFD
Sbjct: 1   MDALLLEYLPILIFFAIAAVIGIGFMVAAFVIAPSRPDPEKVSTYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           +RF LV++LF+IFDLE+AFLFPWAV  ++ +    F SMMVFL +LT+GF+YE KKGAL+
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTLREHLGQFEFWSMMVFLTVLTIGFVYELKKGALD 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|329889332|ref|ZP_08267675.1| NADH-quinone oxidoreductase chain 7 [Brevundimonas diminuta ATCC
           11568]
 gi|328844633|gb|EGF94197.1| NADH-quinone oxidoreductase chain 7 [Brevundimonas diminuta ATCC
           11568]
          Length = 125

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 96/125 (76%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++ L  Y PI+VF+ IA  +    M++ +++A K+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNEFLLEYLPIVVFLGIAIVLGAGFMLAAWVLAPKNPDTEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG----FGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLEIAFLFPWAV    ++  G    F SMMVFLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVSMFDLSHGGMVFAFWSMMVFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW 
Sbjct: 121 ALEWQ 125


>gi|294083711|ref|YP_003550468.1| NADH:ubiquinone oxidoreductase subunit 3 [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663283|gb|ADE38384.1| NADH:ubiquinone oxidoreductase subunit 3 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 121

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ Y PI VF AIA  +    +++ F+   + PD EK++ YECGFD FDD+R +FD
Sbjct: 1   MPGFLSEYLPIAVFFAIAVGLSAAFVLTAFVFGTQRPDEEKMTAYECGFDAFDDSRRQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV    I   GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLGGIGMFGFWSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|149914577|ref|ZP_01903107.1| NADH dehydrogenase subunit A [Roseobacter sp. AzwK-3b]
 gi|149811370|gb|EDM71205.1| NADH dehydrogenase subunit A [Roseobacter sp. AzwK-3b]
          Length = 121

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILV +A+A  + +VL+++  + A ++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVLLAVAIGLGLVLLLAAIVAAVRNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV F+ I+   F SMM FL +LT GF YEW+KGA+EW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFQDISMTAFWSMMAFLAVLTAGFAYEWRKGAMEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|77463070|ref|YP_352574.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides 2.4.1]
 gi|126461942|ref|YP_001043056.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides ATCC 17029]
 gi|221638926|ref|YP_002525188.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides KD131]
 gi|332557943|ref|ZP_08412265.1| NADH:ubiquinone oxidoreductase subunit A [Rhodobacter sphaeroides
           WS8N]
 gi|77387488|gb|ABA78673.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain A [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103606|gb|ABN76284.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159707|gb|ACM00687.1| NADH-quinone oxidoreductase subunit [Rhodobacter sphaeroides KD131]
 gi|332275655|gb|EGJ20970.1| NADH:ubiquinone oxidoreductase subunit A [Rhodobacter sphaeroides
           WS8N]
          Length = 121

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  + PI++   +A  + ++LM+S  IVA + PDPEK+S YECGF+ FDDAR+KF+
Sbjct: 1   MDDLLREFLPIVILTVLAGGLGLLLMLSAVIVAVRRPDPEKVSAYECGFNAFDDARMKFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121


>gi|84686427|ref|ZP_01014321.1| NADH dehydrogenase alpha subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665610|gb|EAQ12086.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 121

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI++F+A+A  + +VL+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYLPIVIFLAVAVGLGLVLVLAAAVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK +  +GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVGMIGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|226348819|gb|ACO50723.1| NADH dehydrogenase subunit 3 [Micromonas pusilla CCMP1545]
          Length = 117

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 94/117 (80%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ YAP+LV++ I++ + ++++   F+ + +  DPEK+S YECGFDPFDDAR +FDIRF 
Sbjct: 1   MSEYAPLLVYLVISATLSVLILSLSFVFSTQKADPEKVSAYECGFDPFDDARGRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWAV    +   GF +MM+FLG+LTVGF+YEW+KGAL+W+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAVSLHNVGPFGFWAMMIFLGVLTVGFVYEWRKGALDWE 117


>gi|83858415|ref|ZP_00951937.1| NADH dehydrogenase alpha subunit [Oceanicaulis alexandrii HTCC2633]
 gi|83853238|gb|EAP91090.1| NADH dehydrogenase alpha subunit [Oceanicaulis alexandrii HTCC2633]
          Length = 121

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/121 (58%), Positives = 96/121 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y PIL+F+ IA+ + +V +++ F++A   PDPEK+STYECGF+ FDDAR+KFD
Sbjct: 1   MNALLLEYLPILIFLGIAAGLGLVFILAAFVLAPSDPDPEKVSTYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPW       +   F SMMVFLG+LTVGF+YEW+KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWLFPIFDGSVAAFWSMMVFLGVLTVGFLYEWRKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|23013444|ref|ZP_00053338.1| COG0838: NADH:ubiquinone oxidoreductase subunit 3 (chain A)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 121

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA AI  + +   +IVA + PD EK + YECGFD F DAR +F+
Sbjct: 1   MEAWLLEYLPILIFLGIAIAISAICVGGSWIVARQKPDTEKATAYECGFDAFGDARSRFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVALGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|83311886|ref|YP_422150.1| NADH:ubiquinone oxidoreductase subunit 3 [Magnetospirillum
           magneticum AMB-1]
 gi|82946727|dbj|BAE51591.1| NADH:ubiquinone oxidoreductase subunit 3 [Magnetospirillum
           magneticum AMB-1]
          Length = 121

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA  I  + + + +IVA + PD EK + YECGFD F DAR KF+
Sbjct: 1   MEAWLLEYLPILIFLGIAIVISAICVGASWIVARQKPDTEKATAYECGFDAFGDARSKFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVALGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|146278044|ref|YP_001168203.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides ATCC 17025]
 gi|145556285|gb|ABP70898.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 139

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  + PI++   +A  + ++LM+S  IVA ++PDPEK+S YECGF+ FDDAR+KF+
Sbjct: 19  MDDLLREFLPIVILTVLAGGLGLLLMLSAVIVAVRNPDPEKVSAYECGFNAFDDARMKFE 78

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 79  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMVFLAVLTVGFAYEWKKGALEW 138

Query: 121 D 121
            
Sbjct: 139 Q 139


>gi|262277301|ref|ZP_06055094.1| NADH-quinone oxidoreductase subunit a (nadhdehydrogenase i subunit
           a) (ndh-1 subunit a) [alpha proteobacterium HIMB114]
 gi|262224404|gb|EEY74863.1| NADH-quinone oxidoreductase subunit a (nadhdehydrogenase i subunit
           a) (ndh-1 subunit a) [alpha proteobacterium HIMB114]
          Length = 122

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           D L  YA IL+F+ I+  +    +I  F+ +  +PDPEKLS YECGF+ FDDAR+KFD+R
Sbjct: 4   DFLRDYATILIFLFISIGLGFAFIIVNFLFSPSNPDPEKLSAYECGFEAFDDARMKFDVR 63

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LV++LF+IFDLE+AFLFPWAV    I  LGF SMM FL ILTVGFIYEWKKGAL+W+
Sbjct: 64  FYLVAILFIIFDLEVAFLFPWAVSLGNIGLLGFWSMMFFLFILTVGFIYEWKKGALDWE 122


>gi|153875119|ref|ZP_02003054.1| NADH dehydrogenase I chain A [Beggiatoa sp. PS]
 gi|152068416|gb|EDN66945.1| NADH dehydrogenase I chain A [Beggiatoa sp. PS]
          Length = 118

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y PIL+F+ I   I + L    F++  + PDPEK STYECGF+ F+DAR+KFD+R+
Sbjct: 1   MLSEYFPILLFIMIGIVIGVALPTLGFLLGPRQPDPEKNSTYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV FK +   GF +MM+FL IL +GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVFKDLGLFGFIAMMIFLAILVIGFIYEWKKGALEWE 118


>gi|197105268|ref|YP_002130645.1| NADH dehydrogenase I, A subunit [Phenylobacterium zucineum HLK1]
 gi|196478688|gb|ACG78216.1| NADH dehydrogenase I, A subunit [Phenylobacterium zucineum HLK1]
          Length = 125

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 98/125 (78%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+A+ I  +++  I A K+PDPEKLS+YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLEYLPIVIFLGIAAALGIAFILAAAIFAPKAPDPEKLSSYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKG 116
           IRF LVS+LF+IFDLE+AFLFPWAV   ++    +   F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVTLMKLPPEASQFAFWSMMTFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|321401336|gb|ADW83091.1| NADH dehydrogenase subunit 3 [Pavlova lutheri]
          Length = 119

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y  +L F+  + A+ +VL +  F +A  S DPEKLS YECGF+PF+DAR +FDIRF 
Sbjct: 3   LQEYFSLLFFVGFSFALSVVLFLLSFFLAVSSNDPEKLSAYECGFNPFEDARSQFDIRFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEI+FLFPWA+  K I   GF SMM+FL ILTVGF+YEW+KGALEW+
Sbjct: 63  LVAILFIIFDLEISFLFPWALTLKSIESFGFWSMMLFLFILTVGFVYEWQKGALEWE 119


>gi|302383045|ref|YP_003818868.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193673|gb|ADL01245.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 125

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+ + I  M++ +++A  +PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLQYLPIVIFLGIATVLGIGFMVAAWVLAPSNPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV      +      F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSIFDLGQGAMVFAFWSMMAFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW 
Sbjct: 121 ALEWQ 125


>gi|113170489|ref|YP_717280.1| nad3/ndhC [Ostreococcus tauri]
 gi|112806896|emb|CAL36402.1| unnamed protein product [Ostreococcus tauri]
          Length = 117

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y PIL+++ +++ +  V++   F+VA +  DPEK S YECGFDPF+DAR +FDIRF 
Sbjct: 1   MIEYLPILLYICVSALLSGVILSLSFLVATQKADPEKTSAYECGFDPFEDARARFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWA+  + I   GF +MMVFL ILTVGF+YEW+KGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAISLRHIDLFGFWTMMVFLIILTVGFVYEWRKGALEWE 117


>gi|114798172|ref|YP_760446.1| NADH-quinone oxidoreductase subunit A [Hyphomonas neptunium ATCC
           15444]
 gi|114738346|gb|ABI76471.1| NADH-quinone oxidoreductase, A subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 124

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 92/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +  L   Y P+++F+ I +AI  + +I   ++A   PDPEK S YECGF  FDDAR+KFD
Sbjct: 4   VERLALDYLPVIIFLVIGAAISGLFVIGNVLLAPSKPDPEKNSAYECGFPAFDDARMKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I  LGF SM+ FLG+LTVGFIYEW++GALEW
Sbjct: 64  VRFYLVAILFIIFDLEVAFLFPWAVSLGEIGILGFWSMVGFLGVLTVGFIYEWRRGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|296536156|ref|ZP_06898284.1| NADH-quinone oxidoreductase subunit A [Roseomonas cervicalis ATCC
           49957]
 gi|296263527|gb|EFH10024.1| NADH-quinone oxidoreductase subunit A [Roseomonas cervicalis ATCC
           49957]
          Length = 122

 Score =  146 bits (369), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 74/118 (62%), Positives = 94/118 (79%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL +Y PILVF+AIA+AI + ++    + A + P  EK+S YECGF+PFDD R +FD+RF
Sbjct: 5   LLANYFPILVFLAIAAAIAVAMVGGSVLAARQKPYAEKVSAYECGFEPFDDTRRRFDVRF 64

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+AFLFPWAV   QI W GF SMM FLG+LTVGFIYEW+KGAL+W+
Sbjct: 65  YLVAILFIIFDLEVAFLFPWAVSLGQIGWFGFLSMMGFLGVLTVGFIYEWRKGALDWE 122


>gi|330994054|ref|ZP_08317984.1| NADH-quinone oxidoreductase subunit A [Gluconacetobacter sp.
           SXCC-1]
 gi|329759000|gb|EGG75514.1| NADH-quinone oxidoreductase subunit A [Gluconacetobacter sp.
           SXCC-1]
          Length = 121

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  ++  Y P+L+F  IA  I   ++ S  +   + P  EK S YECGF+ FDDAR +FD
Sbjct: 1   MHSVIADYLPVLIFGCIAVVIAGAMLGSSLLFGHQKPYAEKTSAYECGFEAFDDARHRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I W GF SMM FLG+L VGFIYEW KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWALSLSRIGWFGFASMMGFLGVLVVGFIYEWSKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|6647657|sp|O84969|NUOA_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|3282559|gb|AAC24985.1| NUOA [Rhodobacter capsulatus]
          Length = 126

 Score =  146 bits (368), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 95/117 (81%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILV +A+A  + ++L+ +  I+A+++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 9   MLREYLPILVLLAMAIGLGLILIAAAAIIAYRNPDPEKVSAYECGFNAFDDARMKFDVRF 68

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+IFDLE+AFLFPWAV F  ++   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 69  YLVSILFIIFDLEVAFLFPWAVAFGDMSMTAFWSMMVFLSVLTVGFAYEWKKGALEW 125


>gi|229315930|ref|YP_002860156.1| NADH dehydrogenase subunit 3 [Micromonas sp. RCC299]
 gi|226431215|gb|ACO55620.1| NADH dehydrogenase subunit 3 [Micromonas sp. RCC299]
          Length = 117

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y P+LV++ I+  + ++++   F+ + +  DPEK+S YECGFDPFDDAR +FDIRF 
Sbjct: 1   MSEYVPLLVYLVISMVLSMLILSLSFVFSTQKADPEKVSAYECGFDPFDDARARFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWA+    I   GF +M+VFL ILT+GF+YEW+KGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAISLHTIQLTGFWTMVVFLLILTIGFVYEWRKGALEWE 117


>gi|148259932|ref|YP_001234059.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Acidiphilium
           cryptum JF-5]
 gi|326403114|ref|YP_004283195.1| NADH-quinone oxidoreductase subunit A [Acidiphilium multivorum
           AIU301]
 gi|146401613|gb|ABQ30140.1| NADH dehydrogenase subunit A [Acidiphilium cryptum JF-5]
 gi|325049975|dbj|BAJ80313.1| NADH-quinone oxidoreductase subunit A [Acidiphilium multivorum
           AIU301]
          Length = 121

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ Y PILVF+ IA+ +    +I   +VA ++P  EKLS YECGF PF DAR KFD
Sbjct: 1   MQSDLSVYFPILVFIGIAALLGAAFIIGSLVVARQNPYGEKLSAYECGFAPFSDARRKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ LV++LF+IFD+EIAFLFPWAV   +I  LGF SMM FL IL VGFIYEW+KGAL+W
Sbjct: 61  VRYYLVAILFIIFDVEIAFLFPWAVSLSRIGALGFWSMMGFLAILVVGFIYEWRKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|58698295|ref|ZP_00373212.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630975|ref|YP_002727766.1| NADH dehydrogenase I, A subunit [Wolbachia sp. wRi]
 gi|58535168|gb|EAL59250.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592956|gb|ACN95975.1| NADH dehydrogenase I, A subunit [Wolbachia sp. wRi]
          Length = 117

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I++F+ ++  +  VL I P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTIVIFICVSIVVSFVLGILPMFLAVSKPDSEKLSTYECGFNPLSSARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWAV   +I++ GF SMMVFL ILT+GFIYEW KGALEW+
Sbjct: 61  LVSILFIIFDLEIAFLFPWAVSLSKISYGGFWSMMVFLAILTIGFIYEWCKGALEWE 117


>gi|226939456|ref|YP_002794529.1| NADH-quinone oxidoreductase subunit [Laribacter hongkongensis
           HLHK9]
 gi|226714382|gb|ACO73520.1| NADH-quinone oxidoreductase subunit [Laribacter hongkongensis
           HLHK9]
          Length = 118

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 93/118 (78%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ I   + +V ++   +++   PDPEK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFVIIGIMVGVVPILLGKLISPNRPDPEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  ++I   GFG+M+VFL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLREIGMFGFGAMLVFLAILVVGFIYEWKKGALEWE 118


>gi|315499788|ref|YP_004088591.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Asticcacaulis
           excentricus CB 48]
 gi|315417800|gb|ADU14440.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Asticcacaulis
           excentricus CB 48]
          Length = 125

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (72%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PI++F  IA  + +  +I+  ++A K+PD EKLS YECGF+ FD AR KFD
Sbjct: 1   MEALLIKYLPIVIFFGIALVLGLGFIIAALVLAPKAPDTEKLSAYECGFNAFDSARQKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG----FGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV    +   G    F SMMVFLG+LTVGFIYEW KG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSMFDLPQAGMQFAFWSMMVFLGVLTVGFIYEWNKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|114330925|ref|YP_747147.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           eutropha C91]
 gi|114307939|gb|ABI59182.1| NADH dehydrogenase subunit A [Nitrosomonas eutropha C91]
          Length = 118

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 93/118 (78%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   +  + +++ +++A   PD EKLSTYECGF  F+DAR+KFD+R+
Sbjct: 1   MLGNYFPILLFILVGLLVGTLCLVAGWLLAPNKPDAEKLSTYECGFGAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FDLEIAFLFPWAV  K++   GF +M+VFLG+L VGFIYEW KGALEWD
Sbjct: 61  YLIAILFILFDLEIAFLFPWAVALKEVGLFGFIAMLVFLGLLVVGFIYEWAKGALEWD 118


>gi|3122487|sp|Q36518|NU3M_PLASU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|633586|emb|CAA87750.1| NADH dehydrogenase subunit 3 [Platymonas subcordiformis]
          Length = 117

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  +L++   + A+  +++   FI A + PDPEK+S YECGFDPFDDAR KFDIRF 
Sbjct: 1   MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWAV   +I + GF +MM FL ILT+GFIYEWKKGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE 117


>gi|327195236|ref|YP_004339018.1| NADH dehydrogenase subunit 3 [Coccomyxa sp. C-169]
 gi|325070732|gb|ADY75460.1| NADH dehydrogenase subunit 3 [Coccomyxa sp. C-169]
          Length = 117

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  I ++  IA+ + I+L+   F+ + + PDPEK+S YECGFDPFDDAR +FD++F 
Sbjct: 1   MVEYLAIFIYFLIATGLAIILLGVSFLASTRKPDPEKISAYECGFDPFDDARSRFDVQFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWA+   ++   GF SMM FL ILT+GF+YEW+KGAL+W 
Sbjct: 61  LVAILFIIFDLEVTFLFPWALVLNRVGLFGFWSMMAFLLILTIGFVYEWRKGALDWS 117


>gi|162148811|ref|YP_001603272.1| NADH-ubiquinone oxidoreductase chain 3 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545441|ref|YP_002277670.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787388|emb|CAP56983.1| putative NADH-ubiquinone oxidoreductase chain 3 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533118|gb|ACI53055.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 121

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 87/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y P+L+F  +A  I   ++ S  +   + P  EK+S YECGFD FDDAR +FD
Sbjct: 1   MQSVLADYFPVLIFGVLAVVIAGAMLGSCLLFGHQKPYAEKVSAYECGFDAFDDARHRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMM FLGILTVGFIYEW KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLSRIGLFGFLSMMGFLGILTVGFIYEWCKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|91205213|ref|YP_537568.1| NADH dehydrogenase subunit A [Rickettsia bellii RML369-C]
 gi|157827449|ref|YP_001496513.1| NADH dehydrogenase subunit A [Rickettsia bellii OSU 85-389]
 gi|122064632|sp|Q1RJI5|NUOA_RICBR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|91068757|gb|ABE04479.1| NADH dehydrogenase I chain A [Rickettsia bellii RML369-C]
 gi|157802753|gb|ABV79476.1| NADH dehydrogenase I chain A [Rickettsia bellii OSU 85-389]
          Length = 124

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 69/120 (57%), Positives = 90/120 (75%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA+ +  ++MI P ++A K  + +KL  YECGF+PFDDAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIATLVSSLIMILPNLLATKKYNKDKLEPYECGFEPFDDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +LT+GF+YEWKKGAL+W+
Sbjct: 65  RFYLVAILFIIFDLEITFLVPWAISLGTIGKIGFFSMMFFLFVLTIGFVYEWKKGALDWE 124


>gi|291334202|gb|ADD93869.1| NADH ubiquinone/plastoquinone oxidoreductase chain 3 [uncultured
           marine bacterium MedDCM-OCT-S08-C1340]
          Length = 118

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ IA     V+M + F     +PD EK S YECGF+PF+D+R+KFD+RF
Sbjct: 1   MLFEYLPILIFLFIALIFASVMMTAGFFFGGSNPDSEKNSPYECGFEPFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I + GF +M VFL IL +GFIYEWKKGALEWD
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDHIGYEGFLAMAVFLFILLIGFIYEWKKGALEWD 118


>gi|254294104|ref|YP_003060127.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hirschia
           baltica ATCC 49814]
 gi|254042635|gb|ACT59430.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hirschia
           baltica ATCC 49814]
          Length = 124

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +  L+ +Y P+++F A+  A+ +  +++  +++  +PDPEK S YECGF+PFDDAR+KFD
Sbjct: 4   VQSLVLNYLPVVIFFALGLALCLAFLVASAVLSPNNPDPEKNSAYECGFNPFDDARMKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLE+AFLFPW           F SMMVFLG+LT+GFIYEW  GALEW
Sbjct: 64  IRFYLVAILFIIFDLEVAFLFPWIFQVDAGNIAAFWSMMVFLGVLTIGFIYEWSSGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|88812976|ref|ZP_01128219.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrococcus
           mobilis Nb-231]
 gi|88789754|gb|EAR20878.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrococcus
           mobilis Nb-231]
          Length = 118

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PILVF+ IA    +  +++  ++A + PD  KLS YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLESYLPILVFLVIAGFAGLAPLVAGLVLAPRRPDENKLSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   Q+   GF +M +F+GIL +GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDQVGLFGFVAMAIFVGILLIGFLYEWKKGALEWE 118


>gi|9653246|ref|NP_062492.1| NADH dehydrogenase subunit 3 [Chondrus crispus]
 gi|1352557|sp|P48910|NU3M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1334494|emb|CAA87616.1| NADH dehydrogenase (ubiquinone), subunit 3 [Chondrus crispus]
          Length = 121

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y+ IL+F AI+S +  V+ +  + +  + PD EK+S YECGF+PFDDAR  FD
Sbjct: 1   MKLIFTEYSAILIFFAISSLLSSVIFLLSYFLIPQKPDQEKVSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLEI+FLFPW++   +I+ +GF SM+VFL ILT+GFIYEW KGALEW
Sbjct: 61  IRFYLVAILFLIFDLEISFLFPWSLVLGEISIIGFWSMIVFLVILTIGFIYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|42520928|ref|NP_966843.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99034975|ref|ZP_01314778.1| hypothetical protein Wendoof_01000401 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225631317|ref|ZP_03787992.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|42410669|gb|AAS14777.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225590992|gb|EEH12199.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 117

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I++F+ ++  +   L I P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTIVIFICVSIVVSFALGILPMFLAVSKPDGEKLSTYECGFNPLSSARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWAV   +I++ GF SMMVFL ILT+GFIYEW KGALEW+
Sbjct: 61  LVSILFIIFDLEIAFLFPWAVSLSKISYGGFWSMMVFLAILTIGFIYEWCKGALEWE 117


>gi|150406499|ref|YP_001315092.1| NADH dehydrogenase subunit 3 [Chlorokybus atmophyticus]
 gi|126507736|gb|ABO15133.1| NADH dehydrogenase subunit 3 [Chlorokybus atmophyticus]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 92/118 (77%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAI-VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  Y  IL+++ ++  + +++L +S F+ +    DPEK+S YECGFDPFDDAR +FD+RF
Sbjct: 1   MIEYLSILIYLIVSLILSLVILALSFFLGSSYKADPEKISAYECGFDPFDDARNRFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+ FLFPWAV   ++  LGF +MMVFL ILT+GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEVTFLFPWAVTLNRLNLLGFWTMMVFLIILTIGFIYEWKKGALEWE 118


>gi|294340861|emb|CAZ89256.1| putative NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Thiomonas sp. 3As]
          Length = 119

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +  +++A + PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEQYLPVLLFILVGIGVGVVPQLLGYLIAPRHPDAEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  +GF +MM+FL ILT+GFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDIGQIGFWAMMIFLAILTIGFIYEWKKGALDWE 119


>gi|148284879|ref|YP_001248969.1| NADH dehydrogenase subunit A [Orientia tsutsugamushi str. Boryong]
 gi|189183818|ref|YP_001937603.1| NADH dehydrogenase subunit A [Orientia tsutsugamushi str. Ikeda]
 gi|146740318|emb|CAM80722.1| NADH dehydrogenase I chain A [Orientia tsutsugamushi str. Boryong]
 gi|189180589|dbj|BAG40369.1| NADH dehydrogenase I chain A [Orientia tsutsugamushi str. Ikeda]
          Length = 123

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/123 (60%), Positives = 89/123 (72%), Gaps = 2/123 (1%)

Query: 1   MSDLLTS--YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVK 58
           M  LLTS  Y PI++F AIA A+   ++I P I A K  +  KL +YECGFD F +AR K
Sbjct: 1   MLHLLTSLEYLPIVIFFAIALALSFFIIILPKIFASKKYNKSKLESYECGFDTFSEARSK 60

Query: 59  FDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           FDIRF L+S+LF+IFDLEIAFL PWAV  K+    GF SMM FL IL +GFIYEWKKGAL
Sbjct: 61  FDIRFYLISMLFIIFDLEIAFLIPWAVNLKETKMFGFYSMMFFLLILVIGFIYEWKKGAL 120

Query: 119 EWD 121
           EW+
Sbjct: 121 EWE 123


>gi|58584499|ref|YP_198072.1| NADH:ubiquinone oxidoreductase chain A [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58418815|gb|AAW70830.1| NADH:ubiquinone oxidoreductase chain A [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 117

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I +F+ ++  + + L + P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLAIAIFICVSIILSLALGVLPMFLAISKPDSEKLSTYECGFNPLSRARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWA+   +I++ GF SMMVFL ILTVGFIYEW KGALEW+
Sbjct: 61  LVSILFMIFDLEIAFLFPWAISLSKISYCGFWSMMVFLAILTVGFIYEWCKGALEWE 117


>gi|153207264|ref|ZP_01946028.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161830456|ref|YP_001597293.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           331]
 gi|165918809|ref|ZP_02218895.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           334]
 gi|223635508|sp|A9N8X3|NUOA_COXBR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120576752|gb|EAX33376.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161762323|gb|ABX77965.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           331]
 gi|165917533|gb|EDR36137.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           334]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ I+  I ++ +   +    + PD  KLS YECGF+ F DAR+ FD+RF
Sbjct: 1   MLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I W GF +MMVFL IL VGFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE 118


>gi|198284346|ref|YP_002220667.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667509|ref|YP_002427008.1| NADH-quinone oxidoreductase, A subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|223635410|sp|B5EN71|NUOA_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|198248867|gb|ACH84460.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519722|gb|ACK80308.1| NADH-quinone oxidoreductase, A subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P+L+F+ +A  + +  ++    +    PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLNHYLPVLIFLLVALVVGVAPLLMGSSLGPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV F QI   GF +MM+FL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVFDQIGMTGFLAMMLFLAILVVGFIYEWKKGALEWE 118


>gi|325983289|ref|YP_004295691.1| NAD(P)H-quinone oxidoreductase subunit 3 [Nitrosomonas sp. AL212]
 gi|325532808|gb|ADZ27529.1| NAD(P)H-quinone oxidoreductase subunit 3 [Nitrosomonas sp. AL212]
          Length = 118

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +V M+  +++A  +PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFLIVGFMVGVVPMLCGWLLAPNNPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+   +I   GF +MMVFL IL VGF+YEW KGALEWD
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLDEIGLFGFVAMMVFLSILVVGFVYEWMKGALEWD 118


>gi|209363823|ref|YP_001423956.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii Dugway
           5J108-111]
 gi|212212182|ref|YP_002303118.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuG_Q212]
 gi|212218212|ref|YP_002304999.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuK_Q154]
 gi|215919185|ref|NP_820431.2| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           493]
 gi|223635535|sp|Q83BQ5|NUOA_COXBU RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635536|sp|A9KBK4|NUOA_COXBN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|206584069|gb|AAO90945.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii RSA 493]
 gi|207081756|gb|ABS77261.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii Dugway
           5J108-111]
 gi|212010592|gb|ACJ17973.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuG_Q212]
 gi|212012474|gb|ACJ19854.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuK_Q154]
          Length = 120

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ I+  I ++ +   +    + PD  KLS YECGF+ F DAR+ FD+RF
Sbjct: 3   VLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I W GF +MMVFL IL VGFIYEWK+GALEW+
Sbjct: 63  YLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE 120


>gi|190571251|ref|YP_001975609.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357523|emb|CAQ54960.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 117

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  IL+F+ ++  +   L + P  +A  +PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTILIFICVSIVVSFTLGVLPMFLAVSNPDGEKLSTYECGFNPLSRARKSFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWAV   +I++ GF SMM+FL ILT+GF+YEW KGALEW+
Sbjct: 61  LVAILFIIFDLEIAFLFPWAVSLSKISYCGFWSMMIFLAILTIGFLYEWCKGALEWE 117


>gi|296136706|ref|YP_003643948.1| hypothetical protein Tint_2268 [Thiomonas intermedia K12]
 gi|295796828|gb|ADG31618.1| hypothetical protein Tint_2268 [Thiomonas intermedia K12]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +  +++A + PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEQYLPVLLFILVGIGVGVVPQLLGYLIAPRHPDAEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K +  +GF +MM+FL ILT+GFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDVGQIGFWAMMIFLAILTIGFIYEWKKGALDWE 119


>gi|74317160|ref|YP_314900.1| NADH dehydrogenase I subunit A [Thiobacillus denitrificans ATCC
           25259]
 gi|74056655|gb|AAZ97095.1| NADH dehydrogenase I chain A [Thiobacillus denitrificans ATCC
           25259]
          Length = 118

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A  I  +++  ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYLPILLFILVGLAFGIGPIVAGGLLAPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  ++I   GF +MMVFLGIL VGFIYEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLEEIGMAGFLAMMVFLGILVVGFIYEWMKGALEWE 118


>gi|82702220|ref|YP_411786.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosospira
           multiformis ATCC 25196]
 gi|82410285|gb|ABB74394.1| NADH dehydrogenase subunit A [Nitrosospira multiformis ATCC 25196]
          Length = 118

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  AI  + M   ++     PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFILLGLAIGALAMGFGWLFGPNRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV   +I   GF +MMVFLGIL VGFIYEW KGALEWD
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLNEIGLFGFIAMMVFLGILVVGFIYEWTKGALEWD 118


>gi|319943347|ref|ZP_08017629.1| threonine synthase [Lautropia mirabilis ATCC 51599]
 gi|319743162|gb|EFV95567.1| threonine synthase [Lautropia mirabilis ATCC 51599]
          Length = 119

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + S + I  M+   ++    PDPEKLS YECGF+ F DAR++ DIR+ 
Sbjct: 3   LNNYLPVLLFLFVGSLVGIGPMVIGKLLGPSRPDPEKLSAYECGFEAFGDARMQVDIRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV    I ++GF SMMVFLGIL +GFIYEW KGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLGTIGFIGFMSMMVFLGILVIGFIYEWGKGALDWE 119


>gi|313200458|ref|YP_004039116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. MP688]
 gi|312439774|gb|ADQ83880.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. MP688]
          Length = 120

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 92/119 (77%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           ++L +Y PIL+F+ +  A+ I  ++   +VA   PD EK S YECGF+ F+DAR+KFD+R
Sbjct: 2   NMLENYFPILLFIIVGLAVGIAPIVLGKVVAPSRPDAEKNSPYECGFEAFEDARMKFDVR 61

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + LV++LF++FDLEIAFLFPWAV  ++I   GF +M+VFLGIL VGF+YEW KGALEW+
Sbjct: 62  YYLVAILFILFDLEIAFLFPWAVVLQEIGLFGFIAMLVFLGILVVGFVYEWMKGALEWE 120


>gi|68171629|ref|ZP_00544996.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658152|ref|YP_507584.1| NADH dehydrogenase I, A subunit [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67998950|gb|EAM85634.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599609|gb|ABD45078.1| NADH dehydrogenase I, A subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 123

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+A++  I  +  I P ++A +SPD EKLS YECGF P  ++R  FDIRF 
Sbjct: 7   IAEYVPVLIFLAVSGFISFLFCILPMLLANRSPDLEKLSPYECGFAPLGNSRKIFDIRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMMVFL ILTVGFIYEW KGALEW+
Sbjct: 67  LVAILFIIFDLEIAFLFPWSICLSDIGINGFWSMMVFLAILTVGFIYEWSKGALEWE 123


>gi|330813982|ref|YP_004358221.1| NADH ubiquinone oxidoreductase chain A [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487077|gb|AEA81482.1| NADH ubiquinone oxidoreductase chain A [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 122

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/120 (55%), Positives = 91/120 (75%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++ L  YA IL+F+ I+  +    +   F+ +  +PD EKLS YECGF+ F D+R+KFD+
Sbjct: 3   TEFLRDYATILIFLFISIGLGFGFIFVNFLFSPSNPDTEKLSAYECGFEAFSDSRMKFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLE+AFLFPWAV   Q+  LGF SMM+FL +LT+GFIYEWKKGAL+W+
Sbjct: 63  RFYLVAILFIIFDLEVAFLFPWAVTLGQLGPLGFWSMMIFLTVLTIGFIYEWKKGALDWE 122


>gi|296116535|ref|ZP_06835145.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976747|gb|EFG83515.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 121

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  ++  Y P+L+F AIA  I   ++ S  +  ++ P  EK S YECGF+PFDD R +FD
Sbjct: 1   MHSVIADYFPVLIFGAIAVVIAAAMLGSSLLFGWQKPYSEKTSAYECGFEPFDDTRRRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I W GF SMM FL +LTVGFIYEW KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLSRIGWFGFLSMMGFLAVLTVGFIYEWCKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|255019907|ref|ZP_05291982.1| NADH ubiquinone oxidoreductase chain A [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970687|gb|EET28174.1| NADH ubiquinone oxidoreductase chain A [Acidithiobacillus caldus
           ATCC 51756]
          Length = 118

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P+L+F+ +A  + IV +     +  K PD EKLS YECGF+ F+DARVKFD+R+
Sbjct: 1   MLDHYLPVLIFLLVALVVGIVPLWLGSNLGPKRPDSEKLSPYECGFEAFEDARVKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV F  I   GF +MM+FL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVFDAIGVTGFLAMMIFLAILVVGFIYEWKKGALEWE 118


>gi|300113265|ref|YP_003759840.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Nitrosococcus watsonii C-113]
 gi|299539202|gb|ADJ27519.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           watsonii C-113]
          Length = 118

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+LVF+ ++  +  V+M+  F +A   PD EK+S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLVFIIVSLLLGGVMMVLGFGLAPYRPDREKISPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVVGFVYEWKKGALEWE 118


>gi|292493668|ref|YP_003529107.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
 gi|291582263|gb|ADE16720.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
          Length = 118

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +   I  V+M   F +A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLIFIIVGLLIGGVMMFLGFSLAPHRPDREKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL  GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVAGFVYEWKKGALEWE 118


>gi|121604330|ref|YP_981659.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Polaromonas
           naphthalenivorans CJ2]
 gi|223635469|sp|A1VM60|NUOA_POLNA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120593299|gb|ABM36738.1| NADH dehydrogenase subunit A [Polaromonas naphthalenivorans CJ2]
          Length = 119

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + I+ M+   ++    PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGVGVGILPMVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K+I  LGF S+MVFLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLKEIGALGFWSVMVFLGILVVGFVYEWKKGALDWE 119


>gi|22550341|ref|NP_689390.1| NADH dehydrogenase subunit 3 [Chaetosphaeridium globosum]
 gi|22417007|gb|AAM96606.1|AF494279_11 NADH dehydrogenase subunit 3 [Chaetosphaeridium globosum]
          Length = 116

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 89/115 (77%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +API +++ ++  + ++L+   F+ A  +  PEKLS YECGFDPFDDAR +FDIRF LV
Sbjct: 2   EFAPIGLYLIVSLILSLILVSVSFLFASSASYPEKLSAYECGFDPFDDARSRFDIRFYLV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           S+LF+IFDLE+ FLFPWAV   +I   GF SM++FL ILT+GFIYEWKKGAL+W+
Sbjct: 62  SILFIIFDLEVTFLFPWAVSLSKIGLFGFWSMIIFLLILTIGFIYEWKKGALDWE 116


>gi|10732664|gb|AAG22493.1|AF239263_1 NADH-ubiquinone oxidoreductase subunit 3 [Coix lacryma-jobi]
          Length = 118

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVFLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|194595688|gb|ACF77131.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Azospirillum
           brasilense]
          Length = 97

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + +I++ K+PD EKLS YECGF+PF+DAR KFD+RF LVS+LF+IFDLE+AFLFPWAV  
Sbjct: 4   ASYIISPKNPDSEKLSPYECGFEPFEDARTKFDVRFYLVSILFIIFDLEVAFLFPWAVAL 63

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             I   GF SM+VFLGILT+GFIYEWKKGALEW+
Sbjct: 64  GDIGLFGFWSMIVFLGILTIGFIYEWKKGALEWE 97


>gi|253998383|ref|YP_003050446.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. SIP3-4]
 gi|253985062|gb|ACT49919.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. SIP3-4]
          Length = 118

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A+ I  ++   +VA   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFIIVGLAVGIAPIVLGKVVAPSRPDAEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +M+VFLGIL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLQEIGLFGFIAMLVFLGILVVGFVYEWMKGALEWE 118


>gi|124266596|ref|YP_001020600.1| NADH dehydrogenase I subunit A [Methylibium petroleiphilum PM1]
 gi|124259371|gb|ABM94365.1| NADH dehydrogenase I chain A [Methylibium petroleiphilum PM1]
          Length = 119

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+++F+ + +A+ I   +  FI     PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LESYLPVILFILVGAAVGIAPQLIGFIFGPHRPDADKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K+I   GF +MMVFLGIL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKEIGAPGFWAMMVFLGILVVGFAYEWKKGALDWE 119


>gi|163855987|ref|YP_001630285.1| NADH-ubiquinone oxidoreductase chain A [Bordetella petrii DSM
           12804]
 gi|163259715|emb|CAP42016.1| NADH-ubiquinone oxidoreductase chain A [Bordetella petrii]
          Length = 119

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIAVATLIGFALLTAGSLLGPRRPYAEKLSAYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAHGAVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|260219922|emb|CBA26938.1| NADH-quinone oxidoreductase subunit A [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 130

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+  A+ ++  ++ +I+    PDP K S YECGF+PF DAR++F++RF 
Sbjct: 13  LEQYLPVLLFIAVGLAVGVLPQLAGYILGPSRPDPAKGSAYECGFEPFGDARMQFNVRFY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWA+  K+I   GF + MVFLGIL +GF YEW KGA++W+
Sbjct: 73  LVAILFIIFDLEIAFLFPWALALKEIGLPGFIAGMVFLGILCIGFAYEWAKGAMDWE 129


>gi|157964437|ref|YP_001499261.1| NADH dehydrogenase subunit A [Rickettsia massiliae MTU5]
 gi|157844213|gb|ABV84714.1| NADH dehydrogenase I chain A [Rickettsia massiliae MTU5]
          Length = 177

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 59  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 118

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 119 RFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 177


>gi|77166023|ref|YP_344548.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Nitrosococcus oceani ATCC 19707]
 gi|254436330|ref|ZP_05049836.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
 gi|76884337|gb|ABA59018.1| NADH dehydrogenase subunit A [Nitrosococcus oceani ATCC 19707]
 gi|207088020|gb|EDZ65293.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
          Length = 118

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+LVF+ ++  +  V+M+  F +A   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLVFIIVSLLLGGVMMVLGFGLAPYRPDREKTSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVVGFVYEWKKGALEWE 118


>gi|11465631|ref|NP_049302.1| NADH dehydrogenase subunit 3 [Porphyra purpurea]
 gi|6647616|sp|O99978|NU3M_PORPU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|4106938|gb|AAD03105.1| NADH dehydrogenase subunit 3 [Porphyra purpurea]
          Length = 121

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ L   Y+ IL F AI+ +I  +++   + +  +  D EK+S YECGF+PFDDAR  FD
Sbjct: 1   MNVLYNEYSAILTFFAISFSISTLILALSYFLNPQPSDQEKVSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPW++   Q++  GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFLIFDLEISFLFPWSLVLGQLSIFGFWSMIVFLIILTLGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|291613538|ref|YP_003523695.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sideroxydans
           lithotrophicus ES-1]
 gi|291583650|gb|ADE11308.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sideroxydans
           lithotrophicus ES-1]
          Length = 118

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ IA  + I+ +    ++    PD +KLS YECGF+ F+DAR+KFD+RF
Sbjct: 1   MLENYFPVLLFIGIALVMGILPLALGKLLGPNRPDEKKLSPYECGFEAFEDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  K+I   GF SMM+FL IL VGFIYEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLKEIGTFGFVSMMIFLAILVVGFIYEWMKGALEWE 118


>gi|2499257|sp|Q36664|NU3M_PINSY RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 118

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ A   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVCLIPLGVPFLFASNGSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|329114678|ref|ZP_08243437.1| NADH-quinone oxidoreductase subunit A 1 [Acetobacter pomorum DM001]
 gi|326696158|gb|EGE47840.1| NADH-quinone oxidoreductase subunit A 1 [Acetobacter pomorum DM001]
          Length = 127

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  YAP+LVF  ++  I   ++    +   + P  EKL+ YECGF+ FDDAR +FD
Sbjct: 7   MQSVLGDYAPVLVFGGMSVIIAAAMLGMALLSGHQKPYSEKLTAYECGFEAFDDARRRFD 66

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I   GF SM+ FL +L +GF+YEW+KGAL+W
Sbjct: 67  VRFYLVAILFIIFDLEVAFLFPWAITLGRIGLFGFLSMLGFLAVLGIGFLYEWRKGALDW 126

Query: 121 D 121
           D
Sbjct: 127 D 127


>gi|302879342|ref|YP_003847906.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gallionella
           capsiferriformans ES-2]
 gi|302582131|gb|ADL56142.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gallionella
           capsiferriformans ES-2]
          Length = 118

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +  A  +V ++   + A   PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLLFICVGLAFGVVPIVLGRLAAPHRPDAKKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  K+I   G+ SMM+FL IL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLKEIGMFGYVSMMIFLAILVVGFVYEWMKGALEWE 118


>gi|152980321|ref|YP_001353152.1| NADH dehydrogenase I chain A [Janthinobacterium sp. Marseille]
 gi|151280398|gb|ABR88808.1| NADH dehydrogenase I chain A [Janthinobacterium sp. Marseille]
          Length = 140

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   ++A   PD +KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 24  LENYFPVLLFILVGIGVGVVPQVLGRVLAPHKPDAQKLSPYECGFEAFEDARMKFDVRYY 83

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE+AFL PWAV  +++  LGF SMM+FLG+LT+G ++EWKKGAL+W+
Sbjct: 84  LVAILFILFDLEVAFLVPWAVAMREVGMLGFWSMMIFLGVLTIGLVFEWKKGALDWE 140


>gi|67458959|ref|YP_246583.1| NADH dehydrogenase subunit A [Rickettsia felis URRWXCal2]
 gi|75536603|sp|Q4UM05|NUOA_RICFE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|67004492|gb|AAY61418.1| NADH dehydrogenase I chain A [Rickettsia felis URRWXCal2]
          Length = 123

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 123


>gi|15604225|ref|NP_220741.1| NADH dehydrogenase subunit A [Rickettsia prowazekii str. Madrid E]
 gi|6647677|sp|Q9ZDH1|NUOA_RICPR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|3860917|emb|CAA14817.1| NADH DEHYDROGENASE I CHAIN A (nuoA) [Rickettsia prowazekii]
 gi|292571966|gb|ADE29881.1| NADH dehydrogenase I chain A [Rickettsia prowazekii Rp22]
          Length = 123

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  + +++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIAVLLSVLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEW KGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIAFLVPWAISLNTIGKMGFFSMMFFLFVLIIGFIYEWTKGALDW 123


>gi|239947490|ref|ZP_04699243.1| NADH-quinone oxidoreductase subunit A [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921766|gb|EER21790.1| NADH-quinone oxidoreductase subunit A [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 133

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF D R KFDI
Sbjct: 15  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDTRSKFDI 74

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 75  RFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 133


>gi|91776413|ref|YP_546169.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Methylobacillus flagellatus KT]
 gi|91710400|gb|ABE50328.1| NADH dehydrogenase subunit A [Methylobacillus flagellatus KT]
          Length = 118

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++   +V+   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFIIVGLVVGVAPIVLGKLVSPNRPDAEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +MMVFLGIL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLQEIGLFGFLAMMVFLGILVVGFVYEWMKGALEWE 118


>gi|134095031|ref|YP_001100106.1| NADH-quinone oxidoreductase subunit A [Herminiimonas
           arsenicoxydans]
 gi|133738934|emb|CAL61981.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [Herminiimonas arsenicoxydans]
          Length = 119

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   I+    PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LETYFPVLLFILVGIGVGVVPQVLGRILGPHKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE+AFL PWAV  +++  LGF SMM+FLG+LT+G ++EWKKGAL+W+
Sbjct: 63  LVAILFILFDLEVAFLVPWAVAMREVGMLGFWSMMIFLGVLTIGLVFEWKKGALDWE 119


>gi|258542722|ref|YP_003188155.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633800|dbj|BAH99775.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636859|dbj|BAI02828.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639912|dbj|BAI05874.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642968|dbj|BAI08923.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646023|dbj|BAI11971.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649076|dbj|BAI15017.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652063|dbj|BAI17997.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655120|dbj|BAI21047.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-12]
          Length = 121

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  YAP+LVF  ++  I   ++    +   + P  EKL+ YECGF+ FDDAR +FD
Sbjct: 1   MQSVLGDYAPVLVFGGMSVIIAAAMLGMALLSGHQKPYSEKLTAYECGFEAFDDARRRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I   GF SM+ FL +L +GF+YEW+KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAISLGRIGLFGFLSMLGFLAVLGIGFLYEWRKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|253996973|ref|YP_003049037.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           mobilis JLW8]
 gi|253983652|gb|ACT48510.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           mobilis JLW8]
          Length = 120

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A+ +  +I   +V+   PD  K S YECGF+ F+DAR+KFD+R+
Sbjct: 3   VLENYFPILLFILVGLAVGVGPLILSKLVSPSRPDSAKNSPYECGFEAFEDARMKFDVRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +MMVFLG+L +GFIYEW KGALEWD
Sbjct: 63  YLVAILFILFDLEIAFLFPWAVVLREIGLFGFLAMMVFLGVLVIGFIYEWMKGALEWD 120


>gi|58578979|ref|YP_197191.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417605|emb|CAI26809.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 141

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 25  ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 84

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 85  LVAILFIIFDLEIAFLFPWSICLSDIGIGGFWSMMIFLVILIIGFIYEWSKGALEWE 141


>gi|58617037|ref|YP_196236.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Gardel]
 gi|58416649|emb|CAI27762.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Gardel]
          Length = 141

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 25  ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 84

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 85  LVAILFIIFDLEIAFLFPWSICLSDIGVGGFWSMMIFLVILIIGFIYEWSKGALEWE 141


>gi|34496088|ref|NP_900303.1| NADH dehydrogenase I chain A [Chromobacterium violaceum ATCC 12472]
 gi|34101942|gb|AAQ58309.1| NADH dehydrogenase I chain A [Chromobacterium violaceum ATCC 12472]
          Length = 119

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 91/119 (76%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + ++ M+    +    PDPEKLS YECGF+ F+DAR++FD+R+
Sbjct: 1   MLENYFPILLFIVVGLLVGVLPMMLGRFLGPNRPDPEKLSPYECGFEAFEDARMRFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV  + ++   G G+M VFLGILT+GF+YEWKKGAL+WD
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVTLRDELGLFGLGAMAVFLGILTIGFVYEWKKGALQWD 119


>gi|157825618|ref|YP_001493338.1| NADH dehydrogenase subunit A [Rickettsia akari str. Hartford]
 gi|157799576|gb|ABV74830.1| NADH dehydrogenase subunit A [Rickettsia akari str. Hartford]
          Length = 123

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI VF  IA  +  ++MI P +++ K  + +KL  YECGF PF DAR KFDI
Sbjct: 5   SELLQEYLPIAVFFGIAVLVSGLIMILPNLLSTKHYNKDKLEPYECGFKPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFD+EIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDIEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 123


>gi|11466536|ref|NP_044785.1| NADH dehydrogenase subunit 3 [Reclinomonas americana]
 gi|6647606|sp|O21273|NU3M_RECAM RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|2258366|gb|AAD11900.1| NADH dehydrogenase subunit 3 [Reclinomonas americana]
          Length = 122

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L+F   +  +  +++   +++A ++ D EKLS YECGF+PFDDAR  FD+RF
Sbjct: 5   ILSEYLSVLIFFIFSFGLSCIILGLSYVLATQNADTEKLSPYECGFNPFDDARGAFDVRF 64

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+AFLFPWAV    +T  GF +M +FL ILTVGFIYEWKKGAL+W+
Sbjct: 65  YLVAILFIIFDLEVAFLFPWAVALSDVTIFGFWTMFIFLLILTVGFIYEWKKGALDWE 122


>gi|311104658|ref|YP_003977511.1| NADH-quinone oxidoreductase subunit A [Achromobacter xylosoxidans
           A8]
 gi|310759347|gb|ADP14796.1| NADH-quinone oxidoreductase subunit A [Achromobacter xylosoxidans
           A8]
          Length = 119

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIVVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  LGF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLLGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|187477541|ref|YP_785565.1| NADH dehydrogenase I subunit A [Bordetella avium 197N]
 gi|115422127|emb|CAJ48651.1| NADH dehydrogenase I chain A [Bordetella avium 197N]
          Length = 119

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIAVATLIGFALITAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|224824823|ref|ZP_03697930.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Lutiella
           nitroferrum 2002]
 gi|224603316|gb|EEG09492.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Lutiella
           nitroferrum 2002]
          Length = 118

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++  ++VA   PDPEKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLQNYFPILLFVIVGLLVGVGPILLGWLVAPNRPDPEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEI FLFPWAV  K++   GFG M+ F+ +LT+GF+Y WKKGALEW+
Sbjct: 61  YLVAILFILFDLEITFLFPWAVVLKELGAFGFGVMVEFIAVLTLGFVYMWKKGALEWE 118


>gi|57239037|ref|YP_180173.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161116|emb|CAH58027.1| putative NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 123

 Score =  136 bits (343), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 7   ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 67  LVAILFIIFDLEIAFLFPWSICLSDIGIGGFWSMMIFLVILIIGFIYEWSKGALEWE 123


>gi|186920125|ref|YP_001874779.1| NADH dehydrogenase subunit 3 [Hemiselmis andersenii]
 gi|186461071|gb|ACC78233.1| NADH dehydrogenase subunit 3 [Hemiselmis andersenii]
          Length = 121

 Score =  136 bits (343), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+   + Y  +LVFM ++     +     + VA +  D EKLS YECGFDPF+DAR  FD
Sbjct: 1   MALFFSQYFSLLVFMVLSIVFSCIFFFLSYAVATQKADTEKLSAYECGFDPFNDARNTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPWA+    ++   F SM++FL ILTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEISFLFPWAIALGDLSIFSFWSMIIFLFILTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|332526747|ref|ZP_08402849.1| NADH dehydrogenase I subunit A [Rubrivivax benzoatilyticus JA2]
 gi|332111150|gb|EGJ11182.1| NADH dehydrogenase I subunit A [Rubrivivax benzoatilyticus JA2]
          Length = 119

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y P+++F+ +  A+ +   +  FI     PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IQAYLPVILFVLVGLAVGVAPQVLGFIFGPNRPDVEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV    I   GF +MM+FLGIL VGF+YEWKKGAL+WD
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALHDIGATGFWAMMLFLGILVVGFVYEWKKGALDWD 119


>gi|170581931|ref|XP_001895903.1| NADH dehydrogenase I, A subunit  [Brugia malayi]
 gi|158597003|gb|EDP35244.1| NADH dehydrogenase I, A subunit , putative [Brugia malayi]
          Length = 172

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 84/116 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I +F+ ++  + + L + P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLAIAIFICVSIILSLALGVLPMFLAISKPDSEKLSTYECGFNPLSRARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LVS LF+IFDLEIAFLFP A+   +I++ GF SMM+FL ILTVGFI+EW KGALEW
Sbjct: 61  LVSXLFMIFDLEIAFLFPCAISLSKISYCGFWSMMIFLAILTVGFIHEWCKGALEW 116


>gi|319794668|ref|YP_004156308.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus EPS]
 gi|315597131|gb|ADU38197.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus EPS]
          Length = 129

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   + +   +  +I+    PD  K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 13  LDSYLPVLLFILVGVGVGVAPQVIGYILGPNRPDAAKNAPYECGFEAFEDARMKFDVRYY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+  K+I  +GF +MM+FL IL VGFIYEWKKGAL+W+
Sbjct: 73  LVAILFILFDLEIAFLFPWAIALKEIGAVGFWAMMIFLAILVVGFIYEWKKGALDWE 129


>gi|73666918|ref|YP_302934.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           canis str. Jake]
 gi|72394059|gb|AAZ68336.1| NADH dehydrogenase subunit A [Ehrlichia canis str. Jake]
          Length = 123

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+A+A  I  +  + P ++A  +PD EKLS YECGF P   +R  FD+RF 
Sbjct: 7   IAEYVPVLIFLAVAGFISFLFAVLPMLLAKCNPDLEKLSPYECGFAPLGSSRKIFDVRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL ILTVGFIYEW KGALEW+
Sbjct: 67  LVAILFIIFDLEIAFLFPWSICLSDIGVNGFWSMMIFLAILTVGFIYEWSKGALEWE 123


>gi|293603919|ref|ZP_06686334.1| NADH-quinone oxidoreductase subunit A [Achromobacter piechaudii
           ATCC 43553]
 gi|292817756|gb|EFF76822.1| NADH-quinone oxidoreductase subunit A [Achromobacter piechaudii
           ATCC 43553]
 gi|317401988|gb|EFV82588.1| NADH-ubiquinone oxidoreductase chain A [Achromobacter xylosoxidans
           C54]
          Length = 119

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIVVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|6647624|sp|Q96007|NU3M_ALLCE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1518344|emb|CAA89850.1| NADH dehydrogenase subunit 3 [Allium cepa]
          Length = 118

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ ++  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVMSLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|85374166|ref|YP_458228.1| NADH dehydrogenase I chain A [Erythrobacter litoralis HTCC2594]
 gi|84787249|gb|ABC63431.1| NADH Dehydrogenase I Chain A [Erythrobacter litoralis HTCC2594]
          Length = 124

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 86/121 (71%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF----IVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L+ Y PIL+F+ IA  +  + +  P     +    +P+ EKLS YECGF  F+DAR +FD
Sbjct: 4   LSQYLPILIFLFIAVGLSALFVFLPMGVSRLTGAHNPNAEKLSEYECGFPAFEDARSRFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV      W+G+  MM+FL ILTVGF YEWKKGALEW
Sbjct: 64  VRFYLVAILFIIFDLEVAFLFPWAVSLDHSGWIGWIGMMIFLVILTVGFAYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|41203470|ref|NP_957730.1| NADH dehydrogenase subunit 3 [Emiliania huxleyi]
 gi|33114156|gb|AAP94712.1| NADH dehydrogenase subunit 3 [Emiliania huxleyi]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 95/118 (80%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++T+Y+ IL+F+ IA  + +++   P+++++K+ D EK S+YECGF+PF D+R +F+I+F
Sbjct: 2   IITNYSGILLFLVIAIILAVIVFAIPYLLSYKTIDREKFSSYECGFNPFKDSRNEFEIKF 61

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEI+FLFP+ +   Q+T +G GSM +FL +LTVGF YEWKKG+L+W+
Sbjct: 62  YLVAILFLIFDLEISFLFPFIMCLDQLTIVGVGSMFIFLLVLTVGFYYEWKKGSLDWE 119


>gi|321268732|gb|ADW79181.1| NADH dehydrogenase subunit 3 [Cyanophora paradoxa]
          Length = 123

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L   Y  + +F  ++  +  ++  + + +A +  D EK+S YECGF+PF+DAR  FDIRF
Sbjct: 6   LYNQYFDLFLFFIVSFILACIIFGASYFIALQKTDSEKVSAYECGFNPFEDARSTFDIRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ FLFPWA+  +Q T +GF SM +FL ILT+GFIYEW KGALEW+
Sbjct: 66  YLVSILFIIFDLEVVFLFPWALTLQQTTIIGFTSMFIFLIILTIGFIYEWLKGALEWE 123


>gi|149927541|ref|ZP_01915795.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Limnobacter
           sp. MED105]
 gi|149823814|gb|EDM83040.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Limnobacter
           sp. MED105]
          Length = 119

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   +    M+   ++A   PD +KLS YECGF+ F+DAR++FD+R+ 
Sbjct: 3   LESYFPVLMFILVGIGVGGGAMLVGRVLAPHRPDGQKLSPYECGFEAFEDARMQFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV +++I  +GF +MM+FLG+L VGFIYEW +GAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVAYREIGPVGFWAMMIFLGVLVVGFIYEWTRGALDWE 119


>gi|121609762|ref|YP_997569.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Verminephrobacter eiseniae EF01-2]
 gi|121554402|gb|ABM58551.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Verminephrobacter eiseniae EF01-2]
          Length = 136

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ +V ++  +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 20  LDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 79

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +Q+   GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 80  LVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE 136


>gi|289207893|ref|YP_003459959.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. K90mix]
 gi|288943524|gb|ADC71223.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. K90mix]
          Length = 118

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+A+   I IV ++    V  + PD  K S YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLEGYLPILLFIAVGIVIGIVPLVVGMAVGPRKPDAAKNSPYECGFEAFEDSRLKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   G  +M VFL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVSLDAIGLFGLLAMAVFLLILVVGFIYEWKKGALEWE 118


>gi|110225667|ref|YP_665673.1| NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
 gi|6066182|gb|AAF03200.1|AF110138_32 NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
          Length = 118

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF-KSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  Y  ILV++ I+  +  +++   F+V   +  DPEKLS YECGFDPF+DAR +FDIRF
Sbjct: 1   MLEYISILVYLIISLGLAGLILGLSFLVGTPQKADPEKLSAYECGFDPFEDARGRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+ FLFPWAV   +    GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 61  YLVAILFIIFDLEVTFLFPWAVTLSKQGLFGFWSMMVFLMILTIGFVYEWKKGALDWE 118


>gi|256821515|ref|YP_003145478.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Kangiella
           koreensis DSM 16069]
 gi|256795054|gb|ACV25710.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Kangiella
           koreensis DSM 16069]
          Length = 118

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  YAPILVF+ I       L++  +  +  +PDPEK   +ECGFD F+D+R+KFD+RF
Sbjct: 1   MIEQYAPILVFIIIGLLFGTGLLLVGYFASPTNPDPEKEKAFECGFDAFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV F  + W G  SM VFL +L +GF YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVFDDLGWFGVVSMGVFLLLLLIGFAYEWKKGALEWE 118


>gi|87200317|ref|YP_497574.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135998|gb|ABD26740.1| NADH dehydrogenase subunit A [Novosphingobium aromaticivorans DSM
           12444]
          Length = 128

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 85/125 (68%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDAR 56
            +  L  Y PIL+F+ IA A+    +  P  VA      +P  EKLS YECGF  F+D R
Sbjct: 4   QASYLAQYLPILIFLGIALALSAAFVFLPMGVARLTGAHNPTAEKLSEYECGFPAFEDPR 63

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +FD+RF LV++LF+IFDLE AFLFPWAV  K+  W G+ +MMVFLG L +GFIY WKKG
Sbjct: 64  SQFDVRFYLVAILFIIFDLEAAFLFPWAVSLKETGWAGWTTMMVFLGELVIGFIYAWKKG 123

Query: 117 ALEWD 121
           AL+W+
Sbjct: 124 ALDWE 128


>gi|11497474|ref|NP_042264.1| NADH dehydrogenase (ubiquinone), subunit 3 [Prototheca wickerhamii]
 gi|6647623|sp|Q37625|NU3M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|467865|gb|AAD12652.1| NADH dehydrogenase (ubiquinone), subunit 3 [Prototheca wickerhamii]
          Length = 117

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  IL++  IA A+ ++L+  PF+V+ +  DPEK+S YECGFDPFDDAR +FDI+F 
Sbjct: 1   MYEFLGILIYFFIALALSLLLLGLPFLVSTRKADPEKISAYECGFDPFDDARGRFDIQFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+IFDLE+AFLFPWA+   +I + GF SMM+FL ILTVGFIYEW+KGAL+W
Sbjct: 61  LVAILFIIFDLEVAFLFPWALTLNKIGYFGFWSMMLFLFILTVGFIYEWRKGALDW 116


>gi|194033229|ref|YP_002000566.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|60498743|dbj|BAC19871.2| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
          Length = 155

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 1/121 (0%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFD 60
           S  L+ +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FD
Sbjct: 35  SAFLSEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFD 94

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W
Sbjct: 95  IRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDW 154

Query: 121 D 121
           +
Sbjct: 155 E 155


>gi|15892408|ref|NP_360122.1| NADH dehydrogenase subunit A [Rickettsia conorii str. Malish 7]
 gi|34580590|ref|ZP_00142070.1| NADH dehydrogenase I chain A [Rickettsia sibirica 246]
 gi|229586624|ref|YP_002845125.1| NADH dehydrogenase subunit A [Rickettsia africae ESF-5]
 gi|15619559|gb|AAL03023.1| NADH dehydrogenase I chain A [Rickettsia conorii str. Malish 7]
 gi|28261975|gb|EAA25479.1| NADH dehydrogenase I chain A [Rickettsia sibirica 246]
 gi|228021674|gb|ACP53382.1| NADH dehydrogenase I chain A [Rickettsia africae ESF-5]
          Length = 132

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 14  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 73

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 74  CFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 132


>gi|223635538|sp|A1WLP4|NUOA_VEREI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 119

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ +V ++  +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +Q+   GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE 119


>gi|313768554|ref|YP_004062228.1| NADH dehydrogenase subunit 3 [Plocamiocolax pulvinata]
 gi|312844681|gb|ADR03244.1| NADH dehydrogenase subunit 3 [Plocamiocolax pulvinata]
          Length = 121

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y  ILVF+ I+  I  ++ + P+ V  K  D EKLS YECGF+PFDDAR  FD
Sbjct: 1   MKLIFTEYFSILVFLLISLLISCIIFLLPYYVIKKKSDQEKLSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLEI+FLFPW +    I   GF SM+ FL ILT GF YEW KGALEW
Sbjct: 61  IRFYLVAILFLIFDLEISFLFPWVLVLGDILLYGFWSMVFFLIILTFGFFYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|33592007|ref|NP_879651.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella pertussis Tohama
           I]
 gi|33597911|ref|NP_885554.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella parapertussis
           12822]
 gi|33602816|ref|NP_890376.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella bronchiseptica
           RB50]
 gi|33571651|emb|CAE41144.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           pertussis Tohama I]
 gi|33574340|emb|CAE38676.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           parapertussis]
 gi|33577258|emb|CAE35815.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           bronchiseptica RB50]
 gi|332381423|gb|AEE66270.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella pertussis CS]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LHPYFPVLLFILVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|103486797|ref|YP_616358.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingopyxis
           alaskensis RB2256]
 gi|98976874|gb|ABF53025.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingopyxis
           alaskensis RB2256]
          Length = 124

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDARVKFD 60
           LT Y PIL+F+ IA  +    +  P  VA       PDP KLS YECGF  F+DAR +FD
Sbjct: 4   LTQYLPILIFLVIAVGLSAAFVFLPMGVARLTGAHKPDPAKLSEYECGFPAFEDARSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV  ++I W G+ +MMVFL  L +G IY WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLEEIGWAGWVTMMVFLAELAIGLIYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|301631483|ref|XP_002944827.1| PREDICTED: NADH-quinone oxidoreductase subunit A-like [Xenopus
           (Silurana) tropicalis]
          Length = 124

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ + +A+ ++ ++  +++    P+PEK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 8   LDQYLPVLLFILVGAAVGVLPLVFGYVLGPNRPNPEKNSPYECGFEAFEDARMKFDVRYY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  + +   GF ++ +FL IL VGF YEWKKGAL+W+
Sbjct: 68  LVAILFILFDLEIAFLFPWAVALRDVGLAGFIAVAIFLAILVVGFAYEWKKGALDWE 124


>gi|239816483|ref|YP_002945393.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus S110]
 gi|239803060|gb|ACS20127.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus S110]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   + +   +  +I+    PD  K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDSYLPVLLFILVGVGVGVAPQVIGYILGPNRPDAAKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+  K+I  +GF +MM+FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIALKEIGAVGFWAMMIFLAILVVGFAYEWKKGALDWE 119


>gi|157828359|ref|YP_001494601.1| NADH dehydrogenase subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800840|gb|ABV76093.1| NADH dehydrogenase subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 176

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI 
Sbjct: 59  ELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIC 118

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 119 FYLVAILFIIFDLEIAFLVPWAISLNTIGQIGFFSMMFFLFVLIIGFIYEWKKGALDW 176


>gi|288942134|ref|YP_003444374.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Allochromatium vinosum DSM 180]
 gi|288897506|gb|ADC63342.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Allochromatium vinosum DSM 180]
          Length = 118

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++  +++  + PD EK S YECGF+ F+ AR+KFD+R+
Sbjct: 1   MLDNYLPILIFILVGILVGVGPLVMGYLLGPRRPDSEKDSPYECGFEAFESARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   ++    F +M+VFLGIL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALGELGLFAFWAMVVFLGILVVGFIYEWKKGALEWE 118


>gi|296108432|ref|YP_003620133.1| NADH dehydrogenase I chain A [Legionella pneumophila 2300/99 Alcoy]
 gi|295650334|gb|ADG26181.1| NADH dehydrogenase I chain A [Legionella pneumophila 2300/99 Alcoy]
          Length = 118

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ IA  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIIALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|171058185|ref|YP_001790534.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Leptothrix
           cholodnii SP-6]
 gi|223635509|sp|B1Y827|NUOA_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|170775630|gb|ACB33769.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Leptothrix
           cholodnii SP-6]
          Length = 119

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+++F+ +   + +   +  F++  + P   K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LENYLPVILFILVGVGVGVAPQVLGFLLGPRRPYAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  ++I   GF +MM+FLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLREIGATGFWAMMIFLGILVVGFVYEWKKGALDWE 119


>gi|165933067|ref|YP_001649856.1| NADH:ubiquinone oxidoreductase subunit A [Rickettsia rickettsii
           str. Iowa]
 gi|165908154|gb|ABY72450.1| NADH-quinone oxidoreductase chain A [Rickettsia rickettsii str.
           Iowa]
          Length = 177

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI 
Sbjct: 60  ELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIC 119

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 120 FYLVAILFIIFDLEIAFLVPWAISLNTIGQIGFFSMMFFLFVLIIGFIYEWKKGALDW 177


>gi|157803901|ref|YP_001492450.1| NADH dehydrogenase subunit A [Rickettsia canadensis str. McKiel]
 gi|157785164|gb|ABV73665.1| NADH dehydrogenase alpha subunit [Rickettsia canadensis str.
           McKiel]
          Length = 123

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+ L  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SEFLQEYLPIAIFCIIAVLVSSLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIVFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 123


>gi|238651034|ref|YP_002916891.1| NADH dehydrogenase subunit A [Rickettsia peacockii str. Rustic]
 gi|20139042|sp|Q92ID5|NUOA_RICCN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|238625132|gb|ACR47838.1| NADH dehydrogenase subunit A [Rickettsia peacockii str. Rustic]
          Length = 123

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 65  CFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 123


>gi|328775175|gb|AEB39982.1| NADH dehydrogenase subunit 3 [Funaria hygrometrica]
 gi|328775233|gb|AEB40012.1| NADH dehydrogenase subunit 3 [Funaria hygrometrica]
          Length = 118

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 89/117 (76%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFC 64
            +API V++ I+  + ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF 
Sbjct: 2   EFAPICVYLVISLLLSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLE+ FLFPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 62  LVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|220934162|ref|YP_002513061.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995472|gb|ACL72074.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 118

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + I+ +    ++    PD  K S YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLENYLPILIFIGVGLLVGIIPLALGMVIGPHRPDGAKNSPYECGFEAFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   G  +M +FLGIL +GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALDSIGLFGLLAMALFLGILVIGFIYEWKKGALEWE 118


>gi|52842987|ref|YP_096786.1| NADH dehydrogenase I, A subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295618|ref|YP_128033.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Lens]
 gi|52630098|gb|AAU28839.1| NADH dehydrogenase I, A subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53755450|emb|CAH16946.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Lens]
 gi|307611659|emb|CBX01350.1| NADH dehydrogenase I chain A [Legionella pneumophila 130b]
          Length = 118

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ +A  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIVALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|78485162|ref|YP_391087.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Thiomicrospira crunogena XCL-2]
 gi|78363448|gb|ABB41413.1| NADH dehydrogenase I chain A [Thiomicrospira crunogena XCL-2]
          Length = 118

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ +     +  ++  +++  + PD EKLS YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLENYLPILVFVVLGILFGVGPILMGYLLGPQRPDAEKLSPYECGFEVFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV  +++   G  +M VFL +L VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALEEVGTFGLLAMGVFLTLLVVGFIYEWKKGALEWE 118


>gi|121593377|ref|YP_985273.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Acidovorax
           sp. JS42]
 gi|223635443|sp|A1W4M2|NUOA_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120605457|gb|ABM41197.1| NADH dehydrogenase subunit A [Acidovorax sp. JS42]
          Length = 119

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PDP K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF +++VFL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE 119


>gi|114321119|ref|YP_742802.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227513|gb|ABI57312.1| NADH dehydrogenase subunit A [Alkalilimnicola ehrlichii MLHE-1]
          Length = 118

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+       +V +   F++A   PD EKLS YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLENYLPILVFIIFGLLFGMVFLAVGFLLAPSKPDAEKLSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWA+    I   G  +M +F+G+L +GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAIVLDDIGMFGILAMALFIGLLLIGFLYEWKKGALEWE 118


>gi|270158114|ref|ZP_06186771.1| NADH-quinone oxidoreductase A subunit [Legionella longbeachae
           D-4968]
 gi|289163621|ref|YP_003453759.1| NADH dehydrogenase I chain A [Legionella longbeachae NSW150]
 gi|269990139|gb|EEZ96393.1| NADH-quinone oxidoreductase A subunit [Legionella longbeachae
           D-4968]
 gi|288856794|emb|CBJ10605.1| NADH dehydrogenase I chain A [Legionella longbeachae NSW150]
          Length = 118

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+L+F+ I  A+ + ++ +  + +   PD  K + YECGF  F++A + FD+RF
Sbjct: 1   MLSQYFPVLIFIIIGVALGLAMIGAGSLFSKHMPDNAKNAPYECGFGAFENAHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF  MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALVLRKIGWFGFAGMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|54298772|ref|YP_125141.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Paris]
 gi|53752557|emb|CAH13989.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Paris]
          Length = 118

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ +A  +  V++ +  +++  SP+  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIVALILGAVMIGAGSLLSKHSPNSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|319761762|ref|YP_004125699.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Alicycliphilus denitrificans BC]
 gi|330826542|ref|YP_004389845.1| NAD(P)H-quinone oxidoreductase subunit 3 [Alicycliphilus
           denitrificans K601]
 gi|317116323|gb|ADU98811.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Alicycliphilus denitrificans BC]
 gi|329311914|gb|AEB86329.1| NAD(P)H-quinone oxidoreductase subunit 3 [Alicycliphilus
           denitrificans K601]
          Length = 129

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PDP K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 13  LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFDDARMKFDVRYY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  + +   GF ++++FL IL +GF YEWKKGAL+W+
Sbjct: 73  LVAILFILFDLEIAFLFPWAVALQDVGATGFVAVVIFLSILVIGFAYEWKKGALDWE 129


>gi|71906588|ref|YP_284175.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Dechloromonas aromatica RCB]
 gi|71846209|gb|AAZ45705.1| NADH dehydrogenase subunit A [Dechloromonas aromatica RCB]
          Length = 124

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +Y PIL+F+ +  AI ++ +   FI+A   PDPEKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MMENYFPILMFVLVGVAIGVLPVAMGFILAPSRPDPEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLE+AFLFPWA  FK       I   GF  M+VF+ IL +G+IY W KGA
Sbjct: 61  YLIAILFILFDLEVAFLFPWATIFKDIVATESIKMFGFVEMLVFVAILVLGYIYAWAKGA 120

Query: 118 LEWD 121
           LEW+
Sbjct: 121 LEWE 124


>gi|38638281|ref|NP_943679.1| NADH dehydrogenase subunit 3 [Chara vulgaris]
 gi|32966595|gb|AAP92178.1| NADH dehydrogenase subunit 3 [Chara vulgaris]
          Length = 118

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/83 (75%), Positives = 72/83 (86%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS YECGFDPFDDAR +FDIRF LVS+LF+IFDLE+ FLFPWAV F +I   GF SM
Sbjct: 36  PEKLSAYECGFDPFDDARSRFDIRFYLVSILFLIFDLEVTFLFPWAVSFNKIGLFGFWSM 95

Query: 99  MVFLGILTVGFIYEWKKGALEWD 121
           MVFL ILT+GF+YEWKKGAL+W+
Sbjct: 96  MVFLLILTIGFVYEWKKGALDWE 118


>gi|323398668|ref|YP_004222743.1| NADH dehydrogenase subunit 3 [Glaucocystis nostochinearum]
 gi|321401361|gb|ADW83115.1| NADH dehydrogenase subunit 3 [Glaucocystis nostochinearum]
          Length = 123

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L   Y  + ++++I+  + +V+    + VA +  D EK+S YECGF+PFDDAR  FDIRF
Sbjct: 6   LHQQYFVLFIYLSISIILSVVIFGLSYFVASQRADSEKVSAYECGFNPFDDARNTFDIRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+AFLFPWA+   +   LGF SM++FL +LT+GF YEW KGALEW+
Sbjct: 66  YLVSILFIIFDLEVAFLFPWALTLSKTYLLGFWSMIIFLILLTIGFFYEWMKGALEWE 123


>gi|329850729|ref|ZP_08265574.1| NADH-quinone oxidoreductase chain 7 [Asticcacaulis biprosthecum
           C19]
 gi|328841044|gb|EGF90615.1| NADH-quinone oxidoreductase chain 7 [Asticcacaulis biprosthecum
           C19]
          Length = 125

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L +Y P+++F  IA+A+ +  +I+  ++A K+PD EKLS YECGF  FD AR KFD
Sbjct: 1   MAKFLLNYLPVIIFFGIATALGLGFLIAALVMAPKAPDTEKLSAYECGFPAFDSARQKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG----FGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF++FD+E AFLFPWAV    +T  G    F +MM+FL  L +G++Y WKKG
Sbjct: 61  VRFYLVSILFIVFDIEAAFLFPWAVSLFDMTPSGMQYAFWTMMIFLAELALGYVYVWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|332528751|ref|ZP_08404728.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hylemonella
           gracilis ATCC 19624]
 gi|332041817|gb|EGI78166.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hylemonella
           gracilis ATCC 19624]
          Length = 119

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ ++  +  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGLAVGVLPQVIGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K +  +GF + MVF+ IL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDVGAVGFWAAMVFIAILVVGFVYEWKKGALDWE 119


>gi|83746297|ref|ZP_00943350.1| NADH-quinone oxidoreductase chain A [Ralstonia solanacearum UW551]
 gi|207723873|ref|YP_002254271.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum MolK2]
 gi|207742735|ref|YP_002259127.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum IPO1609]
 gi|300703642|ref|YP_003745244.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CFBP2957]
 gi|83727047|gb|EAP74172.1| NADH-quinone oxidoreductase chain A [Ralstonia solanacearum UW551]
 gi|206589078|emb|CAQ36040.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum MolK2]
 gi|206594129|emb|CAQ61056.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum IPO1609]
 gi|299071305|emb|CBJ42623.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CFBP2957]
          Length = 119

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDPEKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVIGVGLGLALMSIGRILGPNNPDPEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|241763288|ref|ZP_04761345.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           delafieldii 2AN]
 gi|241367563|gb|EER61850.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           delafieldii 2AN]
          Length = 119

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ IV ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFVLVGVAVGIVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF ++++FL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVVIFLAILVVGFAYEWKKGALNWE 119


>gi|223635539|sp|Q21YC7|NUOA_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 119

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PI +F+ +   + +   +  +I+    PD  K S YECGF+ F DAR+KFD+R+ 
Sbjct: 3   LDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  LGF S+MVFL IL VGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE 119


>gi|89900286|ref|YP_522757.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Rhodoferax
           ferrireducens T118]
 gi|89345023|gb|ABD69226.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodoferax
           ferrireducens T118]
          Length = 137

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PI +F+ +   + +   +  +I+    PD  K S YECGF+ F DAR+KFD+R+ 
Sbjct: 21  LDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVRYY 80

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  LGF S+MVFL IL VGFIYEWKKGAL+W+
Sbjct: 81  LVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE 137


>gi|313768497|ref|YP_004062173.1| NADH dehydrogenase subunit 3 [Gracilariophila oryzoides]
 gi|312844624|gb|ADR03189.1| NADH dehydrogenase subunit 3 [Gracilariophila oryzoides]
          Length = 121

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y+ IL+F+ I+  + + +    + +  +  D EK+S YECGF+PFDDARV FD
Sbjct: 1   MKLIFTEYSIILMFLVISFILSVAIFSLSYFLIPQKADQEKVSAYECGFNPFDDARVTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPW++    I   GF SM++FL ILT+GFIYEW KGALEW
Sbjct: 61  VRFYLVAILFLIFDLEISFLFPWSLVLGNIPLFGFWSMIIFLLILTLGFIYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|57639721|gb|AAW55707.1| NADH dehydrogenase subunit 3 [Thuidium recognitum]
          Length = 114

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 82/110 (74%), Gaps = 2/110 (1%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           PI V++ I+    ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF LVS
Sbjct: 1   PICVYLVISLLFSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+IFDLE+ FLFPWAV   +I   GF SM+VFL ILT+GF+YEWKKGA
Sbjct: 61  ILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMIVFLSILTIGFLYEWKKGA 110


>gi|51473551|ref|YP_067308.1| NADH dehydrogenase subunit A [Rickettsia typhi str. Wilmington]
 gi|81692303|sp|Q68X16|NUOA_RICTY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|51459863|gb|AAU03826.1| NADH dehydrogenase (ubiquinone) subunit A [Rickettsia typhi str.
           Wilmington]
          Length = 123

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 84/119 (70%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++M+ P +++ K  + +KL  YECGF PF DAR KFDI
Sbjct: 5   SELLHEYLPIAIFFGIAVLVSGLIMMLPNLLSTKKYNKDKLEPYECGFAPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +L +GFIYEW KGAL+W
Sbjct: 65  RFYLVAILFIIFDLEITFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWTKGALDW 123


>gi|15130812|emb|CAC48165.1| NADH dehydrogenase subunit 3 [Daucus carota]
          Length = 118

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ AF S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFAFNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|148361102|ref|YP_001252309.1| NADH dehydrogenase I subunit A [Legionella pneumophila str. Corby]
 gi|148282875|gb|ABQ56963.1| NADH dehydrogenase I, A subunit [Legionella pneumophila str. Corby]
          Length = 118

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ IA  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIIALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+ ALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRSALEWE 118


>gi|23464620|ref|NP_696988.1| NADH dehydrogenase subunit 9 [Monosiga brevicollis ATCC 50154]
 gi|23344083|gb|AAN28359.1| NADH dehydrogenase subunit 9 [Monosiga brevicollis]
          Length = 118

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y+ +L+F+ +A A+  VL+ + ++++ K+PD EK+  YECGF+PF D+R  F++RF
Sbjct: 1   MLFEYSAVLIFLIVALALSCVLLGASYLLSNKNPDYEKVQQYECGFNPFSDSRQPFEVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW++    I   G+ +M+ FLGILT+G +YEW KG LEW+
Sbjct: 61  FLVGILFIIFDLEISFLFPWSLVLSDIHVFGYWTMVTFLGILTIGLVYEWLKGGLEWE 118


>gi|308072459|dbj|BAJ22091.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
          Length = 118

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 87/114 (76%), Gaps = 1/114 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF LVS
Sbjct: 5   APICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVS 64

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +LF+IFDLE+ F FPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 65  ILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|171463526|ref|YP_001797639.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|223635470|sp|B1XUJ8|NUOA_POLNS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|171193064|gb|ACB44025.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V M    I+A   PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I WLG+ SM++FL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWLGYASMVIFLLEFIVGFVYIWKKGALDWE 119


>gi|254468438|ref|ZP_05081844.1| NADH-ubiquinone oxidoreductase chain 3 [beta proteobacterium KB13]
 gi|207087248|gb|EDZ64531.1| NADH-ubiquinone oxidoreductase chain 3 [beta proteobacterium KB13]
          Length = 118

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+F+ +   + I  ++   I+A   P+ +K S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLDSYFPVLLFILVGLGVGIGPLVLGKILAPHKPNDQKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEI FLFPWAV    +   GF  MM+FLGIL VGFIYEWKKGAL+W+
Sbjct: 61  YLVAILFILFDLEITFLFPWAVVLDSLGLQGFIVMMIFLGILVVGFIYEWKKGALDWE 118


>gi|119897687|ref|YP_932900.1| putative NADH-ubiquinone oxidoreductase subunit A [Azoarcus sp.
           BH72]
 gi|119670100|emb|CAL94013.1| putative NADH-ubiquinone oxidoreductase chain A [Azoarcus sp. BH72]
          Length = 124

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 91/124 (73%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +   I +V ++   ++A   PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFILVGLGIGVVPVVLGRVIAPHRPDSQKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      ++ W  FGS+MVFL IL +G+I EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQDFIAAGELAWFVFGSVMVFLAILVIGYIVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|309379803|emb|CBX21579.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|221068612|ref|ZP_03544717.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Comamonas
           testosteroni KF-1]
 gi|220713635|gb|EED69003.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Comamonas
           testosteroni KF-1]
          Length = 119

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ I  A+ +V +   +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILIGMAVGVVPLALGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  K +  +GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALKDVGGVGFVAVLIFLAILVVGFAYEWKKGALDWE 119


>gi|11467110|ref|NP_054411.1| NADH dehydrogenase subunit 3 [Marchantia polymorpha]
 gi|464236|sp|P26847|NU3M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|404358|gb|AAB27399.1| NADH dehydrogenase subunit 3=nad3 gene product [Marchantia
           polymorpha=liverworts, Peptide Mitochondrial, 118 aa]
 gi|786195|gb|AAC09408.1| nad3 [Marchantia polymorpha]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/83 (74%), Positives = 71/83 (85%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS YECGFDPFDDAR +FDIRF LVS+LF+IFDLE+ FLFPWAV   +I   GF SM
Sbjct: 36  PEKLSAYECGFDPFDDARSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSM 95

Query: 99  MVFLGILTVGFIYEWKKGALEWD 121
           MVFL ILT+GF+YEWKKGAL+W+
Sbjct: 96  MVFLFILTIGFVYEWKKGALDWE 118


>gi|148555889|ref|YP_001263471.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           wittichii RW1]
 gi|148501079|gb|ABQ69333.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           wittichii RW1]
          Length = 125

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDAR 56
           M+ +   Y PIL+F+ +A    SA V + M+   +     P+PEKL+ YECGF  F+D+R
Sbjct: 1   MASVAAGYLPILLFLGVALVLSSAFVFLPMLVGRLTGTHQPNPEKLAEYECGFPAFEDSR 60

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +FD+RF L+++LF+IFDLE AFL+PWAV    I ++G+ SMM+FL  L VGFIY WKKG
Sbjct: 61  AQFDVRFYLIAILFIIFDLEAAFLYPWAVSLGGIGFVGWLSMMIFLVELAVGFIYAWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|319638814|ref|ZP_07993572.1| NADH-quinone oxidoreductase subunit [Neisseria mucosa C102]
 gi|317399718|gb|EFV80381.1| NADH-quinone oxidoreductase subunit [Neisseria mucosa C102]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKHHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGTYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|34496396|ref|NP_900611.1| NADH-ubiquinone oxidoreductase, chain A [Chromobacterium violaceum
           ATCC 12472]
 gi|34102249|gb|AAQ58615.1| NADH-ubiquinone oxidoreductase, chain A [Chromobacterium violaceum
           ATCC 12472]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++   ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLQNYFPILMFVIVGLLVGVGPIVLGKLLAPNRPDAEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FDLEIAFLFPWAV  K +   G G M+ FL +LT+GF+Y WKKGALEW+
Sbjct: 61  YLIAILFILFDLEIAFLFPWAVVLKDLGVYGLGVMVEFLAVLTLGFVYMWKKGALEWE 118


>gi|241663484|ref|YP_002981844.1| NADH dehydrogenase subunit A [Ralstonia pickettii 12D]
 gi|240865511|gb|ACS63172.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ralstonia
           pickettii 12D]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + LM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+S+LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LISILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|160900612|ref|YP_001566194.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Delftia
           acidovorans SPH-1]
 gi|223635451|sp|A9BNB4|NUOA_DELAS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|160366196|gb|ABX37809.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Delftia
           acidovorans SPH-1]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILVGMGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  + +   GF ++++FL +L VGF+YEWKKGAL+WD
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALRDVGGAGFAAVLIFLTVLVVGFVYEWKKGALDWD 119


>gi|264677198|ref|YP_003277104.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni CNB-2]
 gi|299530742|ref|ZP_07044157.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni S44]
 gi|262207710|gb|ACY31808.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni CNB-2]
 gi|298721258|gb|EFI62200.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni S44]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ I  A+ +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILIGMAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  K +  +GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALKDVGGVGFVAVLIFLAILVVGFAYEWKKGALDWE 119


>gi|14917019|sp|P92533|NU3M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|61229010|sp|P68159|NU3M_RAPSA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|61229012|sp|P68160|NU3M_BRANA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIR 62
           ++  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIR
Sbjct: 1   MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  FYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 119


>gi|300691025|ref|YP_003752020.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           PSI07]
 gi|299078085|emb|CBJ50728.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           PSI07]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +VLM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIVGVGLGLVLMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|110189753|gb|ABG49446.1| NADH dehydrogenase subunit 3 [Carthamus tinctorius]
 gi|110294537|gb|ABG66727.1| NADH dehydrogenase subunit 3 [Carthamus tinctorius]
          Length = 118

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|241760630|ref|ZP_04758722.1| NADH-quinone oxidoreductase subunit a [Neisseria flavescens SK114]
 gi|261379580|ref|ZP_05984153.1| NADH dehydrogenase, A subunit [Neisseria subflava NJ9703]
 gi|241318811|gb|EER55337.1| NADH-quinone oxidoreductase subunit a [Neisseria flavescens SK114]
 gi|284798054|gb|EFC53401.1| NADH dehydrogenase, A subunit [Neisseria subflava NJ9703]
          Length = 118

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAAYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|291010620|ref|YP_003495131.1| NADH dehydrogenase subunit 3 [Pycnococcus provasolii]
 gi|258406743|gb|ACV72089.1| NADH dehydrogenase subunit 3 [Pycnococcus provasolii]
          Length = 116

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 84/115 (73%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           SY PI  FM +++ I   ++   F VA   PD EK+S YECGFDPFDDAR +FD+RF LV
Sbjct: 2   SYPPIAGFMVLSAFIASFILGLSFFVAKLKPDGEKVSAYECGFDPFDDARARFDVRFYLV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF+IFDLE+ F FPWA+        GF S++ FLG+LT+GF+YEW+KGAL+W+
Sbjct: 62  AILFIIFDLEVTFCFPWALTLFYSGLFGFYSIVFFLGLLTLGFVYEWQKGALDWE 116


>gi|307293270|ref|ZP_07573116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphingobium
           chlorophenolicum L-1]
 gi|306881336|gb|EFN12552.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphingobium
           chlorophenolicum L-1]
          Length = 124

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (68%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA    SA V + M+   +     PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAEYLPILIFLGIALLLSSAFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV   QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|222110086|ref|YP_002552350.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           ebreus TPSY]
 gi|221729530|gb|ACM32350.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           ebreus TPSY]
          Length = 119

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF +++VFL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE 119


>gi|255067281|ref|ZP_05319136.1| NADH dehydrogenase, A subunit [Neisseria sicca ATCC 29256]
 gi|261364347|ref|ZP_05977230.1| NADH dehydrogenase, A subunit [Neisseria mucosa ATCC 25996]
 gi|298370384|ref|ZP_06981700.1| NADH dehydrogenase (ubiquinone), A subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|255048432|gb|EET43896.1| NADH dehydrogenase, A subunit [Neisseria sicca ATCC 29256]
 gi|288567611|gb|EFC89171.1| NADH dehydrogenase, A subunit [Neisseria mucosa ATCC 25996]
 gi|298281844|gb|EFI23333.1| NADH dehydrogenase (ubiquinone), A subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 118

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKHHYAEKDAAYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|299066333|emb|CBJ37517.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CMR15]
          Length = 119

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|110816057|ref|YP_684389.1| NADH dehydrogenase subunit 3 [Oltmannsiellopsis viridis]
 gi|86450268|gb|ABC96347.1| NADH dehydrogenase subunit 3 [Oltmannsiellopsis viridis]
          Length = 125

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I V++  +S + +++    F+ A + PDPEKLS YECGFDPFD AR +FDI F 
Sbjct: 1   MSDYLNIFVYLCFSSVLSLLISSLAFVTAVRKPDPEKLSAYECGFDPFDSARTQFDIHFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+IFDLEI FLFPW +   QI   GF  MMVFL ILT+GFIYEW K ALE+
Sbjct: 61  LVAILFIIFDLEITFLFPWCITLGQIGMEGFFVMMVFLIILTIGFIYEWLKTALEF 116


>gi|120609950|ref|YP_969628.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Acidovorax
           citrulli AAC00-1]
 gi|223635405|sp|A1TLL6|NUOA_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120588414|gb|ABM31854.1| NADH dehydrogenase subunit A [Acidovorax citrulli AAC00-1]
          Length = 119

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV   ++   GF +++VFL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALHEVGMTGFVAVIVFLAILVVGFAYEWKKGALDWE 119


>gi|112253891|ref|YP_717146.1| NADH dehydrogenase subunit 3 [Brassica napus]
 gi|37591093|dbj|BAC98895.1| NADH dehydrogenase subunit 3 [Brassica napus]
          Length = 118

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|295311644|ref|YP_003587240.1| NADH dehydrogenase subunit 3 [Citrullus lanatus]
 gi|38605649|sp|P60159|NU3M_HELAN RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|38605650|sp|P60160|NU3M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1518350|emb|CAA89856.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
 gi|259156772|gb|ACV96634.1| NADH dehydrogenase subunit 3 [Citrullus lanatus]
          Length = 118

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|253807632|gb|ACT36210.1| NADH dehydrogenase subunit 3 [Helicosporidium sp. ex Simulium
           jonesi]
          Length = 120

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (77%), Gaps = 2/117 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIV--AFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + +  I ++  IA A+ ++L++ PFIV  A    D EK+S YECGFDPFDDAR +FDI+F
Sbjct: 3   SEFLGIFIYFIIALALSLLLLVLPFIVSPAQNVADSEKISAYECGFDPFDDARGRFDIQF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLE+AFLFPWA+   +I + GF +MMVFL ILT+GFIYEW+KGAL+W
Sbjct: 63  YLVAILFIIFDLEVAFLFPWALTLSKIGYFGFWTMMVFLIILTIGFIYEWRKGALDW 119


>gi|304322208|ref|YP_003855851.1| NADH dehydrogenase subunit alpha [Parvularcula bermudensis
           HTCC2503]
 gi|303301110|gb|ADM10709.1| NADH dehydrogenase alpha subunit [Parvularcula bermudensis
           HTCC2503]
          Length = 131

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 8/124 (6%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PI++F  +AS + I+ ++ P ++A   PDPEKLSTYECGF+ F+DAR+KFD++F 
Sbjct: 7   LQDYLPIIIFAGLASVLGILFLVLPVVLAPNEPDPEKLSTYECGFEAFEDARLKFDVQFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYF--------KQITWLGFGSMMVFLGILTVGFIYEWKKG 116
           +V++LF+I DL++AFLFPWAV          +      F SM VFL +  +GF+YEWKKG
Sbjct: 67  IVAILFIIVDLDVAFLFPWAVTLFNPELGMDRGFQIYAFWSMAVFLAVFFIGFLYEWKKG 126

Query: 117 ALEW 120
           ALEW
Sbjct: 127 ALEW 130


>gi|91789116|ref|YP_550068.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Polaromonas
           sp. JS666]
 gi|91698341|gb|ABE45170.1| NADH dehydrogenase subunit A [Polaromonas sp. JS666]
          Length = 119

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +   ++    PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGVGVGVVPQVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLEIAFLFPWAV  K++  +GF S+M+FLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LIAILFILFDLEIAFLFPWAVALKEVGSVGFWSVMIFLGILVVGFVYEWKKGALDWE 119


>gi|295311690|ref|YP_003587376.1| NADH dehydrogenase subunit 3 [Cucurbita pepo]
 gi|9280618|gb|AAF86497.1|AF279450_1 NADH dehydrogenase subunit 3 [Lupinus luteus]
 gi|9280622|gb|AAF86499.1|AF279452_1 NADH dehydrogenase subunit 3 [Lupinus angustifolius]
 gi|259156818|gb|ACV96679.1| NADH dehydrogenase subunit 3 [Cucurbita pepo]
          Length = 118

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|128714|sp|P18630|NU3M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|66159|pir||DNOBU3 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 3 - evening
           primrose mitochondrion
 gi|13179|emb|CAA36454.1| nad3 protein (AA 1 - 118) [Oenothera berteroana]
          Length = 118

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API + + I+  + ++L++ PF+ +  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICISLVISLLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV F +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSFNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|319779198|ref|YP_004130111.1| NADH ubiquinone oxidoreductase chain A [Taylorella equigenitalis
           MCE9]
 gi|317109222|gb|ADU91968.1| NADH ubiquinone oxidoreductase chain A [Taylorella equigenitalis
           MCE9]
          Length = 118

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   Y P+L+F+ IA+     L+ +  ++    PD EK S YECGF  F+DAR++FD+R+
Sbjct: 1   MTAEYFPVLLFIVIATVFGAFLVFTGAMLGPHKPDSEKNSPYECGFVAFEDARMRFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AFLFPWA+    I  +GFG+ ++FL ILTVGF+YEW+KGAL+WD
Sbjct: 61  YLVAILFILFDLELAFLFPWAIANDHIGLVGFGTALLFLFILTVGFVYEWRKGALDWD 118


>gi|332285017|ref|YP_004416928.1| NADH dehydrogenase I chain A [Pusillimonas sp. T7-7]
 gi|330428970|gb|AEC20304.1| NADH dehydrogenase I chain A [Pusillimonas sp. T7-7]
          Length = 119

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+  A+ I   L+ +  ++    P  EKLS YECGF+ F D+R+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIIFATCIGFALLGAGRLLGPHRPYDEKLSQYECGFEAFGDSRMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    I  +GF +++VFL ILTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFIMFDLEIAFLFPWAMANGTIGMVGFWTVLVFLAILTVGFIYEWKKGALDWE 119


>gi|326316099|ref|YP_004233771.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372935|gb|ADX45204.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 119

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV   ++   GF +++VFL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLHEVGVTGFVAVIVFLAILVVGFAYEWKKGALDWE 119


>gi|187929293|ref|YP_001899780.1| NADH dehydrogenase subunit A [Ralstonia pickettii 12J]
 gi|309781852|ref|ZP_07676585.1| threonine synthase [Ralstonia sp. 5_7_47FAA]
 gi|223635480|sp|B2U7R1|NUOA_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|187726183|gb|ACD27348.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ralstonia
           pickettii 12J]
 gi|308919493|gb|EFP65157.1| threonine synthase [Ralstonia sp. 5_7_47FAA]
          Length = 119

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + LM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|294011307|ref|YP_003544767.1| NADH dehydrogenase I chain A [Sphingobium japonicum UT26S]
 gi|292674637|dbj|BAI96155.1| NADH dehydrogenase I chain A [Sphingobium japonicum UT26S]
          Length = 124

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (68%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA    SA V + M+   +     PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAEYLPILIFLGIALLLSSAFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFL+PWAV   QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLYPWAVSLDQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|91208869|ref|YP_539030.1| NADH dehydrogenase subunit 3 [Physcomitrella patens]
 gi|90991409|dbj|BAE93101.1| NADH dehydrogenase subunit 3 [Physcomitrella patens]
          Length = 118

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 88/117 (75%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFC 64
            +API V++ I+  + ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF 
Sbjct: 2   EFAPICVYLVISLLLSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLE+ F FPWAV   +I   GF SM+VFL ILT+GF+YEWKKGAL+W+
Sbjct: 62  LVSILFIIFDLEVTFSFPWAVSLNKIGLFGFWSMIVFLLILTIGFLYEWKKGALDWE 118


>gi|261400469|ref|ZP_05986594.1| NADH dehydrogenase, A subunit [Neisseria lactamica ATCC 23970]
 gi|313669286|ref|YP_004049570.1| NADH dehydrogenase I chain A [Neisseria lactamica ST-640]
 gi|269209728|gb|EEZ76183.1| NADH dehydrogenase, A subunit [Neisseria lactamica ATCC 23970]
 gi|313006748|emb|CBN88218.1| NADH dehydrogenase I chain A [Neisseria lactamica 020-06]
          Length = 118

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|326387462|ref|ZP_08209071.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208118|gb|EGD58926.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 128

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPF----IVAFKSPDPEKLSTYECGFDPFDDAR 56
            +  L  Y PIL+F+ IA A+    +  P     +    +P+ EKLS YECGF  F+D R
Sbjct: 4   QTSYLAGYLPILIFLGIALALSTAFVFLPIGASRLTGTYNPNTEKLSEYECGFPAFEDPR 63

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +FD+RF LV++LF+IFDLE AFLFPWAV  K+  W G+ +MM+FL  L +GFIY WKKG
Sbjct: 64  SQFDVRFYLVAILFIIFDLEAAFLFPWAVSLKETQWAGWATMMLFLFELVIGFIYAWKKG 123

Query: 117 ALEWD 121
           AL+W+
Sbjct: 124 ALDWE 128


>gi|213018649|ref|ZP_03334457.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995600|gb|EEB56240.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 92

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/90 (66%), Positives = 74/90 (82%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           +A  +PD EKLSTYECGF+P   AR  FDI+F LV++LF+IFDLEIAFLFPWAV   +I+
Sbjct: 3   LAVSNPDGEKLSTYECGFNPLSRARKSFDIKFYLVAILFIIFDLEIAFLFPWAVSLSKIS 62

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + GF SMM+FL ILT+GF+YEW KGALEW+
Sbjct: 63  YCGFWSMMIFLAILTIGFLYEWCKGALEWE 92


>gi|145589234|ref|YP_001155831.1| NADH dehydrogenase subunit A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|223635471|sp|A4SXQ3|NUOA_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145047640|gb|ABP34267.1| NADH dehydrogenase subunit A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 119

 Score =  129 bits (325), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 85/117 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V M    I+A   PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W G+ SM++FL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWFGYASMVIFLLEFIVGFVYIWKKGALDWE 119


>gi|85708755|ref|ZP_01039821.1| NADH Dehydrogenase I Chain A [Erythrobacter sp. NAP1]
 gi|85690289|gb|EAQ30292.1| NADH Dehydrogenase I Chain A [Erythrobacter sp. NAP1]
          Length = 124

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (68%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF----IVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA  + ++ +  P     +    +PD EKLS YECGF  F+DAR +FD
Sbjct: 4   LAQYLPILLFIFIAFGLSVLFVFLPMGVSRLTGAHNPDAEKLSEYECGFPAFEDARSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++ F+IFDLE AFLFPWAV   +  W+G+  MM FLGIL +G  YEWKKGAL+W
Sbjct: 64  VRFYLVAISFIIFDLEAAFLFPWAVSLGETGWVGWIGMMTFLGILAIGLAYEWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|325135044|gb|EGC57672.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M13399]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K   PEK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYPEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGVYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|257095319|ref|YP_003168960.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047843|gb|ACV37031.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 124

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+ VF+ +  A     +++  IVA   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLESYFPVFVFILVGVAFGFAPVLTGLIVAPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGA 117
            L++++F++FDLE+AFL PWA  FK+I       W GF  M+VF+ IL VG++Y W KGA
Sbjct: 61  YLIAIIFILFDLEVAFLLPWATIFKEIVHTDSVRWFGFIEMLVFIAILVVGYVYAWAKGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|17546781|ref|NP_520183.1| NADH dehydrogenase subunit A [Ralstonia solanacearum GMI1000]
 gi|81768558|sp|Q8XXQ1|NUOA_RALSO RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|17429081|emb|CAD15769.1| probable transmembrane nadh dehydrogenaseI(chain a) oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 119

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|297538956|ref|YP_003674725.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           sp. 301]
 gi|297258303|gb|ADI30148.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           sp. 301]
          Length = 109

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (75%), Gaps = 6/112 (5%)

Query: 11  ILVFMAIA-SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ILV +A+    +V+ L++SP       PD  K S YECGF+ F+DAR++FD+R+ LV++L
Sbjct: 3   ILVGLAVGVGPLVLGLLVSP-----HKPDSAKNSPYECGFEAFEDARMRFDVRYYLVAIL 57

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F++FDLEIAFLFPWAV  ++I   GF +MM+FLG+L +GFIYEW KGALEWD
Sbjct: 58  FILFDLEIAFLFPWAVVLQEIGLFGFIAMMIFLGVLVIGFIYEWMKGALEWD 109


>gi|325139132|gb|EGC61678.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           ES14902]
 gi|325143082|gb|EGC65429.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           961-5945]
 gi|325143152|gb|EGC65498.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           961-5945]
 gi|325197527|gb|ADY92983.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           G2136]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ I  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILIGLAAGVLFILLGTILGSKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|225077016|ref|ZP_03720215.1| hypothetical protein NEIFLAOT_02068 [Neisseria flavescens
           NRL30031/H210]
 gi|224951573|gb|EEG32782.1| hypothetical protein NEIFLAOT_02068 [Neisseria flavescens
           NRL30031/H210]
          Length = 118

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|292559464|ref|YP_003540832.1| NADH dehydrogenase subunit 3 [Hartmannella vermiformis]
 gi|290775717|gb|ADD62216.1| NADH dehydrogenase subunit 3 [Hartmannella vermiformis]
          Length = 117

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 82/117 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I ++  +   I + L    F++ +  PD EKLS YECGF PF DAR +F+++F
Sbjct: 1   MLVEYANIGIYWVLVLFIALALCALSFLLVYHKPDDEKLSAYECGFSPFGDARGRFEVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLEI FLFPW+V    I + GF SM +FL ILT+GFIYEW KGAL+W
Sbjct: 61  YLVAILFIIFDLEITFLFPWSVVVGHIGFWGFNSMFIFLFILTIGFIYEWMKGALDW 117


>gi|94496482|ref|ZP_01303059.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           sp. SKA58]
 gi|94424228|gb|EAT09252.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           sp. SKA58]
          Length = 124

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (67%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA       V + M+   +     PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAQYLPILIFLGIALLLSGTFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV  +QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLEQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|296040779|gb|ADG85357.1| NADH dehydrogenase subunit 3 [Silene noctiflora]
          Length = 118

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ +   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGLPFLFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|239811633|gb|ACS27120.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
 gi|239811673|gb|ACS27159.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
 gi|288871930|dbj|BAI70616.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
          Length = 122

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y+P+L+F+ I+  +  V+    +++A   PD EKLS YECGFDP++DAR  FD+RF 
Sbjct: 6   IQEYSPVLIFLGISIVLSGVIFGLSYVLAIHKPDTEKLSPYECGFDPYEDARQAFDVRFY 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE  +LFPWA+   QI  +GF +M+ FL  L +GF+Y W+ GALEW+
Sbjct: 66  LVAILFIIFDLEAMYLFPWAISLNQIGSMGFWTMLDFLVELGIGFVYAWRVGALEWE 122


>gi|56478176|ref|YP_159765.1| NADH dehydrogenase I chain A [Aromatoleum aromaticum EbN1]
 gi|56314219|emb|CAI08864.1| NADH dehydrogenase I chain A (EC 1.6.5.3) [Aromatoleum aromaticum
           EbN1]
          Length = 124

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     +V +I   ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFILVGLGFGLVPVILGRVLAPYRPDGEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      +I W  FGS+MVFL +L +G++ EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQEFIAAGEIAWFVFGSVMVFLAVLVIGYVVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|1518359|emb|CAA89888.1| NADH dehydrogenase subunit 3 [Magnolia x soulangeana]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 87/118 (73%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  + PI +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFVPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|254805717|ref|YP_003083938.1| NADH-ubiquinone oxidoreductase chain 3 [Neisseria meningitidis
           alpha14]
 gi|254669259|emb|CBA08157.1| NADH-ubiquinone oxidoreductase chain 3 [Neisseria meningitidis
           alpha14]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|261856550|ref|YP_003263833.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Halothiobacillus neapolitanus c2]
 gi|261837019|gb|ACX96786.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Halothiobacillus neapolitanus c2]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F  +A    + L+    ++A   PD  K + YECGF  F+DAR+KFD+R+
Sbjct: 1   MLEGYLPILIFFGVAVLFSLGLLFGGKLLAPFRPDSSKNAPYECGFAAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   QI   G  +M +FLG+L VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALDQIGHFGLIAMAIFLGVLVVGFVYEWKKGALEWE 118


>gi|121998544|ref|YP_001003331.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Halorhodospira halophila SL1]
 gi|121589949|gb|ABM62529.1| NADH dehydrogenase subunit A [Halorhodospira halophila SL1]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     ++ + + F++  +  DPEK S YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLENYLPVLLFIVVGLVFGVLPLAAGFVLGPRREDPEKQSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV    I   G  +M +F+G+L +G +YEW+KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLDDIGLFGILAMGLFVGLLVIGLLYEWRKGALEWE 118


>gi|162279929|ref|NP_064074.2| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|307101733|ref|YP_003875492.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|323435094|ref|YP_004222312.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|87248035|gb|ABD36072.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|148491433|dbj|BAA99467.2| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|296040777|gb|ADG85356.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|301338028|gb|ADK73320.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|317905648|emb|CBJ14047.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|319439827|emb|CBJ17538.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|320148727|emb|CBJ23365.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ +   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|9280620|gb|AAF86498.1|AF279451_1 NADH dehydrogenase subunit 3 [Lupinus albus]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 87/118 (73%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIILDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|221103087|ref|XP_002161534.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone), subunit 3
           [Hydra magnipapillata]
          Length = 123

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 88/120 (73%), Gaps = 4/120 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD----DARVKFD 60
           L +Y  ILVF+A+A     +L+   ++   ++P  +K + YECGFD FD    +AR +FD
Sbjct: 3   LEAYFSILVFLAVAFGFAALLLGLSWLRGKQNPYKQKEAPYECGFDAFDLPTQNARKQFD 62

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF+IFDLEIAFLFPWA+  + I W GF SM++FL +LTVGF+YEW+KGAL+W
Sbjct: 63  VQFYLVAILFIIFDLEIAFLFPWAISLETIGWQGFWSMLIFLSVLTVGFVYEWRKGALDW 122


>gi|317097444|ref|YP_004123643.1| NADH dehydrogenase subunit 3 [Oscarella tuberculata]
 gi|317134138|ref|YP_004123301.1| NADH dehydrogenase subunit 3 [Oscarella lobularis]
 gi|308912623|gb|ADO51388.1| NADH dehydrogenase subunit 3 [Oscarella tuberculata]
 gi|308912745|gb|ADO51502.1| NADH dehydrogenase subunit 3 [Oscarella lobularis]
          Length = 118

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 85/111 (76%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+A+  +IVI + IS   +I+  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 8   IFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFLIGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|254491806|ref|ZP_05104985.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Methylophaga thiooxidans DMS010]
 gi|224463284|gb|EEF79554.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Methylophaga thiooxydans DMS010]
          Length = 117

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y PIL+F+ I     ++ +++ FI+  + PD EK S YECGF+PF+D+ +KFD+R+ 
Sbjct: 1   MENYLPILLFIIIGIGFGVMPLLAGFILGPRHPDDEKRSAYECGFEPFEDSHMKFDVRYY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWA+    I   G  SM +FL IL VGF+YEWKKGALEW+
Sbjct: 61  LVAILFIIFDLEIAFLFPWAIVLDDIGVFGLLSMFLFLAILVVGFVYEWKKGALEWE 117


>gi|217970156|ref|YP_002355390.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thauera sp.
           MZ1T]
 gi|217507483|gb|ACK54494.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thauera sp.
           MZ1T]
          Length = 124

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+FM +     +  +I   ++A   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFMLVGLGFGLAPVILGRLLAPYRPDSEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      +I W  FGS+MVFL IL +G+I EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQEFIAAGEIAWFVFGSVMVFLAILVIGYIVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|22653466|gb|AAN04077.1| NADH dehydrogenase subunit 3 [Amoebidium parasiticum]
          Length = 122

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 87/116 (75%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PI+  + ++ AI +VL+I+ + +A +SPDPEK+S YECGF P+ DAR KF++RF L
Sbjct: 7   NQYLPIVWLIVVSIAIAVVLVIASYFLAVQSPDPEKVSAYECGFQPYSDAREKFEVRFFL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LF++FDLEI  L P+A+   QI+ +GF ++ +F+ +LT+G ++EW+ GALEW 
Sbjct: 67  VAILFILFDLEITLLVPFALVINQISLMGFWNVWLFVILLTLGLVFEWRSGALEWQ 122


>gi|304389066|ref|ZP_07371110.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis ATCC
           13091]
 gi|254670953|emb|CBA07615.1| probable NADH-ubiquinone oxidoreductase chain 3 [Neisseria
           meningitidis alpha153]
 gi|304336939|gb|EFM03129.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis ATCC
           13091]
 gi|325131613|gb|EGC54320.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M6190]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|15676165|ref|NP_273297.1| NADH dehydrogenase I chain A [Neisseria meningitidis MC58]
 gi|7225463|gb|AAF40695.1| NADH dehydrogenase I, A subunit [Neisseria meningitidis MC58]
 gi|316985169|gb|EFV64121.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis
           H44/76]
 gi|325141077|gb|EGC63580.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           CU385]
 gi|325199444|gb|ADY94899.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           H44/76]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ I  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILIGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|121634113|ref|YP_974358.1| NADH dehydrogenase I chain A [Neisseria meningitidis FAM18]
 gi|120865819|emb|CAM09551.1| NADH dehydrogenase I chain A [Neisseria meningitidis FAM18]
 gi|308388461|gb|ADO30781.1| NADH dehydrogenase I chain A [Neisseria meningitidis alpha710]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAASVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|73540664|ref|YP_295184.1| NADH dehydrogenase subunit A [Ralstonia eutropha JMP134]
 gi|123625485|sp|Q473U3|NUOA_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|72118077|gb|AAZ60340.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ralstonia
           eutropha JMP134]
          Length = 119

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + I LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGIALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|161870823|ref|YP_001599996.1| NADH dehydrogenase I chain A [Neisseria meningitidis 053442]
 gi|194099647|ref|YP_002002778.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae NCCP11945]
 gi|218767069|ref|YP_002341581.1| NADH dehydrogenase I chain A [Neisseria meningitidis Z2491]
 gi|239999844|ref|ZP_04719768.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae 35/02]
 gi|240015003|ref|ZP_04721916.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae DGI18]
 gi|240017451|ref|ZP_04723991.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA6140]
 gi|240081590|ref|ZP_04726133.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA19]
 gi|240113872|ref|ZP_04728362.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae MS11]
 gi|240116603|ref|ZP_04730665.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID18]
 gi|240118827|ref|ZP_04732889.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID1]
 gi|240122072|ref|ZP_04735034.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID24-1]
 gi|240124366|ref|ZP_04737322.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID332]
 gi|240126578|ref|ZP_04739464.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae SK-92-679]
 gi|240129043|ref|ZP_04741704.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae SK-93-1035]
 gi|254494627|ref|ZP_05107798.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 1291]
 gi|260439636|ref|ZP_05793452.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae DGI2]
 gi|261378540|ref|ZP_05983113.1| NADH dehydrogenase, A subunit [Neisseria cinerea ATCC 14685]
 gi|268595654|ref|ZP_06129821.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 35/02]
 gi|268597686|ref|ZP_06131853.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae FA19]
 gi|268599938|ref|ZP_06134105.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae MS11]
 gi|268602272|ref|ZP_06136439.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID18]
 gi|268604538|ref|ZP_06138705.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID1]
 gi|268682993|ref|ZP_06149855.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID332]
 gi|268685158|ref|ZP_06152020.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-92-679]
 gi|268687421|ref|ZP_06154283.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-93-1035]
 gi|291042876|ref|ZP_06568617.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae DGI2]
 gi|293398112|ref|ZP_06642317.1| NADH dehydrogenase I subunit A [Neisseria gonorrhoeae F62]
 gi|296313747|ref|ZP_06863688.1| NADH dehydrogenase, A subunit [Neisseria polysaccharea ATCC 43768]
 gi|121051077|emb|CAM07347.1| NADH dehydrogenase I chain A [Neisseria meningitidis Z2491]
 gi|161596376|gb|ABX74036.1| NADH dehydrogenase I chain A [Neisseria meningitidis 053442]
 gi|193934937|gb|ACF30761.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae NCCP11945]
 gi|226513667|gb|EEH63012.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 1291]
 gi|254674104|emb|CBA09888.1| probable NADH-ubiquinone oxidoreductase chain 3 [Neisseria
           meningitidis alpha275]
 gi|261391773|emb|CAX49228.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A;
           NDH-1, chain A) [Neisseria meningitidis 8013]
 gi|268549043|gb|EEZ44461.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 35/02]
 gi|268551474|gb|EEZ46493.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae FA19]
 gi|268584069|gb|EEZ48745.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae MS11]
 gi|268586403|gb|EEZ51079.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID18]
 gi|268588669|gb|EEZ53345.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID1]
 gi|268623277|gb|EEZ55677.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID332]
 gi|268625442|gb|EEZ57842.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-92-679]
 gi|268627705|gb|EEZ60105.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-93-1035]
 gi|269145090|gb|EEZ71508.1| NADH dehydrogenase, A subunit [Neisseria cinerea ATCC 14685]
 gi|291013310|gb|EFE05276.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae DGI2]
 gi|291611375|gb|EFF40445.1| NADH dehydrogenase I subunit A [Neisseria gonorrhoeae F62]
 gi|296839670|gb|EFH23608.1| NADH dehydrogenase, A subunit [Neisseria polysaccharea ATCC 43768]
 gi|317165132|gb|ADV08673.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319411276|emb|CBY91683.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A;
           NDH-1, chain A) [Neisseria meningitidis WUE 2594]
 gi|325129039|gb|EGC51889.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           N1568]
 gi|325137068|gb|EGC59664.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M0579]
 gi|325202930|gb|ADY98384.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240149]
 gi|325203358|gb|ADY98811.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240355]
 gi|325207272|gb|ADZ02724.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 118

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|170676856|ref|YP_001742099.1| NADH dehydrogenase subunit 3 [Suberites domuncula]
 gi|170649722|emb|CAM84214.1| NADH dehydrogenase subunit 3 [Suberites domuncula]
          Length = 118

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 80/116 (68%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T +  I + +  +  +  ++  + +IV  K PD EK+S YECGFDPF  +RV F ++F L
Sbjct: 3   TEFLGIFILILFSITLSTIISGASYIVGVKHPDSEKVSVYECGFDPFGSSRVPFSVKFFL 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V +LF+IFDLEI+FLFPW V + QI  LGF +M +FL ILTVG IYEW KG LEW+
Sbjct: 63  VGILFLIFDLEISFLFPWCVVYNQIGLLGFWTMYIFLVILTVGLIYEWAKGGLEWE 118


>gi|164421043|ref|YP_001648673.1| NADH dehydrogenase subunit 3 [Plakortis angulospiculatus]
 gi|158939033|gb|ABW83953.1| NADH dehydrogenase subunit 3 [Plakortis angulospiculatus]
          Length = 122

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (73%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + ++  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 12  IFIMLCVSIGLSIIISGASYTLGVKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILF 71

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+F+FPW+V F QIT  G+ +M+VFL ILT+G IYEW KG LEW+
Sbjct: 72  MIFDLEISFIFPWSVVFNQITLFGYWTMIVFLIILTLGLIYEWVKGGLEWE 122


>gi|325130969|gb|EGC53696.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           OX99.30304]
 gi|325145305|gb|EGC67583.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240013]
 gi|325205326|gb|ADZ00779.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M04-240196]
          Length = 118

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGVYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|317134282|ref|YP_004123165.1| NADH dehydrogenase subunit 3 [Pseudocorticium jarrei]
 gi|308912683|gb|ADO51444.1| NADH dehydrogenase subunit 3 [Pseudocorticium jarrei]
          Length = 118

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (75%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           VF+A+  +IVI  +IS   +I+  K PD EK+S YECGFDPF+ +R+ F +RF L+ + F
Sbjct: 8   VFIALCLSIVISTVISGASYILGVKEPDIEKVSVYECGFDPFESSRIPFSVRFFLIGIXF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWSVVYNQISLFGYWTMIIFLLILTLGLIYEWMKGGLEWE 118


>gi|126695327|ref|YP_001090214.1| NADH dehydrogenase subunit 3 [Oscarella carmela]
 gi|116876183|gb|ABK30947.1| NADH dehydrogenase subunit 3 [Oscarella carmela]
          Length = 118

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (75%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           VF+A+  +IVI + IS   +I+  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 8   VFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFLIGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFD EI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDXEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|194289159|ref|YP_002005066.1| NADH dehydrogenase subunit a [Cupriavidus taiwanensis LMG 19424]
 gi|193222994|emb|CAQ68999.1| NADH:ubiquinone oxidoreductase complex I, membrane subunit A
           [Cupriavidus taiwanensis LMG 19424]
          Length = 119

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGVALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  K I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALKDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|317134339|ref|YP_004123125.1| NADH dehydrogenase subunit 3 [Oscarella microlobata]
 gi|308912654|gb|ADO51417.1| NADH dehydrogenase subunit 3 [Oscarella microlobata]
          Length = 118

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 84/111 (75%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+A+  +I I + IS   +I+  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 8   IFIALCLSIAISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFLIGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|197131011|gb|ACH47056.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|205277647|gb|ACI02096.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|209916089|gb|ACI95884.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|241912116|gb|ACS71779.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|314908394|gb|ADT62144.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
          Length = 118

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 70/86 (81%)

Query: 36  SPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGF 95
           S  PEKLS YECGFDP DDAR +FDIRF LVS+LF+IFDLE+ FLFPWA+   +I + GF
Sbjct: 33  SSYPEKLSAYECGFDPLDDARSRFDIRFYLVSILFIIFDLEVTFLFPWAISLNRIGFRGF 92

Query: 96  GSMMVFLGILTVGFIYEWKKGALEWD 121
            SMMVFL ILT+GF YEW KGAL+W+
Sbjct: 93  WSMMVFLLILTIGFTYEWTKGALDWE 118


>gi|317097064|ref|YP_004123206.1| NADH dehydrogenase subunit 3 [Oscarella viridis]
 gi|308912699|gb|ADO51459.1| NADH dehydrogenase subunit 3 [Oscarella viridis]
          Length = 118

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 84/111 (75%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+A+  +IVI + IS   +I+  K PD EK+S YECGFDPF+ +R+ F +RF  + +LF
Sbjct: 8   IFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFXIGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|294624678|ref|ZP_06703348.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601034|gb|EFF45101.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 133

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|21243432|ref|NP_643014.1| NADH dehydrogenase subunit A [Xanthomonas axonopodis pv. citri str.
           306]
 gi|325924675|ref|ZP_08186113.1| NADH dehydrogenase subunit A [Xanthomonas perforans 91-118]
 gi|21108985|gb|AAM37550.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|325544881|gb|EGD16226.1| NADH dehydrogenase subunit A [Xanthomonas perforans 91-118]
          Length = 118

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|78048409|ref|YP_364584.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294666777|ref|ZP_06732011.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|78036839|emb|CAJ24532.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|292603438|gb|EFF46855.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 133

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|224160831|ref|XP_002338259.1| predicted protein [Populus trichocarpa]
 gi|222871535|gb|EEF08666.1| predicted protein [Populus trichocarpa]
          Length = 113

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 1/113 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF LVS+
Sbjct: 1   PICIYLVISLLVSLILLGLPFLFASPSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  LFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 113


>gi|113867070|ref|YP_725559.1| NADH dehydrogenase subunit A [Ralstonia eutropha H16]
 gi|113525846|emb|CAJ92191.1| NADH dehydrogenase chain A [Ralstonia eutropha H16]
          Length = 119

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGVALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|316996004|dbj|BAD83443.2| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 118

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 69/87 (79%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG 94
            S  PEKLS YECGFDPF DAR +FDIRF LVS+LF+IFDLE+ F FPWAV   +I   G
Sbjct: 32  SSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFG 91

Query: 95  FGSMMVFLGILTVGFIYEWKKGALEWD 121
           F SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 92  FWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|167836049|ref|ZP_02462932.1| NADH dehydrogenase subunit A [Burkholderia thailandensis MSMB43]
          Length = 119

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFVAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|94502644|ref|YP_588354.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|40795083|gb|AAR91127.1| NADH dehydrogenase subunit 3 [Zea mays]
          Length = 118

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (72%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL IL +G +YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILMIGSLYEWKRGALDWE 118


>gi|53718847|ref|YP_107833.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei K96243]
 gi|53725825|ref|YP_103434.1| NADH dehydrogenase subunit A [Burkholderia mallei ATCC 23344]
 gi|67642192|ref|ZP_00440952.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Burkholderia mallei GB8 horse 4]
 gi|76809619|ref|YP_332844.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710b]
 gi|83720995|ref|YP_441614.1| NADH dehydrogenase subunit A [Burkholderia thailandensis E264]
 gi|121599834|ref|YP_992469.1| NADH dehydrogenase subunit A [Burkholderia mallei SAVP1]
 gi|124386231|ref|YP_001026728.1| NADH dehydrogenase subunit A [Burkholderia mallei NCTC 10229]
 gi|126438518|ref|YP_001058338.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 668]
 gi|126448156|ref|YP_001079987.1| NADH dehydrogenase subunit A [Burkholderia mallei NCTC 10247]
 gi|126452694|ref|YP_001065577.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1106a]
 gi|167000368|ref|ZP_02266186.1| NADH dehydrogenase I, A subunit [Burkholderia mallei PRL-20]
 gi|167580422|ref|ZP_02373296.1| NADH dehydrogenase subunit A [Burkholderia thailandensis TXDOH]
 gi|167618531|ref|ZP_02387162.1| NADH dehydrogenase subunit A [Burkholderia thailandensis Bt4]
 gi|167718843|ref|ZP_02402079.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei DM98]
 gi|167737852|ref|ZP_02410626.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 14]
 gi|167815036|ref|ZP_02446716.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 91]
 gi|167823452|ref|ZP_02454923.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 9]
 gi|167845004|ref|ZP_02470512.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei B7210]
 gi|167893545|ref|ZP_02480947.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 7894]
 gi|167901991|ref|ZP_02489196.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei NCTC 13177]
 gi|167910227|ref|ZP_02497318.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 112]
 gi|167918260|ref|ZP_02505351.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei BCC215]
 gi|217419865|ref|ZP_03451371.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 576]
 gi|237811582|ref|YP_002896033.1| NADH-quinone oxidoreductase subunit a (NADH dehydrogenase i subunit
           a) (ndh-1 subunit a) [Burkholderia pseudomallei MSHR346]
 gi|242317948|ref|ZP_04816964.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106b]
 gi|254175758|ref|ZP_04882418.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 10399]
 gi|254190550|ref|ZP_04897057.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195198|ref|ZP_04901627.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           S13]
 gi|254202110|ref|ZP_04908473.1| NADH dehydrogenase I, A subunit [Burkholderia mallei FMH]
 gi|254207440|ref|ZP_04913790.1| NADH dehydrogenase I, A subunit [Burkholderia mallei JHU]
 gi|254258663|ref|ZP_04949717.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710a]
 gi|254298533|ref|ZP_04965985.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           406e]
 gi|254359862|ref|ZP_04976132.1| NADH dehydrogenase I, A subunit [Burkholderia mallei 2002721280]
 gi|257139690|ref|ZP_05587952.1| NADH dehydrogenase subunit A [Burkholderia thailandensis E264]
 gi|81685034|sp|Q62IN5|NUOA_BURMA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81690416|sp|Q63VN3|NUOA_BURPS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123537639|sp|Q2SZN5|NUOA_BURTA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123599741|sp|Q3JUA9|NUOA_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635426|sp|A3MIA1|NUOA_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635427|sp|A2S459|NUOA_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635428|sp|A1V2L6|NUOA_BURMS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635429|sp|A3NTA6|NUOA_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635430|sp|A3N7L7|NUOA_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|52209261|emb|CAH35206.1| NADH dehydrogenase I chain A [Burkholderia pseudomallei K96243]
 gi|52429248|gb|AAU49841.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 23344]
 gi|76579072|gb|ABA48547.1| NADH dehydrogenase I chain A [Burkholderia pseudomallei 1710b]
 gi|83654820|gb|ABC38883.1| NADH dehydrogenase I, A subunit [Burkholderia thailandensis E264]
 gi|121228644|gb|ABM51162.1| NADH dehydrogenase I, A subunit [Burkholderia mallei SAVP1]
 gi|124294251|gb|ABN03520.1| NADH dehydrogenase I, A subunit [Burkholderia mallei NCTC 10229]
 gi|126218011|gb|ABN81517.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit
           [Burkholderia pseudomallei 668]
 gi|126226336|gb|ABN89876.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106a]
 gi|126241026|gb|ABO04119.1| NADH dehydrogenase I, A subunit [Burkholderia mallei NCTC 10247]
 gi|147746357|gb|EDK53434.1| NADH dehydrogenase I, A subunit [Burkholderia mallei FMH]
 gi|147751334|gb|EDK58401.1| NADH dehydrogenase I, A subunit [Burkholderia mallei JHU]
 gi|148029102|gb|EDK87007.1| NADH dehydrogenase I, A subunit [Burkholderia mallei 2002721280]
 gi|157808206|gb|EDO85376.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           406e]
 gi|157938225|gb|EDO93895.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696802|gb|EDP86772.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 10399]
 gi|169651946|gb|EDS84639.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           S13]
 gi|217397169|gb|EEC37185.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 576]
 gi|237502777|gb|ACQ95095.1| NADH-quinone oxidoreductase subunit a (NADH dehydrogenase i subunit
           a) (ndh-1 subunit a) [Burkholderia pseudomallei MSHR346]
 gi|238523288|gb|EEP86727.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Burkholderia mallei GB8 horse 4]
 gi|242141187|gb|EES27589.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106b]
 gi|243063702|gb|EES45888.1| NADH dehydrogenase I, A subunit [Burkholderia mallei PRL-20]
 gi|254217352|gb|EET06736.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710a]
          Length = 119

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|11466646|ref|NP_066329.1| NADH dehydrogenase subunit 3 [Malawimonas jakobiformis]
 gi|10178684|gb|AAG13696.1|AF295546_22 NADH dehydrogenase subunit 3 [Malawimonas jakobiformis]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/92 (60%), Positives = 74/92 (80%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           +I+A + PD EK+S YECGF PF+DAR KFD++F LV++LF+IFDLE+ +LFPW     +
Sbjct: 30  YILATQQPDVEKISAYECGFAPFEDARNKFDVKFYLVAILFIIFDLEVTYLFPWITVLNK 89

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           I++LGF SM VFL ILT+GF+YEW KGAL+W 
Sbjct: 90  ISYLGFWSMFVFLFILTIGFVYEWMKGALDWQ 121


>gi|332185806|ref|ZP_08387553.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Sphingomonas sp. S17]
 gi|332014164|gb|EGI56222.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Sphingomonas sp. S17]
          Length = 124

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 84/121 (69%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDARVKFD 60
           L+ Y PIL+F+ +A A+    +  P +VA       P+ +KLS YECGF  F+D R +FD
Sbjct: 4   LSQYLPILLFLGVALALSTAFVFLPMLVARLTGAHQPNEQKLSEYECGFPAFEDPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFL+PWAV    I W+ + SMM+F+G L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLYPWAVSVFSIGWVAWISMMIFIGELALGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|114777361|ref|ZP_01452358.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Mariprofundus ferrooxydans PV-1]
 gi|114552143|gb|EAU54645.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Mariprofundus ferrooxydans PV-1]
          Length = 123

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L   YAPI +F+ IA  +    +   +++A + P+ EK S YECGF+ F+DAR++FD+RF
Sbjct: 6   LANEYAPIFIFIIIAFVMGAAPLALTYLLAEQRPNAEKRSAYECGFEAFEDARMQFDVRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LFV+FDLE AFLFPWAV   +I   GF  MM+FL IL VG+IY WKKGAL+W+
Sbjct: 66  YLVAILFVVFDLESAFLFPWAVVLNKIGLFGFVEMMMFLVILLVGYIYAWKKGALQWE 123


>gi|84508623|ref|YP_448670.1| NADH dehydrogenase subunit 3 [Desmarestia viridis]
 gi|45925655|gb|AAS79056.1| NADH dehydrogenase subunit 3 [Desmarestia viridis]
          Length = 120

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+  + A+ +++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LKEYYPVLIFLGFSLALALLIFGASYTLAFSEADNEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FD+E  FLFPWA    Q+  +G+ SMM FL  L +GFIY W+ G+L+W+
Sbjct: 64  LVAILFLLFDIETVFLFPWASSLSQLPAIGYWSMMDFLLELVIGFIYAWQIGSLDWE 120


>gi|319787443|ref|YP_004146918.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465955|gb|ADV27687.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 118

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I + L+I   ++  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAQYLPTLLFLIVATGIGVALIIVGRVLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW + F+ +      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTLVFQDLGPRALVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|262186708|ref|YP_003275967.1| NADH dehydrogenase subunit 3 [Pleurozia purpurea]
 gi|237780705|gb|ACR19351.1| NADH dehydrogenase subunit 3 [Pleurozia purpurea]
          Length = 118

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS +ECGFDPFDDAR +FDIRF LVS+LF+IFD E+  LFPWAV   +I   GF SM
Sbjct: 36  PEKLSAHECGFDPFDDARSRFDIRFYLVSILFIIFDSEVTSLFPWAVSLNKIGSFGFWSM 95

Query: 99  MVFLGILTVGFIYEWKKGALEWD 121
           MVFL ILT+GF+YEWKKGAL+W+
Sbjct: 96  MVFLLILTIGFVYEWKKGALDWE 118


>gi|295676037|ref|YP_003604561.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1002]
 gi|295435880|gb|ADG15050.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1002]
          Length = 133

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLLFLIVGTGLGVALVSIGKLLGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDIGWAGFTAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|15150750|ref|NP_150416.1| NADH dehydrogenase subunit 3 [Pylaiella littoralis]
 gi|15147756|emb|CAC50857.1| NADH dehydrogenase subunit 3 [Pylaiella littoralis]
          Length = 120

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y P L+F+  +  +  ++  + +I+A  S D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   LLKEYYPALIFLVFSFVLAAIIFGASYILAVSSADSEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWAV   Q+  +G+ SMM FL  L VGFIY W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETIFLFPWAVSLSQLPSIGYWSMMDFLFELVVGFIYAWQIGSLDWE 120


>gi|302035623|ref|YP_003795945.1| NADH-quinone oxidoreductase membrane subunit A [Candidatus
           Nitrospira defluvii]
 gi|300603687|emb|CBK40018.1| NADH-quinone oxidoreductase, membrane subunit A [Candidatus
           Nitrospira defluvii]
          Length = 127

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 85/119 (71%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           + L+ Y PILVF+ +A A     ++  + V  K P+PEKLSTYECG +PF DAR+ F +R
Sbjct: 9   EYLSRYFPILVFVFVALAFGAGTLLISYFVQPKYPEPEKLSTYECGSEPFSDARMPFPVR 68

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + ++LFVIFD+E+ FL+PWA+ F +I  +G   M++F+G+  V ++Y W+KGALEWD
Sbjct: 69  YYIFAMLFVIFDVEVIFLYPWAIVFNKIGLIGLIEMLIFIGLFLVAYVYAWRKGALEWD 127


>gi|21231960|ref|NP_637877.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767913|ref|YP_242675.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21113691|gb|AAM41801.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66573245|gb|AAY48655.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris str. 8004]
          Length = 118

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLVVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|188991029|ref|YP_001903039.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167732789|emb|CAP50983.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris]
          Length = 133

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLVVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|11466212|ref|NP_066535.1| NADH dehydrogenase subunit 3 [Naegleria gruberi]
 gi|10444247|gb|AAG17813.1|AF288092_38 NADH dehydrogenase subunit 3 [Naegleria gruberi]
          Length = 120

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           LT Y     +  +  AI  ++++  +I+ FK+P  EK   YECGFDPF DAR  F ++F 
Sbjct: 4   LTEYYEYYFYGVLILAISFIILLLCYIITFKNPYTEKNYGYECGFDPFSDARNPFHVKFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+S++F+IFD+E+AF FPWA+  K++ + G+ +M +F+ IL VGF+YEWKKGALEW+
Sbjct: 64  LISIIFIIFDVEVAFFFPWAISIKELMFFGYYTMYLFIFILLVGFVYEWKKGALEWE 120


>gi|59802072|ref|YP_208784.1| hypothetical protein NGO1751 [Neisseria gonorrhoeae FA 1090]
 gi|59718967|gb|AAW90372.1| putative NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA
           1090]
          Length = 118

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + Y+CGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYKCGFESFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVDILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|289065171|ref|YP_003434223.1| NADH dehydrogenase subunit 3 [Chattonella marina]
 gi|288871883|dbj|BAI70570.1| NADH dehydrogenase subunit 3 [Chattonella marina]
          Length = 122

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y+PIL+F+ ++  +  ++    + +A   PD EKLS YECGFDP++DAR  FD+RF 
Sbjct: 6   LQNYSPILIFLGLSIILSGIIFGLSYFLAIHKPDTEKLSPYECGFDPYEDARQAFDVRFY 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE  +LFPWAV   Q   +GF SM+ FL  L +GF+Y W+ G LEW+
Sbjct: 66  LVAILFILFDLEAMYLFPWAVSLNQTGVMGFWSMVDFLVELGIGFVYAWRIGGLEWE 122


>gi|170696399|ref|ZP_02887528.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           graminis C4D1M]
 gi|170138727|gb|EDT06926.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           graminis C4D1M]
          Length = 133

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLMFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|51338760|sp|P16265|NU3M_MAIZE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 118

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (72%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL IL +G +YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILFIGSLYEWKRGALDWE 118


>gi|325915539|ref|ZP_08177850.1| NADH dehydrogenase subunit A [Xanthomonas vesicatoria ATCC 35937]
 gi|325538255|gb|EGD09940.1| NADH dehydrogenase subunit A [Xanthomonas vesicatoria ATCC 35937]
          Length = 118

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|186476764|ref|YP_001858234.1| NADH dehydrogenase subunit A [Burkholderia phymatum STM815]
 gi|223635431|sp|B2JDM8|NUOA_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|184193223|gb|ACC71188.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           phymatum STM815]
          Length = 123

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 7   LAAYFPVLMFLLVGTGLGVALVSIGKILGPNRPDTEKNAPYECGFEAFEDARMKFDVRYY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF SMM+FL    +GF Y WKKG L+W+
Sbjct: 67  LVAILFIIFDLETAFLFPWGVALRDIGWPGFISMMIFLLEFLLGFAYIWKKGGLDWE 123


>gi|209518515|ref|ZP_03267336.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. H160]
 gi|209501060|gb|EEA01095.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. H160]
          Length = 133

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + + W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDVGWAGFIAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|307730340|ref|YP_003907564.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1003]
 gi|307584875|gb|ADN58273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1003]
          Length = 119

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|284794667|ref|YP_003412025.1| NADH dehydrogenase subunit 3 [Lubomirskia baicalensis]
 gi|284098136|gb|ADB78067.1| NADH dehydrogenase subunit 3 [Lubomirskia baicalensis]
          Length = 118

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 80/111 (72%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ +  +I++  +IS   +IV  K PD EK+S YECGFDPF+ +R+ F +RF LV +LF
Sbjct: 8   IFILLLFSIILSTVISGASYIVGVKQPDSEKVSVYECGFDPFESSRIPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI   GF +M  FL ILTVG IYEW KG LEW+
Sbjct: 68  MIFDLEISFLFPWCVVYNQIGLFGFWTMYFFLVILTVGLIYEWIKGGLEWE 118


>gi|187923340|ref|YP_001894982.1| NADH dehydrogenase subunit A [Burkholderia phytofirmans PsJN]
 gi|223635432|sp|B2T2E7|NUOA_BURPP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|187714534|gb|ACD15758.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           phytofirmans PsJN]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFLAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|167562177|ref|ZP_02355093.1| NADH dehydrogenase subunit A [Burkholderia oklahomensis EO147]
 gi|167569422|ref|ZP_02362296.1| NADH dehydrogenase subunit A [Burkholderia oklahomensis C6786]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|57639683|gb|AAW55688.1| NADH dehydrogenase subunit 3 [Amborella trichopoda]
          Length = 112

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (77%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           F  +  S  PEKLS YECGFDPFDDAR +FDIRF LVS+LF+IFDLE+ FLFPWAV   +
Sbjct: 21  FASSSNSAHPEKLSAYECGFDPFDDARSRFDIRFSLVSILFIIFDLEVTFLFPWAVSLSK 80

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           I   G  S+++FL ILT+G +YEWKKGAL+
Sbjct: 81  IGLFGSWSIILFLSILTIGSLYEWKKGALD 110


>gi|323525436|ref|YP_004227589.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1001]
 gi|323382438|gb|ADX54529.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1001]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLLVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|91782612|ref|YP_557818.1| NADH dehydrogenase subunit A [Burkholderia xenovorans LB400]
 gi|296160629|ref|ZP_06843444.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. Ch1-1]
 gi|123168725|sp|Q142H3|NUOA_BURXL RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|91686566|gb|ABE29766.1| NADH dehydrogenase subunit A [Burkholderia xenovorans LB400]
 gi|295889155|gb|EFG68958.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. Ch1-1]
          Length = 119

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|319738250|emb|CBJ18026.1| NADH dehydrogenase subunit 3 [Ectocarpus siliculosus]
          Length = 120

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+  + A+  V+  + FI+A    D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LKEYYPVLIFLGFSLALAGVIFGASFILAVSDADTEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FD+E  FLFPW+V   Q+  +G+ SM+ FL  L VGFIY W+ G+L+W+
Sbjct: 64  LVAILFLLFDIETIFLFPWSVSLSQLPSIGYWSMLDFLFELVVGFIYAWQIGSLDWE 120


>gi|289665173|ref|ZP_06486754.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667380|ref|ZP_06488455.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 118

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|269469168|gb|EEZ80710.1| NADH dehydrogenase I chain A [uncultured SUP05 cluster bacterium]
          Length = 118

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI+VF+ +  A  +  M+  +++    PD EK S +ECGF  FDD+R+ F++R+
Sbjct: 1   MLENYLPIMVFIFLGVAFGVGPMLIGYLLGPSKPDEEKNSQFECGFPAFDDSRMYFNVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV    + W GF +M +FL +L VGFI+EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSDLGWFGFIAMSIFLFLLVVGFIFEWKNGALEWE 118


>gi|254181187|ref|ZP_04887784.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           1655]
 gi|184211725|gb|EDU08768.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           1655]
          Length = 119

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +M++FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMVIFLLEFLLGFAYIWKKGGLDWE 119


>gi|94309872|ref|YP_583082.1| NADH dehydrogenase subunit A [Cupriavidus metallidurans CH34]
 gi|93353724|gb|ABF07813.1| NADH dehydrogenase chain A [Cupriavidus metallidurans CH34]
          Length = 119

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PD  KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIVFGVVLGVALMAIGRILGPYKPDAAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  K I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALKDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|10802939|gb|AAG23687.1|AF288091_32 NADH dehydrogenase subunit 3 [Thraustochytrium aureum]
          Length = 120

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 85/120 (70%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ L + YAPI++++ I+  +  ++  + + +A ++P  EKLS YECGFDPFDDAR +FD
Sbjct: 1   MTFLFSEYAPIVIYIGISMILSFIIFFASYSIAIQNPYSEKLSAYECGFDPFDDARNEFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF++FDLE +FLFPWA+    +   GF S++ F   L +GF Y WK GALEW
Sbjct: 61  VKFYLVALLFLVFDLETSFLFPWALNISYLNSFGFWSIIDFFFELVIGFFYVWKIGALEW 120


>gi|20385853|gb|AAM21470.1|AF395895_1 NADH dehydrogenase subunit 3 [Pisum sativum subsp. abyssinicum]
          Length = 118

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (73%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGA 114


>gi|260223142|emb|CBA33410.1| NADH-quinone oxidoreductase subunit A [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   I +V  +  +I+    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGIGVVPQVLGYILGPNKPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE AFLFPWAV  K++   GF   + F+ ILT+GF+Y WKKGAL+W+
Sbjct: 63  LVAILFILFDLETAFLFPWAVSLKELGLFGFLIGVEFVVILTIGFVYMWKKGALDWE 119


>gi|166712614|ref|ZP_02243821.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 118

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|317097236|ref|YP_004123365.1| NADH dehydrogenase subunit 3 [Plakortis simplex]
 gi|308912758|gb|ADO51514.1| NADH dehydrogenase subunit 3 [Plakortis simplex]
          Length = 122

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 80/111 (72%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + ++    I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 12  IFIMLCVSIGFSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILF 71

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+F+FPW+V   QIT  G+ +M+VFL ILT+G +YEW KG LEW+
Sbjct: 72  MIFDLEISFIFPWSVVLNQITLFGYWTMIVFLIILTLGLVYEWVKGGLEWE 122


>gi|134296433|ref|YP_001120168.1| NADH dehydrogenase subunit A [Burkholderia vietnamiensis G4]
 gi|223635433|sp|A4JGD0|NUOA_BURVG RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|134139590|gb|ABO55333.1| NADH dehydrogenase subunit A [Burkholderia vietnamiensis G4]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFSAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|296283829|ref|ZP_06861827.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Citromicrobium bathyomarinum JL354]
          Length = 124

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF----IVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ +A AI  V +  P     +    +P  EKLS YECGF  F++ R +FD
Sbjct: 4   LGQYLPILLFLGVALAISCVFVFLPMGVSRLTGTHNPTAEKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV      W G+ +MM+F+G L +G IY WK GALEW
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDFTGWSGWTTMMIFIGELAIGLIYAWKVGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|313768522|ref|YP_004062197.1| NADH dehydrogenase subunit 3 [Gracilariopsis andersonii]
 gi|312844649|gb|ADR03213.1| NADH dehydrogenase subunit 3 [Gracilariopsis andersonii]
          Length = 121

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG 94
           +  D EK+S YECGF+PFDDAR  FD+RF LV++LF+IFDLEI+FLFPW++    I   G
Sbjct: 35  QKADQEKVSAYECGFNPFDDARATFDVRFYLVAILFLIFDLEISFLFPWSLVLGNIPLFG 94

Query: 95  FGSMMVFLGILTVGFIYEWKKGALEWD 121
           F SM++FL ILT+GFIYEW KGALEW+
Sbjct: 95  FWSMIIFLLILTIGFIYEWYKGALEWE 121


>gi|164421002|ref|YP_001648497.1| NADH dehydrogenase subunit 3 [Topsentia ophiraphidites]
 gi|158938932|gb|ABW83859.1| NADH dehydrogenase subunit 3 [Topsentia ophiraphidites]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (72%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ +  +I++  +IS   FI+  K PD EK+S YECGFDPF  +R+ F ++F LV +LF
Sbjct: 8   IFILLLFSIILSTVISGASFIIGVKQPDSEKVSVYECGFDPFGSSRIPFSVKFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V ++QI   GF +M +FL ILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVAYQQIGLFGFWTMYLFLIILTIGLIYEWVKGGLEWE 118


>gi|167585971|ref|ZP_02378359.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ubonensis Bu]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNRPDVEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|78067046|ref|YP_369815.1| NADH dehydrogenase subunit A [Burkholderia sp. 383]
 gi|107023188|ref|YP_621515.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia AU 1054]
 gi|115352338|ref|YP_774177.1| NADH dehydrogenase subunit A [Burkholderia ambifaria AMMD]
 gi|116690270|ref|YP_835893.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia HI2424]
 gi|161524204|ref|YP_001579216.1| NADH dehydrogenase subunit A [Burkholderia multivorans ATCC 17616]
 gi|170698109|ref|ZP_02889189.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria IOP40-10]
 gi|170733609|ref|YP_001765556.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia MC0-3]
 gi|171316303|ref|ZP_02905524.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MEX-5]
 gi|172061209|ref|YP_001808861.1| NADH dehydrogenase subunit A [Burkholderia ambifaria MC40-6]
 gi|189351039|ref|YP_001946667.1| NADH dehydrogenase subunit A [Burkholderia multivorans ATCC 17616]
 gi|206560703|ref|YP_002231468.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia J2315]
 gi|221199656|ref|ZP_03572700.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2M]
 gi|221205444|ref|ZP_03578459.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2]
 gi|221211735|ref|ZP_03584714.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD1]
 gi|254247657|ref|ZP_04940978.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Burkholderia
           cenocepacia PC184]
 gi|122322641|sp|Q0BDD0|NUOA_BURCM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123244855|sp|Q1BV13|NUOA_BURCA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123568004|sp|Q39EE5|NUOA_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635421|sp|B1YTQ7|NUOA_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635422|sp|B1JVP1|NUOA_BURCC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635423|sp|B4E5M2|NUOA_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635425|sp|A9AJP4|NUOA_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635445|sp|A0K923|NUOA_BURCH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|77967791|gb|ABB09171.1| NADH dehydrogenase subunit A [Burkholderia sp. 383]
 gi|105893377|gb|ABF76542.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia AU 1054]
 gi|115282326|gb|ABI87843.1| NADH dehydrogenase subunit A [Burkholderia ambifaria AMMD]
 gi|116648359|gb|ABK09000.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia HI2424]
 gi|124872433|gb|EAY64149.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Burkholderia
           cenocepacia PC184]
 gi|160341633|gb|ABX14719.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           multivorans ATCC 17616]
 gi|169816851|gb|ACA91434.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           cenocepacia MC0-3]
 gi|170136967|gb|EDT05215.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria IOP40-10]
 gi|171098529|gb|EDT43330.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MEX-5]
 gi|171993726|gb|ACB64645.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MC40-6]
 gi|189335061|dbj|BAG44131.1| NADH dehydrogenase I chain A [Burkholderia multivorans ATCC 17616]
 gi|198036745|emb|CAR52645.1| NADH dehydrogenase I chain A [Burkholderia cenocepacia J2315]
 gi|221169096|gb|EEE01564.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD1]
 gi|221174282|gb|EEE06714.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2]
 gi|221180941|gb|EEE13344.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2M]
 gi|325520397|gb|EGC99515.1| NADH:ubiquinone oxidoreductase subunit A [Burkholderia sp. TJI49]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|317097126|ref|YP_004123258.1| NADH dehydrogenase subunit 3 [Plakina jani]
 gi|308912727|gb|ADO51485.1| NADH dehydrogenase subunit 3 [Plakina jani]
          Length = 122

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 81/111 (72%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I+  +  ++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 12  IFIMLCISIGLSFIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILF 71

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+F+FPW+V F QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 72  MIFDLEISFIFPWSVVFNQISLFGYWTMIIFLIILTLGLVYEWIKGGLEWE 122


>gi|57639715|gb|AAW55704.1| NADH dehydrogenase subunit 3 [Dicranum scoparium]
          Length = 110

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKS--PDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           PI V++ I     ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF LVS
Sbjct: 1   PICVYLVINLLFSLILIGVSFLFASSSNLAYPEKLSAYECGFDPFDDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+IFD E+ FLFPWAV   +I   GF SM+VFL I T+GF YEWKKGA
Sbjct: 61  ILFIIFDSEVTFLFPWAVSPNKIGLFGFWSMIVFLSISTIGFSYEWKKGA 110


>gi|268053561|ref|YP_003288920.1| NADH dehydrogenase subunit 3 [Saccharina japonica]
 gi|268053600|ref|YP_003288958.1| NADH dehydrogenase subunit 3 [Saccharina religiosa]
 gi|268053639|ref|YP_003288996.1| NADH dehydrogenase subunit 3 [Saccharina ochotensis]
 gi|268053678|ref|YP_003289073.1| NADH dehydrogenase subunit 3 [Saccharina diabolica]
 gi|268053717|ref|YP_003289124.1| NADH dehydrogenase subunit 3 [Saccharina longipedalis]
 gi|268164066|ref|YP_003288831.1| NADH dehydrogenase subunit 3 [Saccharina angustata]
 gi|268164105|ref|YP_003288882.1| NADH dehydrogenase subunit 3 [Saccharina coriacea]
 gi|262318181|dbj|BAI48506.1| NADH dehydrogenase subunit 3 [Saccharina japonica]
 gi|262318220|dbj|BAI48544.1| NADH dehydrogenase subunit 3 [Saccharina religiosa]
 gi|262318259|dbj|BAI48582.1| NADH dehydrogenase subunit 3 [Saccharina ochotensis]
 gi|262318298|dbj|BAI48620.1| NADH dehydrogenase subunit 3 [Saccharina diabolica]
 gi|262318337|dbj|BAI48658.1| NADH dehydrogenase subunit 3 [Saccharina longipedalis]
 gi|262318376|dbj|BAI48696.1| NADH dehydrogenase subunit 3 [Saccharina angustata]
 gi|262318415|dbj|BAI48734.1| NADH dehydrogenase subunit 3 [Saccharina coriacea]
          Length = 120

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PIL+F+  +  +  ++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LKEYYPILIFLGFSLVLASLIFGASYTLAFSESDSEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FD+E  FLFPWAV   ++  +G+ SMM FL  L +GF+Y W+ G+L+W+
Sbjct: 64  LVAILFLLFDIETVFLFPWAVSLSELPSIGYWSMMDFLFELVIGFVYAWQIGSLDWE 120


>gi|330817792|ref|YP_004361497.1| Putative transmembrane NADH dehydrogenase I, NuoA [Burkholderia
           gladioli BSR3]
 gi|327370185|gb|AEA61541.1| Putative transmembrane NADH dehydrogenase I, NuoA [Burkholderia
           gladioli BSR3]
          Length = 119

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + L+    ++    P+ EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLIVGVGLGVALVGIGKVLGPNKPNSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V F+ I W GF +MM+FL     GF Y W+KG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVAFRDIGWPGFMAMMIFLLEFLFGFAYIWRKGGLDWE 119


>gi|21450020|ref|NP_659282.1| NADH dehydrogenase subunit 3 [Laminaria digitata]
 gi|21425345|emb|CAC87978.1| NADH dehydrogenase subunit 3 [Laminaria digitata]
          Length = 120

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+  +  +  ++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LKEYYPVLIFLGFSLVLASLIFGASYTLAFSEADSEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FD+E  FLFPWAV   ++  +G+ SMM FL  L VGF+Y W+ G+L+W+
Sbjct: 64  LVAILFLLFDIETVFLFPWAVSLSELPSIGYWSMMDFLFELVVGFVYAWQIGSLDWE 120


>gi|164420979|ref|YP_001648601.1| NADH dehydrogenase subunit 3 [Xestospongia muta]
 gi|158938984|gb|ABW83908.1| NADH dehydrogenase subunit 3 [Xestospongia muta]
          Length = 118

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 71/94 (75%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + +IV  K PD EK+S YECGFDPF+ +R+ F +RF LV +LF+IFDLEI+FLFPW V +
Sbjct: 25  ASYIVGVKQPDGEKVSVYECGFDPFESSRIPFSVRFFLVGILFMIFDLEISFLFPWCVVY 84

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   GF +M+ FL ILT+G IYEW KG LEW+
Sbjct: 85  NQIGLFGFWTMIFFLIILTIGLIYEWVKGGLEWE 118


>gi|164420949|ref|YP_001648462.1| NADH dehydrogenase subunit 3 [Amphimedon compressa]
 gi|158668073|gb|ABW76537.1| NADH dehydrogenase subunit 3 [Amphimedon compressa]
          Length = 118

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (72%), Gaps = 2/113 (1%)

Query: 11  ILVFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           I +F+ +  +I++  +IS   +IV  K PD EK S YECGFDPF+ +R+ F +RF LV +
Sbjct: 6   IGIFLLLFFSIILSTVISGASYIVGVKQPDGEKTSVYECGFDPFESSRIPFSVRFFLVGI 65

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LF+IFDLEI+FLFPW+V + Q    GF +M++FL ILT+G IYEW +G LEW+
Sbjct: 66  LFMIFDLEISFLFPWSVVYNQTGLFGFWTMVLFLIILTIGLIYEWVQGGLEWE 118


>gi|8954369|ref|NP_059358.1| NADH dehydrogenase subunit 3 [Cyanidioschyzon merolae]
 gi|3927873|dbj|BAA34661.1| NADH-ubiquinone oxidoreductase chain 3 [Cyanidioschyzon merolae
           strain 10D]
          Length = 118

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   Y+ +L F+ +   +  ++ I  +I + +  D EK+S YECGF+PFDDAR  FDIRF
Sbjct: 1   MFKEYSILLTFICLTFLLATIVFILSYIFSVQKADAEKISAYECGFNPFDDARTTFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE++FL+PW+V    +   GF  +  FL ILT+GF+YEW KGAL+W+
Sbjct: 61  YLVAILFLIFDLEVSFLYPWSVCIGYLNNQGFYVICTFLFILTIGFLYEWFKGALDWE 118


>gi|325921411|ref|ZP_08183268.1| NADH dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
 gi|325548169|gb|EGD19166.1| NADH dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
          Length = 118

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGITLMLIGRFLGPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|317097079|ref|YP_004123218.1| NADH dehydrogenase subunit 3 [Plakortis halichondrioides]
 gi|308912712|gb|ADO51471.1| NADH dehydrogenase subunit 3 [Plakortis halichondrioides]
          Length = 122

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 80/111 (72%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + ++  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF
Sbjct: 12  IFIMLCVSIGLSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFXVRFFLIGILF 71

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+F+FPW+V F QIT  G+ +M+ FL  LT+G +YEW KG LEW+
Sbjct: 72  MIFDLEISFIFPWSVVFNQITLFGYWTMIXFLIXLTLGLVYEWVKGGLEWE 122


>gi|300122801|emb|CBK23816.2| unnamed protein product [Blastocystis hominis]
          Length = 119

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 82/112 (73%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            +LV+   A  +  +  +  +I   ++ D  KLS YECGF PF+DAR  F+I F LV++L
Sbjct: 8   ALLVYFICAIVVSYIAFLISYIFGIRANDSNKLSAYECGFTPFEDARNTFEIHFYLVAIL 67

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F++FDLEI+FL+PWAV    I+++G+ +M+VFL ILT+GF+YE+KKGALEW+
Sbjct: 68  FLMFDLEISFLYPWAVSLSAISFVGYFAMVVFLIILTLGFVYEYKKGALEWE 119


>gi|164420803|ref|YP_001648471.1| NADH dehydrogenase subunit 3 [Ephydatia muelleri]
 gi|158938919|gb|ABW83847.1| NADH dehydrogenase subunit 3 [Ephydatia muelleri]
          Length = 118

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ +  +I++  +IS   +IV  K PD EK+S YECGFDPF+ +R+ F +RF LV +LF
Sbjct: 8   IFILLLFSIILSTVISGASYIVGVKQPDSEKVSVYECGFDPFESSRIPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI   GF +M  FL ILTVG IYEW KG L W+
Sbjct: 68  MIFDLEISFLFPWCVVYNQIGLFGFWTMYFFLVILTVGLIYEWIKGGLGWE 118


>gi|238028143|ref|YP_002912374.1| NADH dehydrogenase subunit A [Burkholderia glumae BGR1]
 gi|237877337|gb|ACR29670.1| Putative transmembrane NADH dehydrogenase I(chain A), NuoA
           [Burkholderia glumae BGR1]
          Length = 119

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + L+    I+    P+ EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLIVGVGLGVALVGIGKILGPSKPNNEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y W+KG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWRKGGLDWE 119


>gi|260751303|gb|ACX48925.1| NADH dehydrogenase subunit 3 [Leiopathes glaberrima]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F +RF
Sbjct: 1   MLTEFYGILVLLIFSVILSAIISGASYILGVKQPDREKVSAYECGFDPFGTPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF+IFDLEI+FLFPW V + QI+ +GF +M+VFL ILT+G IYEW KG LEW+
Sbjct: 61  FLIAILFLIFDLEISFLFPWCVIYNQISPVGFWTMVVFLIILTLGLIYEWIKGGLEWE 118


>gi|28198171|ref|NP_778485.1| NADH dehydrogenase subunit A [Xylella fastidiosa Temecula1]
 gi|28056241|gb|AAO28134.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xylella fastidiosa
           Temecula1]
 gi|307579273|gb|ADN63242.1| NADH dehydrogenase subunit A [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 1   MLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|57639717|gb|AAW55705.1| NADH dehydrogenase subunit 3 [Polytrichum juniperinum]
          Length = 110

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (83%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS YECGFDPFDDA  +FDIRF LVS+LF+IFDLE+ FLFPWAV   +I   GF SM
Sbjct: 32  PEKLSAYECGFDPFDDAXSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSM 91

Query: 99  MVFLGILTVGFIYEWKKGA 117
           +VFL ILT+GF+YEWKKGA
Sbjct: 92  IVFLLILTIGFLYEWKKGA 110


>gi|11466607|ref|NP_066497.1| NADH dehydrogenase subunit 3 [Rhodomonas salina]
 gi|10444194|gb|AAG17768.1|AF288090_44 NADH dehydrogenase subunit 3 [Rhodomonas salina]
          Length = 121

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 83/121 (68%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L+ +  + ++  I   +  +  I  +++  K    EKLS YECGFDPFD+AR  FD
Sbjct: 1   MTLYLSQFFSLFIYFFICFLLAFIFFILSYVLGPKKIYIEKLSAYECGFDPFDNARNTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF++FDLE++FLFPW +   +     + SM++FL ILTVGFIYEWKKGAL+W
Sbjct: 61  IRFYLVAILFIVFDLEVSFLFPWCLVISKSCLFSYWSMVIFLVILTVGFIYEWKKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|300311095|ref|YP_003775187.1| transmembrane NADH dehydrogenase I subunit A [Herbaspirillum
           seropedicae SmR1]
 gi|300073880|gb|ADJ63279.1| transmembrane NADH dehydrogenase I (Chain A) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 119

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +   +   ++    PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LENYFPVLLFILVGIGVGVAPQLLGRLLGPHKPDAQKTSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AF FPW V  +++ W GF +MMVF+    VGF Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFFFPWGVSMRELGWQGFVTMMVFIAEFVVGFWYIWKKGALDWE 119


>gi|71275690|ref|ZP_00651975.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Dixon]
 gi|71897854|ref|ZP_00680080.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|170729489|ref|YP_001774922.1| NADH dehydrogenase subunit A [Xylella fastidiosa M12]
 gi|182680805|ref|YP_001828965.1| NADH dehydrogenase subunit A [Xylella fastidiosa M23]
 gi|71163581|gb|EAO13298.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Dixon]
 gi|71732409|gb|EAO34463.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|167964282|gb|ACA11292.1| NADH-ubiquinone oxidoreductase, NQO7 subunit [Xylella fastidiosa
           M12]
 gi|182630915|gb|ACB91691.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xylella
           fastidiosa M23]
          Length = 135

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|71897766|ref|ZP_00679992.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|71732321|gb|EAO34375.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
          Length = 135

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|190575278|ref|YP_001973123.1| NADH dehydrogenase subunit A [Stenotrophomonas maltophilia K279a]
 gi|190013200|emb|CAQ46833.1| putative NADH dehydrogenase I chain A [Stenotrophomonas maltophilia
           K279a]
          Length = 134

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 17  VLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 76

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 77  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 134


>gi|254251861|ref|ZP_04945179.1| NADH dehydrogenase alpha subunit [Burkholderia dolosa AUO158]
 gi|124894470|gb|EAY68350.1| NADH dehydrogenase alpha subunit [Burkholderia dolosa AUO158]
          Length = 119

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVGIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|109156447|ref|YP_654279.1| NADH dehydrogenase subunit 3 [Pseudopterogorgia bipinnata]
 gi|108513892|gb|ABF93175.1| NADH dehydrogenase subunit 3 [Pseudopterogorgia bipinnata]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 83/115 (72%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +K +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYKGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|15836908|ref|NP_297596.1| NADH dehydrogenase subunit A [Xylella fastidiosa 9a5c]
 gi|9105128|gb|AAF83116.1|AE003884_1 NADH-ubiquinone oxidoreductase, NQO7 subunit [Xylella fastidiosa
           9a5c]
          Length = 135

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|194366604|ref|YP_002029214.1| NADH dehydrogenase subunit A [Stenotrophomonas maltophilia R551-3]
 gi|194349408|gb|ACF52531.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Stenotrophomonas maltophilia R551-3]
          Length = 134

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 17  VLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 76

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 77  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLITMGLFVGMLFLGFIYVWKKGALEWE 134


>gi|115494870|ref|YP_778640.1| NADH dehydrogenase subunit 3 [Chrysopathes formosa]
 gi|82792231|gb|ABB90980.1| NADH dehydrogenase subunit 3 [Chrysopathes formosa]
          Length = 118

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F +RF
Sbjct: 1   MLTEFYGILVLLIFSVILSAIISGASYILGVKQPDREKVSAYECGFDPFRTPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF+IFDLEI+FLFPW V + Q++ +GF +M+VFL ILT+G IYEW KG LEW+
Sbjct: 61  FLIAILFLIFDLEISFLFPWCVIYNQVSPVGFWTMVVFLIILTLGLIYEWIKGGLEWE 118


>gi|254496121|ref|ZP_05109020.1| NADH dehydrogenase I, A subunit [Legionella drancourtii LLAP12]
 gi|254354662|gb|EET13298.1| NADH dehydrogenase I, A subunit [Legionella drancourtii LLAP12]
          Length = 97

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/87 (58%), Positives = 67/87 (77%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG 94
            SPD  K + YECGF  F+ + + FD+RF LV++LF+IFDLE AF FPWA+  ++I W G
Sbjct: 11  HSPDAAKNAPYECGFGAFESSHIPFDVRFYLVAILFIIFDLETAFFFPWALALRKIGWFG 70

Query: 95  FGSMMVFLGILTVGFIYEWKKGALEWD 121
           F  MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 71  FAGMMLFLGLLVIGFIYEWKRGALEWE 97


>gi|63025149|ref|YP_232814.1| NADH dehydrogenase subunit 3 [Tethya actinia]
 gi|37961483|gb|AAP59073.1| NADH dehydrogenase subunit 3 [Tethya actinia]
          Length = 118

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ I  ++ +  +IS   +IV  K PD EK+S YECGFDPF  +RV F ++F LV +LF
Sbjct: 8   IFLLILFSVTLSTIISGASYIVGNKQPDSEKVSVYECGFDPFGSSRVPFSVKFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI+  GF  + +FL ILT+G +YEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVVYNQISLFGFWVVYLFLIILTIGLVYEWAKGGLEWE 118


>gi|224020969|ref|YP_002608202.1| NADH dehydrogenase subunit 3 [Carica papaya]
          Length = 119

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 1/115 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIR 62
           +++ ++PI +++ I+  + ++L+  PF ++  S   P+KLS YECGFDP  DAR +FDIR
Sbjct: 1   MMSEFSPIFIYLVISPLVSLILLGLPFPLSSNSSTYPDKLSAYECGFDPSGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           F LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  FYLVSILFIIPDPEVTFFFPWAVPPNKIDPFGFWSMMAFLFILTIGFLYEWKRGA 115


>gi|254521491|ref|ZP_05133546.1| NADH-ubiquinone oxidoreductase Nqo7 subunit [Stenotrophomonas sp.
           SKA14]
 gi|219719082|gb|EED37607.1| NADH-ubiquinone oxidoreductase Nqo7 subunit [Stenotrophomonas sp.
           SKA14]
          Length = 118

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLITMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|1352558|sp|P48911|NU3M_CYACA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|758180|emb|CAA88774.1| NADH dehydrogenase subunit 3 [Cyanidium caldarium]
          Length = 120

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 81/120 (67%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M      Y  +  ++ I+  +  ++ +  +++  K  DPEK S YECGF+PFDD R  FD
Sbjct: 1   MKFYFVEYFILFTYIIISFILACIISLLSYLLTTKKEDPEKTSAYECGFNPFDDTRTTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF  F LEI+FLFPW++    I++ GF ++++FL ILT+GFIYEWKKGAL W
Sbjct: 61  VKFYLVAILFFNFCLEISFLFPWSIVLGNISYFGFVAIILFLFILTIGFIYEWKKGALNW 120


>gi|117926909|ref|YP_867526.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Magnetococcus sp. MC-1]
 gi|117610665|gb|ABK46120.1| NADH dehydrogenase subunit A [Magnetococcus sp. MC-1]
          Length = 118

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+ + IA  + + ++ + ++V  K P  EK S YECGF P     +KFD+RF
Sbjct: 1   MLESYFPVLILLVIAGGMAVFMLAASYLVGVKRPYAEKRSQYECGFAPLSRVYIKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E AFLFPWAV FK+I  +GF  M++FL +L VG+ Y WKKGALEW+
Sbjct: 61  YLLAILFIVFDIEAAFLFPWAVAFKEIGIVGFVEMVLFLVVLLVGYAYAWKKGALEWE 118


>gi|317097392|ref|YP_004123599.1| NADH dehydrogenase subunit 3 [Plakina crypta]
 gi|308912605|gb|ADO51371.1| NADH dehydrogenase subunit 3 [Plakina crypta]
          Length = 122

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 73/94 (77%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + +I+  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF+IFDLEI+F+FPW+V F
Sbjct: 29  ASYILGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILFMIFDLEISFIFPWSVVF 88

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 89  NQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|49147175|ref|YP_025768.1| NADH dehydrogenase subunit 3 [Pseudendoclonium akinetum]
 gi|33439190|gb|AAQ18727.1| NADH dehydrogenase subunit 3 [Pseudendoclonium akinetum]
          Length = 117

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 79/113 (69%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           Y  IL+++  A A   +   + F+VA +    EK S+YECGFDPFDDAR +FD+RF LV+
Sbjct: 4   YLSILIYLVAAGAFATIFSGAAFLVAVRRTYSEKTSSYECGFDPFDDARSRFDVRFYLVA 63

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF+I DLEI F FP+++    I  LG+   ++F+ ILTVGFIYEW KGAL+W
Sbjct: 64  LLFLIMDLEILFCFPYSIALADIGSLGYWVGIIFILILTVGFIYEWSKGALDW 116


>gi|330339540|ref|YP_004376740.1| NADH dehydrogenase subunit 3 [Corallium konojoi]
 gi|328750581|dbj|BAK18842.1| NADH dehydrogenase subunit 3 [Corallium konojoi]
          Length = 117

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFGGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +K +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYKGLPLFGYWVVMIFLFILTLGLIYEWIEGGLEWE 116


>gi|118602275|ref|YP_903490.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gi|118567214|gb|ABL02019.1| NADH dehydrogenase subunit A [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 118

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P++VF+ +  A  +  M+  +++    P  EK + +ECGF  FDD+R+ F++R+
Sbjct: 1   MLESYIPVIVFIFLGLAFGVGPMLIGYLLGPSKPYEEKNTQFECGFPAFDDSRMYFNVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV   Q+ W GF ++ +FL +L VGFI+EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSQLGWFGFIAISIFLFLLAVGFIFEWKNGALEWE 118


>gi|7524982|ref|NP_050080.1| NADH dehydrogenase subunit 3 [Dictyostelium discoideum]
 gi|6093562|sp|Q37312|NU3M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|699592|dbj|BAA03934.1| NADH dehydrogenase subunit 3 [Dictyostelium discoideum]
 gi|4958885|dbj|BAA78062.1| NADH dehydrogenase subunit 3 [Dictyostelium discoideum]
          Length = 120

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  ILV +AI++ + ++L    + + FK    +KL  YECGFDPF +AR +FDIRF LV
Sbjct: 6   EFVYILVLLAISTGLSVILFFLGYFLMFKVAYEDKLMGYECGFDPFGNARGEFDIRFYLV 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF+IFDLEI FLFP++V    +T L +  M++FL ILT+GFIYE KKGAL+W 
Sbjct: 66  AILFLIFDLEITFLFPFSVSIMSMTLLSYSLMLIFLIILTIGFIYEIKKGALDWS 120


>gi|317134295|ref|YP_004123150.1| NADH dehydrogenase subunit 3 [Plakina trilopha]
 gi|308912667|gb|ADO51429.1| NADH dehydrogenase subunit 3 [Plakina trilopha]
          Length = 122

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 73/94 (77%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF+IFDLEI+F+FPW+V F
Sbjct: 29  ASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILFMIFDLEISFIFPWSVVF 88

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 89  NQISLFGYWTMIIFLIILTLGLVYEWIKGGLEWE 122


>gi|329901006|ref|ZP_08272667.1| NADH ubiquinone oxidoreductase chain A [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549294|gb|EGF33869.1| NADH ubiquinone oxidoreductase chain A [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   ++A   PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LETYFPVLLFILVGIGVGVVPQLLGRVLAPFKPDSQKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE AF FPW V  + + W GF +M+VF+    VGF Y WKKGAL+W+
Sbjct: 63  LVAILFILFDLETAFFFPWGVAMRDLGWAGFVTMLVFIAEFAVGFWYIWKKGALDWE 119


>gi|62161303|ref|YP_214869.1| NADH dehydrogenase subunit 3 [Axinella corrugata]
 gi|55275034|gb|AAV49312.1| NADH dehydrogenase subunit 3 [Axinella corrugata]
          Length = 118

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ I  +I +  +IS   ++V  K PD EK+S YECGFDPF  +RV F ++F LV +LF
Sbjct: 8   IFLIILFSITLSTVISGASYVVGVKQPDSEKVSVYECGFDPFGSSRVPFSVKFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI   G  +M +FL ILT+G IYEW KG LEW+
Sbjct: 68  MIFDLEISFLFPWCVAYNQIGSFGIWTMYLFLIILTIGLIYEWVKGGLEWE 118


>gi|200004019|ref|YP_002221354.1| NADH dehydrogenase subunit 3 [Blastocystis sp. DMP/02-328]
 gi|156617366|gb|ABU87586.1| NADH dehydrogenase subunit 3 [Blastocystis sp. BT-1]
 gi|156617369|gb|ABU87588.1| NADH dehydrogenase subunit 3 [Blastocystis sp. DMP/02-328]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            + VF   A  I  V  +  +I   ++ D  KL++YECGF PFDDAR  F+I F LV++L
Sbjct: 8   ALFVFFICAIVISYVAFLISYIFGVRADDSNKLASYECGFTPFDDARNTFEIHFYLVAIL 67

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F++FDLEI+FLFPWAV    ++++G+ +M++F  +LT+GFIYE+KKGALEW+
Sbjct: 68  FLMFDLEISFLFPWAVSLSTLSFVGYFAMVIFFILLTLGFIYEYKKGALEWE 119


>gi|149184639|ref|ZP_01862957.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Erythrobacter sp. SD-21]
 gi|148831959|gb|EDL50392.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Erythrobacter sp. SD-21]
          Length = 124

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 76/121 (62%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF----IVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA A+    +  P     +     P  EK S YECGF  F+D R +FD
Sbjct: 4   LEQYLPILIFLFIAVALSAAFVFLPMGVSRLTGAHQPTAEKYSEYECGFPAFEDPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV      W G+ +MMVFL  L VGF Y WK GALEW
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDLTGWPGWITMMVFLAELIVGFAYAWKVGALEW 123

Query: 121 D 121
           D
Sbjct: 124 D 124


>gi|3914180|sp|O63850|NU3M_SARGL RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|3132795|gb|AAC16384.1| NADH dehydrogenase subunit 3 [Sarcophyton glaucum]
          Length = 117

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + I+  + I+++ + +I+ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|291147675|gb|ACB20491.2| NADH dehydrogenase subunit 3 [Carica papaya]
          Length = 118

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ I+  + ++L+  PF ++  S   P+KLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVISPLVSLILLGLPFPLSSNSSTYPDKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFFFPWAVPPNKIDPFGFWSMMAFLFILTIGFLYEWKRGA 114


>gi|146221431|gb|ABQ11831.1| NADH dehydrogenase subunit 3 [Iphiteon panicea]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 82/116 (70%), Gaps = 2/116 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKS-PDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            Y PIL+ + I SAI   ++I+   ++ K+ P+PEK S YECGFDP    R+ F I+F L
Sbjct: 5   EYIPILILL-ITSAIFSSILITISTLSSKNIPEPEKTSVYECGFDPIKTPRLPFSIKFFL 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V +LF++FD+EI+F+FPW    K I+W+ F +M++FL ILT+GFIYEW K  LEW+
Sbjct: 64  VGILFLLFDIEISFIFPWCTTIKSISWISFSTMILFLLILTIGFIYEWLKEGLEWE 119


>gi|317134246|ref|YP_004123490.1| NADH dehydrogenase subunit 3 [Halisarca sp. DVL-2010]
 gi|315141537|gb|ADT81741.1| NADH dehydrogenase subunit 3 [Halisarca sp. DVL-2010]
          Length = 119

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (71%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + I+ A+  ++  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF LV +LF+IFD
Sbjct: 13  LLISVALSTIISGASYILGVKEPDSEKVSAYECGFDPFESSRIPFSVRFFLVGILFLIFD 72

Query: 75  LEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LEI++LFPW V   QI  LGF  MM+FL ILT+G IYEW  G L+W+
Sbjct: 73  LEISYLFPWCVVSNQIELLGFWIMMIFLIILTLGLIYEWILGGLDWE 119


>gi|84624724|ref|YP_452096.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577696|ref|YP_001914625.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84368664|dbj|BAE69822.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188522148|gb|ACD60093.1| NADH-quinone oxidoreductase chain a [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+ +L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVCMLFLGFVYVWKKGALEWE 118


>gi|160872304|ref|ZP_02062436.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Rickettsiella grylli]
 gi|159121103|gb|EDP46441.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Rickettsiella grylli]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+     + +  +   ++   + PD  KLS YECGF    DAR+ FD+R+
Sbjct: 1   MLQQYFPILIFIVFGLFLGVAALSMGYLTGLQRPDWAKLSPYECGFPGMSDARLPFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I   G  +M +FL +L +GF+YEWKKGAL+W+
Sbjct: 61  YLVAILFIIFDLETAFLFPWAVSLRHIGLPGLLAMGIFLSLLLLGFVYEWKKGALQWE 118


>gi|326910742|gb|AEA11189.1| NADH dehydrogenase subunit 3 [Selaginella moellendorffii]
 gi|327176858|gb|AEA29866.1| NADH dehydrogenase subunit 3 [Selaginella moellendorffii]
          Length = 122

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (80%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEK+S YECGFDPFDDAR +F+IRF LVS+LF+IFDLE+ F FPWA+  K I   GF SM
Sbjct: 32  PEKVSAYECGFDPFDDARNRFEIRFYLVSILFIIFDLEVTFFFPWAISLKWIDLFGFWSM 91

Query: 99  MVFLGILTVGFIYEWKKGALEWD 121
           +VF  ILT+GF YEW++GAL+W 
Sbjct: 92  IVFFLILTIGFFYEWRQGALDWH 114


>gi|164421018|ref|YP_001648539.1| NADH dehydrogenase subunit 3 [Iotrochota birotulata]
 gi|158938948|gb|ABW83874.1| NADH dehydrogenase subunit 3 [Iotrochota birotulata]
          Length = 122

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 77/111 (69%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F  I  +IV+  +IS   +IV  K PD EK+S YECGFDPF  +RV F ++F LV +LF
Sbjct: 12  IFWLILCSIVLSTIISGASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLVGILF 71

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V   QI  LG   M +FL ILT+G IYEW +G LEW+
Sbjct: 72  LIFDLEISFLFPWCVVLNQINILGVWVMYLFLIILTIGLIYEWVRGGLEWE 122


>gi|54606761|dbj|BAD66784.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGVPFPFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFIILDPEVTFFFPWAVPLNKIDPFGSWSMMAFLLILTIGFLYEWKRGA 114


>gi|1524182|emb|CAA45193.1| NADH dehydrogenase subunit 3 [Brassica napus]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 114


>gi|58582859|ref|YP_201875.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58427453|gb|AAW76490.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 152

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 35  VLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 94

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+ +L +GF+Y WKKGALEW+
Sbjct: 95  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVCMLFLGFVYVWKKGALEWE 152


>gi|110225685|ref|YP_665690.1| NADH dehydrogenase subunit 3 [Mesostigma viride]
 gi|17222556|gb|AAL36729.1|AF353999_9 NADH dehydrogenase subunit 3 [Mesostigma viride]
          Length = 118

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (80%)

Query: 38  DPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGS 97
           D EKLS YECGFDPFDDAR +FDIRF LV++LF+IFDLE+ +LFPW+V     + + F S
Sbjct: 35  DAEKLSAYECGFDPFDDARNRFDIRFYLVAILFIIFDLEVIYLFPWSVSLSDGSMIRFWS 94

Query: 98  MMVFLGILTVGFIYEWKKGALEW 120
           MM FL +LT+GFIYEW KGAL+W
Sbjct: 95  MMAFLILLTIGFIYEWMKGALDW 117


>gi|171187531|gb|ACB41369.1| NADH dehydrogenase subunit A [Mimulus guttatus]
          Length = 114

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PIL+++ I+S + ++ +  PF  +  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFSPILIYLVISSLVSLIPLGVPFPFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|148244389|ref|YP_001219083.1| NADH dehydrogenase I chain A [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326216|dbj|BAF61359.1| NADH dehydrogenase I chain A [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 118

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI+VF+ +     I  M+  +++    P+ EK + +ECGF  F+D+R  F+IR+
Sbjct: 1   MLENYLPIVVFIFLGLFFGIGPMLIGYLLGPSKPNEEKNTQFECGFPAFNDSRTYFNIRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV   Q+ W GF  M +FL +L VGF++EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSQLGWFGFVVMSIFLFLLIVGFVFEWKNGALEWE 118


>gi|294788084|ref|ZP_06753328.1| NADH dehydrogenase (ubiquinone), A subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294484377|gb|EFG32060.1| NADH dehydrogenase (ubiquinone), A subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 122

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F  +     IV ++   I+  K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVLIFAIVGLIAGIVFILLGTILGPKRHYAEKDTPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K    Q     F SM+VF+ +LTVGFIYEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVYKDLMAQTGAYAFWSMLVFIVVLTVGFIYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|317097376|ref|YP_004123585.1| NADH dehydrogenase subunit 3 [Plakina monolopha]
 gi|308912590|gb|ADO51357.1| NADH dehydrogenase subunit 3 [Plakina monolopha]
          Length = 122

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 72/94 (76%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF+IFDLEI+F+FPW+V F
Sbjct: 29  ASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILFMIFDLEISFIFPWSVVF 88

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 89  NQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|270267569|ref|YP_003331253.1| NADH dehydrogenase subunit 3 [Dendronephthya gigantea]
 gi|209887407|gb|ACI95029.1| NADH dehydrogenase subunit 3 [Dendronephthya gigantea]
          Length = 117

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVIMLFLFILTLGLIYEWIEGGLEWE 116


>gi|164421079|ref|YP_001648624.1| NADH dehydrogenase subunit 3 [Agelas schmidti]
 gi|158938994|gb|ABW83917.1| NADH dehydrogenase subunit 3 [Agelas schmidti]
          Length = 118

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 2/111 (1%)

Query: 13  VFMAIASAIVIVLMIS--PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +F+ I  ++++  +IS   +I   K PD EK+S YECGFDPF  +R  F +RF LV +LF
Sbjct: 8   IFILILFSVILSTVISGASYIAGVKQPDGEKVSVYECGFDPFGSSRAPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI   G  +M +FL ILT+G IYEW KG LEW+
Sbjct: 68  MIFDLEISFLFPWCVTYNQIHLWGVWTMFLFLIILTIGLIYEWAKGGLEWE 118


>gi|200004047|ref|YP_002221381.1| NADH dehydrogenase subunit 3 [Blastocystis sp. NandII]
 gi|156617372|gb|ABU87590.1| NADH dehydrogenase subunit 3 [Blastocystis sp. NandII]
          Length = 119

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 83/116 (71%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T    + V++ +A  I  V     ++   ++ D  KLS YECGF PF+DAR  F+I F L
Sbjct: 4   TDLYALFVYLILAIIISYVAFGISYLFGIRADDSNKLSAYECGFTPFEDARNTFEIHFYL 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LF++FDLEI+FL+PWA+    I+++G+ +M++FL +LT+GFIYE+KKGALEW+
Sbjct: 64  VAILFLMFDLEISFLYPWAISLSAISFVGYFAMVIFLILLTLGFIYEYKKGALEWE 119


>gi|20198300|gb|AAM15514.1| hypothetical protein [Arabidopsis thaliana]
          Length = 477

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 85/119 (71%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIR 62
           +++ +API +++ I+  + ++L+  PF  A  S   PEKLS YECGFDP  DAR +FDIR
Sbjct: 359 MMSEFAPISIYLVISLLVSLILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIR 418

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA + +
Sbjct: 419 FYLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGASDRE 477


>gi|88607210|ref|YP_505114.1| NADH dehydrogenase I, A subunit [Anaplasma phagocytophilum HZ]
 gi|88598273|gb|ABD43743.1| NADH dehydrogenase I, A subunit [Anaplasma phagocytophilum HZ]
          Length = 120

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y+ +L+F ++A+ +  +  + P  +A +    EKL  YECGFD  ++    FDI+FC++
Sbjct: 6   EYSSVLIFFSLAAVLSSLFAVLPIFLAKRRDSMEKLVPYECGFDQKEEVSSVFDIKFCII 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LFVIFD+E+ FLFPW+V    I + G+ SM+ FLG+LT+GFIYEW  GALEW+
Sbjct: 66  GILFVIFDVEVTFLFPWSVCLGSIGFAGYFSMLCFLGMLTIGFIYEWNSGALEWE 120


>gi|1518347|emb|CAA89854.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
 gi|12584567|emb|CAA58829.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
          Length = 118

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|12006705|gb|AAG44883.1|AF285878_1 NADH dehydrogenase subunit 3 [Daucus carota]
 gi|12006707|gb|AAG44884.1|AF285879_1 NADH dehydrogenase subunit 3 [Daucus carota]
          Length = 118

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ A  S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFLFASNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|323649905|ref|YP_004237278.1| NADH dehydrogenase subunit 3 [Ricinus communis]
 gi|322394285|gb|ADW96042.1| NADH dehydrogenase subunit 3 [Ricinus communis]
          Length = 118

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ I+  + ++ +  PF  A  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFSPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIILDPEVTFFFPWAVPPNKIDLFGFWSMMAFLLILTIGSLYEWKRGA 114


>gi|89280722|ref|YP_514649.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|289065031|ref|YP_003433842.1| NADH dehydrogenase subunit 3 [Oryza rufipogon]
 gi|769728|dbj|BAA06832.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|769734|dbj|BAA04794.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|870716|gb|AAA70313.1| Nad3 protein [Oryza sativa]
 gi|74100089|gb|AAZ99253.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|74100144|gb|AAZ99307.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|74100198|gb|AAZ99360.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|285026113|dbj|BAI67946.1| NADH dehydrogenase subunit 3 [Oryza rufipogon]
 gi|285026175|dbj|BAI68007.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
          Length = 155

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (66%), Gaps = 1/121 (0%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFD 60
           S  L+ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDP  DAR +FD
Sbjct: 35  SAFLSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFD 94

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF  V +LF+I DLE+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA + 
Sbjct: 95  IRFYPVPILFIIPDLEVTFFFPWAVPPNKIDLFGSWSMMAFLLILTIGFLYEWKRGASDR 154

Query: 121 D 121
           +
Sbjct: 155 E 155


>gi|164421183|ref|YP_001648569.1| NADH dehydrogenase subunit 3 [Ptilocaulis walpersi]
 gi|158938965|gb|ABW83890.1| NADH dehydrogenase subunit 3 [Ptilocaulis walpersi]
          Length = 118

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 70/92 (76%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           +I+  K PD EK+S YECG+DPF  +R+ F ++F LV +LF+IFDLEI+FLFPWAV ++Q
Sbjct: 27  YIIGIKQPDSEKVSVYECGYDPFGSSRILFSVKFFLVGILFLIFDLEISFLFPWAVTYQQ 86

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           I   G+  M +FL ILT+G IYEW +G LEW+
Sbjct: 87  IGLFGYWVMYLFLIILTIGLIYEWVQGGLEWE 118


>gi|124484828|ref|YP_001031210.1| NADH dehydrogenase subunit 3 [Amphimedon queenslandica]
 gi|113952600|gb|ABI48999.1| NADH dehydrogenase subunit 3 [Amphimedon queenslandica]
          Length = 118

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 77/113 (68%), Gaps = 6/113 (5%)

Query: 14  FMAIASAIVIVLMIS------PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +M + S I+  +++S       +++  + PD EK+S YECGFDPF+ AR+ F +RF LV 
Sbjct: 5   YMGVVSLILFSVVLSTIISGGSYVMGVRHPDSEKVSVYECGFDPFESARIPFSVRFFLVG 64

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF+IFDLEI+++FPW V +  I   GF  MM+FL ILT G IYEW +G LEW
Sbjct: 65  ILFMIFDLEISYIFPWGVAYSHIGLYGFWIMMLFLVILTGGLIYEWAQGGLEW 117


>gi|330339525|ref|YP_004376726.1| NADH dehydrogenase subunit 3 [Paracorallium japonicum]
 gi|328750566|dbj|BAK18828.1| NADH dehydrogenase subunit 3 [Paracorallium japonicum]
          Length = 117

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 81/115 (70%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFGGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|84508546|ref|YP_448711.1| NADH dehydrogenase subunit 3 [Dictyota dichotoma]
 gi|45925714|gb|AAS79095.1| NADH dehydrogenase subunit 3 [Dictyota dichotoma]
          Length = 119

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F  I+  +  ++    +I+AF   D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LHEYYPVLLFFLISILLAFLIFGLSYILAFSKADSEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF++FD+E  F+FPWAV   Q+  +G+ SMM FL  L VGFIY WK G+LEW
Sbjct: 64  LVAILFLLFDIETVFVFPWAVSLSQLPSVGYWSMMDFLFELIVGFIYAWKIGSLEW 119


>gi|20385855|gb|AAM21471.1|AF395896_1 NADH dehydrogenase subunit 3 [Pisum sativum]
          Length = 118

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++ +  PF+ A  S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MPEFAPICIYLVISPLVSLIPLGVPFLFASNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|224365657|ref|YP_002608384.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
 gi|225465152|ref|XP_002278765.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|209954181|emb|CAQ77633.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
 gi|239764727|gb|ACS15198.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
          Length = 118

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|285017792|ref|YP_003375503.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenaseI chain a)
           (ndh-1, chain a) (nuo1) oxidoreductase [Xanthomonas
           albilineans GPE PC73]
 gi|283473010|emb|CBA15515.1| probable nadh-quinone oxidoreductase chain a (nadh dehydrogenaseI
           chain a) (ndh-1, chain a) (nuo1). oxidoreductase protein
           [Xanthomonas albilineans]
          Length = 118

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I + LM+    +  + PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPTLLFLIVATGIGVALMLIGRFLGPRRPDLKKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  +      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMDLGARSLVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|84508583|ref|YP_448631.1| NADH dehydrogenase subunit 3 [Fucus vesiculosus]
 gi|39653306|gb|AAR29325.1| NADH dehydrogenase subunit 3 [Fucus vesiculosus]
          Length = 120

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 80/117 (68%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P L+++  +  +  V+  + + +A    D EKLS+YECGFDP++DAR  FD+RF 
Sbjct: 4   LKEYYPALIYLCFSLLLASVIFGASYTLAMSEADSEKLSSYECGFDPYEDARNAFDVRFY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FD+E  FLFPWA    Q+  +G+ SM+ FL  L +GFIY W+ G+L+W+
Sbjct: 64  LVAILFLLFDIETVFLFPWAASLSQLPAIGYWSMIDFLFELVIGFIYAWQIGSLDWE 120


>gi|107736214|ref|YP_626510.1| NADH dehydrogenase subunit 3 [Briareum asbestinum]
 gi|100913614|gb|ABF69701.1| NADH dehydrogenase subunit 3 [Briareum asbestinum]
          Length = 117

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 81/115 (70%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G +YEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMSLPLFGYWVVMLFLFILTLGLVYEWIEGGLEWE 116


>gi|317097476|ref|YP_004123692.1| NADH dehydrogenase subunit 3 [Plakina sp. DVL-2010]
 gi|308912636|gb|ADO51400.1| NADH dehydrogenase subunit 3 [Plakina sp. DVL-2010]
          Length = 122

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (75%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGFDPF+ +R+ F +RF L+ +LF+IFDLEI+ +FPW+V F
Sbjct: 29  ASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILFMIFDLEISXIFPWSVVF 88

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 89  NQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|109156513|ref|YP_654325.1| NADH dehydrogenase subunit 3 [Agaricia humilis]
 gi|108744076|gb|ABG02301.1| NADH dehydrogenase subunit 3 [Agaricia humilis]
          Length = 118

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 3/111 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF  + SA+      + + +  K PD EK+S YECGF+PF      F +RF LV +LF
Sbjct: 11  LLVFSVVLSAL---FFGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V F QI+  GF  M+VFLG+LT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVLFNQISPFGFWVMVVFLGVLTLGLIYEWVKGGLEWE 118


>gi|26557002|ref|NP_085553.2| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|15215919|emb|CAA69839.3| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
          Length = 119

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 83/115 (72%), Gaps = 1/115 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIR 62
           +++ +API +++ I+  + ++L+  PF  A  S   PEKLS YECGFDP  DAR +FDIR
Sbjct: 1   MMSEFAPISIYLVISLLVSLILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           F LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  FYLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 115


>gi|57639719|gb|AAW55706.1| NADH dehydrogenase subunit 3 [Psilotum nudum]
          Length = 110

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 62/80 (77%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEK+S +ECG DPFDDAR +FDIRF LVS+ F+I D E+ F FPWAV   +I W GF SM
Sbjct: 31  PEKVSAHECGSDPFDDARSRFDIRFYLVSIPFIISDSEVTFSFPWAVSPNKIGWFGFRSM 90

Query: 99  MVFLGILTVGFIYEWKKGAL 118
           MVF  ILT+GFIYEWKKG L
Sbjct: 91  MVFTRILTIGFIYEWKKGVL 110


>gi|2665687|gb|AAB88455.1| NADH-UQ dehydrogenase subunit 3 [Lupinus luteus]
 gi|2665690|gb|AAB88457.1| NADH-UQ dehydrogenase subunit 3 [Lupinus albus]
 gi|2665693|gb|AAB88459.1| NADH-UQ dehydrogenase subunit 3 [Lupinus mutabilis]
 gi|2665696|gb|AAB88461.1| NADH-UQ dehydrogenase subunit 3 [Lupinus angustifolius]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGLPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLFILTIGSLYEWKRGA 114


>gi|237746751|ref|ZP_04577231.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes HOxBLS]
 gi|229378102|gb|EEO28193.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes HOxBLS]
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 68/90 (75%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           +A   PD EKLS YECGF PF++AR+KFD+RF L+++LF++FDLE AFLFPWA   +++ 
Sbjct: 30  LAPHRPDSEKLSPYECGFAPFENARMKFDVRFYLIAILFILFDLETAFLFPWAASMRELG 89

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           W  F ++M+FL  L  GF Y WKKGAL W+
Sbjct: 90  WQAFVAIMIFLAELVAGFWYIWKKGALNWE 119


>gi|163854295|ref|YP_001633641.1| NADH dehydrogenase subunit 3 [Negombata magnifica]
 gi|163639450|emb|CAM06606.1| NADH dehydrogenase subunit 3 [Negombata magnifica]
          Length = 117

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + +IV  K PD EK+S YECGFDPF  +RV F ++F LV +LF+IFDLEI+FLFPW V  
Sbjct: 24  ASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLVGILFLIFDLEISFLFPWCVVL 83

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   G   M +FL ILT+G IYEW +G LEW+
Sbjct: 84  NQIKLFGVWVMYLFLIILTLGLIYEWVRGGLEWE 117


>gi|109156427|ref|YP_654313.1| NADH dehydrogenase subunit 3 [Ricordea florida]
 gi|108515297|gb|ABF93394.1| NADH dehydrogenase subunit 3 [Ricordea florida]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 3/111 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  I SA       + + +  K PD EK+S YECGF+PF      F +RF LV +LF
Sbjct: 11  LLIFSVILSAF---FSGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V + QI+ LGF  M+VFLGILT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVIYNQISPLGFWIMVVFLGILTLGLIYEWIKGGLEWE 118


>gi|294669092|ref|ZP_06734178.1| NADH dehydrogenase, A subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309084|gb|EFE50327.1| NADH dehydrogenase, A subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 122

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     I+ ++   ++  K    EK   +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYLPVLIFLIVGLLAGILFILLGTVLGPKRHYAEKDQPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV FK    Q     F SM VF+ +L VGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVFKNLLAQSGQFAFWSMFVFIVVLGVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|22325554|ref|NP_671803.1| NADH-ubiquinone oxidoreductase chain 3, putative [Arabidopsis
           thaliana]
 gi|303517|dbj|BAA02856.1| NADH dehydrogenase subunit 3 [Brassica napus]
 gi|1171198|gb|AAB18648.1| NADH dehydrogenase subunit three [Raphanus sativus]
 gi|1171201|gb|AAB18650.1| NADH dehydrogenase subunit three [Raphanus sativus]
 gi|330250975|gb|AEC06069.1| NADH dehydrogenase I subunit 3 [Arabidopsis thaliana]
          Length = 118

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++L+  PF  A  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPISIYLVISLLVSLILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 114


>gi|329118898|ref|ZP_08247593.1| NADH-quinone oxidoreductase subunit A [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464926|gb|EGF11216.1| NADH-quinone oxidoreductase subunit A [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 135

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ +FM +  A  ++ +    ++       EK + +ECGF+ F++AR+KFD+R+
Sbjct: 18  MLSNYFPVFIFMLVGLAAGVLFIALGLLLGPNRHYAEKDTPFECGFEAFENARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAF+ PWAV FK++       M+VF+ +L +GF+YEWKKGALEW+
Sbjct: 78  YLVAILFILFDLEIAFVIPWAVVFKELGAPALWPMLVFIVVLGIGFVYEWKKGALEWE 135


>gi|317134164|ref|YP_004123417.1| NADH dehydrogenase subunit 3 [Corticium candelabrum]
 gi|308912773|gb|ADO51528.1| NADH dehydrogenase subunit 3 [Corticium candelabrum]
          Length = 122

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 79/117 (67%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  +  I + + ++  +  ++  + + +  K PD EK+S YECGFDPF+ +R+ F +R  
Sbjct: 6   LLEFFVIFIMLCLSIGLSFIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRXF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V   QI   G+  M+VFL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVLNQIPLFGYWIMIVFLFILTLGLVYEWVKGGLEWE 122


>gi|11467083|ref|NP_042559.1| NADH dehydrogenase, subunit 3 [Acanthamoeba castellanii]
 gi|6647621|sp|Q37382|NU3M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|562064|gb|AAD11852.1| NADH dehydrogenase, subunit 3 [Acanthamoeba castellanii]
          Length = 118

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y  I +F   A  I  +L+   + + ++  D EK S YECGF PF+D R KF++R+ L+
Sbjct: 4   EYIYIFIFFWGAFFISCLLIFLSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRYYLI 63

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF+IFDLEI +LFPW++     ++ G  ++ +FL ILTVGFIYEW+KGALEWD
Sbjct: 64  AILFMIFDLEIMYLFPWSISISTGSFFGVWAIFLFLIILTVGFIYEWQKGALEWD 118


>gi|284794746|ref|YP_003412099.1| NADH dehydrogenase subunit 3 [Phaeoceros laevis]
 gi|254596066|gb|ACT75307.1| NADH dehydrogenase subunit 3 [Phaeoceros laevis]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 79/116 (68%), Gaps = 2/116 (1%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSP--DPEKLSTYECGFDPFDDARVKFDIRFCL 65
           + PI V++ I+S + ++L+   F+ AF S    PEKLS +ECG DP DD R +FDIRF  
Sbjct: 3   FVPICVYLVISSLLFLILIGVSFLFAFSSSLAYPEKLSAHECGSDPSDDVRSRFDIRFYF 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V +  +I DLE+  LFPWAV   +I   GF SMMVF  I T+GF+YEWKKGAL+W+
Sbjct: 63  VLISSIISDLEVTSLFPWAVSPNKIGLFGFWSMMVFSLISTIGFVYEWKKGALDWE 118


>gi|109156412|ref|YP_654403.1| NADH dehydrogenase subunit 3 [Porites porites]
 gi|108744158|gb|ABG02377.1| NADH dehydrogenase subunit 3 [Porites porites]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 3/111 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF  + SA+      + + +  K PD EK+S YECGF+PF      F +RF LV +LF
Sbjct: 11  LLVFSVVLSAL---FSGASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V F QI+  GF  M+VFLG+LT+G +YEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVLFNQISPFGFWVMVVFLGVLTLGLLYEWIKGGLEWE 118


>gi|63025106|ref|YP_232800.1| NADH dehydrogenase subunit 3 [Geodia neptuni]
 gi|37961468|gb|AAP59165.1| NADH dehydrogenase subunit 3 [Geodia neptuni]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + ++V  + PD EK+S YECGFDP   +R  F ++F LV +LF++FDLEI+FLFPW V +
Sbjct: 25  ASYLVGIRQPDSEKVSVYECGFDPLGSSRTPFSVKFFLVGILFLVFDLEISFLFPWCVIY 84

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI  LG   M +FL ILT+G IYEW KG LEW+
Sbjct: 85  NQIGLLGIWMMYLFLVILTIGLIYEWVKGGLEWE 118


>gi|82253|pir||JV0006 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 3 - garden
           petunia mitochondrion
 gi|1323713|gb|AAC00529.1| NAD3 [Petunia sp.]
 gi|1421804|gb|AAB03875.1| NADH dehydrogenase chain 3 [Petunia axillaris subsp. parodii]
          Length = 118

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|325267310|ref|ZP_08133972.1| NADH-quinone oxidoreductase subunit A [Kingella denitrificans ATCC
           33394]
 gi|324981247|gb|EGC16897.1| NADH-quinone oxidoreductase subunit A [Kingella denitrificans ATCC
           33394]
          Length = 122

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F  I     IV ++    +  K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVLIFAIIGLIAGIVFILLGTFLGPKRHYAEKDTPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT----WLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K +        F SM+VF+ +LTVGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMVPWAVVYKDLMADTGAYAFWSMLVFIVVLTVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|6137790|ref|NP_009260.1| NADH dehydrogenase subunit 3 [Metridium senile]
 gi|3122484|sp|Q35100|NU3M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1353407|gb|AAC47101.1| NADH dehydrogenase subunit 3 [Metridium senile]
 gi|2920992|gb|AAC04637.1| NADH dehydrogenase subunit 3 [Metridium senile]
          Length = 118

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F IRF
Sbjct: 1   MYTEFYGILVLLIFSVVLSAIISGASYILGDKQPDREKVSAYECGFDPFGTPGRPFSIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW V   Q+   G+ +M+VFL +LT+G +YEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWCVVCNQVFPFGYWTMIVFLAVLTLGLVYEWLKGGLEWE 118


>gi|107736857|ref|YP_626484.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168915]
 gi|107736884|ref|YP_626497.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168916]
 gi|99866568|gb|ABF67616.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168915]
 gi|99866582|gb|ABF67629.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168916]
          Length = 118

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGF+PF      F +RF LV +LF+IFDLEI+FLFPW V +
Sbjct: 25  ASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRFFLVGILFLIFDLEISFLFPWCVIY 84

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI  LGF  M+VFLGILT+G +YEW KG LEW+
Sbjct: 85  NQIAPLGFWIMVVFLGILTLGLVYEWIKGGLEWE 118


>gi|164421156|ref|YP_001648558.1| NADH dehydrogenase subunit 3 [Chondrilla aff. nucula CHOND]
 gi|158668117|gb|ABW76578.1| NADH dehydrogenase subunit 3 [Chondrilla aff. nucula CHOND]
          Length = 119

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  I + + I+  +  V+  + +++  K PD EK+S YECGFDPF+ +R+ F +RF  V
Sbjct: 5   EFLGIFILLLISVVLSTVISSASYVLGVKKPDSEKVSAYECGFDPFESSRIPFSVRFFXV 64

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI++LF W V   QI  LGF  M++FL ILT+G IYEW  G L+W+
Sbjct: 65  GILFLIFDLEISYLFXWCVVSNQIELLGFWIMIIFLIILTLGLIYEWIXGGLDWE 119


>gi|164420993|ref|YP_001648614.1| NADH dehydrogenase subunit 3 [Halisarca dujardini]
 gi|158668147|gb|ABW76606.1| NADH dehydrogenase subunit 3 [Halisarca dujardini]
          Length = 119

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 75/111 (67%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + V + I+ A+   +  + +++  K PD EK+S YECGFDPF+ +R  F +R  LV +LF
Sbjct: 9   VFVLLLISVALSTAISGASYVLGVKKPDSEKVSAYECGFDPFESSRTPFSVRXFLVGILF 68

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI++LFPW V   QI  LGF  M+VF  ILT+G IYEW  G L+W+
Sbjct: 69  LIFDLEISYLFPWCVVSNQIELLGFWIMVVFXVILTLGLIYEWILGGLDWE 119


>gi|109156559|ref|YP_654369.1| NADH dehydrogenase subunit 3 [Nematostella sp. JVK-2006]
 gi|156320442|ref|XP_001618182.1| hypothetical protein NEMVEDRAFT_v1g225413 [Nematostella vectensis]
 gi|108744122|gb|ABG02343.1| NADH dehydrogenase subunit 3 [Nematostella sp. JVK-2006]
 gi|156197894|gb|EDO26082.1| predicted protein [Nematostella vectensis]
          Length = 118

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  +LV +  +  +  V+  + +I+  K PD EK+S YECGFDPF      F IRF
Sbjct: 1   MYTEFYGLLVLIIFSVILSAVISGASYILGDKQPDREKVSAYECGFDPFGAPGRPFSIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+F+FPW V + QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFIFPWCVVYNQISPFGYWTMILFLVILTLGLVYEWLKGGLEWE 118


>gi|164421122|ref|YP_001648417.1| NADH dehydrogenase subunit 3 [Cinachyrella kuekenthali]
 gi|158938904|gb|ABW83833.1| NADH dehydrogenase subunit 3 [Cinachyrella kuekenthali]
          Length = 119

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + ++V  K PD EK+S YECGFDP   +R  F ++F LV +LF++FDLEI+FLFPW V +
Sbjct: 26  ASYLVGIKQPDSEKVSVYECGFDPLGSSRTPFSVKFFLVGILFLVFDLEISFLFPWCVIY 85

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   G   M +FL ILT+G IYEW KG LEW+
Sbjct: 86  NQIGLXGVWMMYLFLVILTIGLIYEWVKGGLEWE 119


>gi|134283934|ref|ZP_01770630.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 305]
 gi|226195426|ref|ZP_03791015.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|134244723|gb|EBA44821.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 305]
 gi|225932628|gb|EEH28626.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei Pakistan
           9]
          Length = 105

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 74/105 (70%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ LV++LF+IFDLE
Sbjct: 1   MGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLE 60

Query: 77  IAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 61  TAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 105


>gi|109156525|ref|YP_654390.1| NADH dehydrogenase subunit 3 [Pavona clavus]
 gi|108744144|gb|ABG02364.1| NADH dehydrogenase subunit 3 [Pavona clavus]
          Length = 118

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (67%), Gaps = 3/111 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF  I SA+      + + +  K PD EK+S YECGF+PF      F +RF LV +LF
Sbjct: 11  LLVFSVILSAL---FFGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++FDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 68  LVFDLEISFLFPWCVLFNQISPFGFWVMVGFLGVLTLGLIYEWVKGGLEWE 118


>gi|57639705|gb|AAW55699.1| NADH dehydrogenase subunit 3 [Lonicera sp. Bergthorsson 0301]
          Length = 113

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFC 64
           + +API +++ I+  + ++ +  PF  +  S   PEKLS YECGFDP  DAR +FDIRF 
Sbjct: 1   SEFAPICIYLVISPLVSLIPLGVPFPFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|237748891|ref|ZP_04579371.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes OXCC13]
 gi|229380253|gb|EEO30344.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes OXCC13]
          Length = 119

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (72%)

Query: 31  IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQI 90
           I+A   PD EK S YECG  PFDDAR+KFD+RF L+++LF++FDLE AFLFPWA   K +
Sbjct: 29  ILAPHRPDAEKNSPYECGIAPFDDARMKFDVRFYLIAILFILFDLETAFLFPWASAMKDL 88

Query: 91  TWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            W  F ++M+FL  L  GF Y WKKGAL W+
Sbjct: 89  GWEAFVAIMIFLAELVAGFWYIWKKGALNWE 119


>gi|124286763|ref|YP_001023657.1| NADH dehydrogenase subunit 3 [Savalia savaglia]
 gi|110083982|gb|ABG49159.1| NADH dehydrogenase subunit 3 [Savalia savaglia]
          Length = 118

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  ILV +  +  +  ++  + +++  K PD EK+S YECGFD F      F +RF
Sbjct: 1   MYTEFYGILVLLIFSVILSAIISGASYVLGVKQPDREKVSAYECGFDAFGAPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW++ + QI+  GF +M VFL ILT+G IYEW +G LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWSIIYNQISPFGFWTMAVFLVILTLGLIYEWIEGGLEWE 118


>gi|87043018|ref|YP_492632.1| NADH dehydrogenase subunit 3 [Dictyostelium citrinum]
 gi|122000115|sp|Q2LCR0|NU3M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|84682118|gb|ABC60383.1| NADH dehydrogenase subunit 3 [Dictyostelium citrinum]
          Length = 120

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 78/116 (67%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             +  IL+   I+  + I+L    + + FK    +KL  YECGFDPF +AR +FDIRF L
Sbjct: 5   VEFTYILILFFISLGLSIILFFLGYFLMFKVAYEDKLMGYECGFDPFGNARGEFDIRFYL 64

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LF+IFDLEI FLFP++V    +T   +  M++FL ILT+GFIYE KKGAL+W 
Sbjct: 65  VAILFLIFDLEITFLFPFSVSIMSMTLFSYSIMLIFLIILTIGFIYEIKKGALDWS 120


>gi|225024125|ref|ZP_03713317.1| hypothetical protein EIKCOROL_00993 [Eikenella corrodens ATCC
           23834]
 gi|224943150|gb|EEG24359.1| hypothetical protein EIKCOROL_00993 [Eikenella corrodens ATCC
           23834]
          Length = 122

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+ VF+ +     ++ ++   ++  K    EK   +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVFVFILVGLIAGVLFILLGTLLGSKRHYAEKDQPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV FK    Q     F SM VF+ +L VGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVFKDLLAQSGQFAFWSMFVFIVVLGVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|192293783|ref|YP_001994422.1| NADH dehydrogenase subunit 3 [Acanella eburnea]
 gi|148964838|gb|ABR19860.1| NADH dehydrogenase subunit 3 [Acanella eburnea]
          Length = 115

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 81/115 (70%), Gaps = 2/115 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSIIILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G +YEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMAL--FGYWVVMLFLFILTLGLVYEWIEGGLEWE 114


>gi|302035991|ref|YP_003796313.1| NADH-quinone oxidoreductase membrane subunit A [Candidatus
           Nitrospira defluvii]
 gi|300604055|emb|CBK40387.1| NADH-quinone oxidoreductase, membrane subunit A [Candidatus
           Nitrospira defluvii]
          Length = 123

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y PIL+F+ IA A   V ++   IV    P   KL+ YE G   F DARV+F IR+ ++
Sbjct: 9   NYIPILIFIVIAFAFGAVQILLGRIVRPSRPYRAKLAPYESGSPLFSDARVQFPIRYYII 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+EI F+FPWAV FK++  +G   M+VF+ IL VGF Y WKKGALEWD
Sbjct: 69  AMLFVIFDIEIVFMFPWAVAFKKLGLVGLVEMVVFIAILIVGFWYAWKKGALEWD 123


>gi|109156540|ref|YP_654300.1| NADH dehydrogenase subunit 3 [Rhodactis sp. CASIZ 171755]
 gi|108515268|gb|ABF93381.1| NADH dehydrogenase subunit 3 [Rhodactis sp. CASIZ 171755]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGF+PF      F +RF LV +LF+IFDLEI+FLFPW V +
Sbjct: 25  ASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRFFLVGILFLIFDLEISFLFPWCVIY 84

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI   GF  M+VFLGILT+G IYEW KG LEW+
Sbjct: 85  NQIAPFGFWIMVVFLGILTLGLIYEWIKGGLEWE 118


>gi|146221446|gb|ABQ11845.1| NADH dehydrogenase subunit 3 [Sympagella nux]
          Length = 119

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG 94
            +P+PEK+S YECGFDP   +R+ F I+F L+ VLF+IFDLEI+++FPW    K+I W+ 
Sbjct: 33  NNPEPEKISIYECGFDPLHTSRLPFSIKFFLIGVLFLIFDLEISYIFPWCTCIKEIKWIS 92

Query: 95  FGSMMVFLGILTVGFIYEWKKGALEWD 121
           F +M+ FL ILT+GFIYEWK+  LEW+
Sbjct: 93  FITMIFFLTILTLGFIYEWKEEGLEWE 119


>gi|11467917|ref|NP_057978.1| NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
 gi|8099200|gb|AAF72055.1|AF204057_10 NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
 gi|7271429|emb|CAB77707.1| NADH ubiquinone oxidoreductase subunit 3 [Scenedesmus obliquus]
 gi|7711039|emb|CAB90363.1| NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
          Length = 117

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y  +L+++AIA  + IV++   + V  +  D EK + YECGF+PF +AR  FDI F 
Sbjct: 1   MTEYVGVLLYIAIAVGLGIVILFRSYKVRPRRLDLEKATAYECGFEPFGEARSPFDIGFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFD+E+AFL PW +        GF + ++FL +LT+GF++EW+KGALEW 
Sbjct: 61  LVAILFLIFDIEVAFLLPWVLGGISTGSSGFFAFLLFLVVLTIGFVFEWQKGALEWS 117


>gi|1046292|gb|AAA80308.1| NADH dehydrogenase chain 3 [Petunia axillaris subsp. parodii]
 gi|1046302|gb|AAB82731.1| NADH dehydrogenase chain 3 [Petunia x hybrida]
 gi|1256947|gb|AAA96603.1| NADH dehydrogenase subunit 3 [Petunia axillaris subsp. parodii]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEK S YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKFSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|109156483|ref|YP_654416.1| NADH dehydrogenase subunit 3 [Siderastrea radians]
 gi|108744172|gb|ABG02390.1| NADH dehydrogenase subunit 3 [Siderastrea radians]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 12  LVFMAIASAIVIVLMI-SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L F+ + S ++ VL   + + +  K PD EK+S YECGF+PF      F +RF LV +LF
Sbjct: 8   LFFLLVFSIVLSVLFSGASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVLFNQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|309792518|ref|ZP_07686981.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Oscillochloris trichoides DG6]
 gi|308225421|gb|EFO79186.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Oscillochloris trichoides DG6]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I VF   A +  ++ ++  F +  K P P KLSTYECG +   D RV+F +++
Sbjct: 1   MLANYAFIGVFFVAALSFPVIPLLLAFFLRPKRPAPLKLSTYECGLEAIGDIRVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F ++   GF + MVFL +L  G IYEW+KGALEW
Sbjct: 61  YLYALAFVIFDVEVVFLYPWAVAFNKVGLYGFTAAMVFLAMLFAGLIYEWRKGALEW 117


>gi|332968235|gb|EGK07312.1| NADH-quinone oxidoreductase subunit A [Kingella kingae ATCC 23330]
          Length = 122

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 86/123 (69%), Gaps = 6/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +L +Y P+L+F AI   I  +L I    +   K    EK + +ECGF+ F++AR+KFD+R
Sbjct: 1   MLENYFPVLIF-AIVGLIAGILFIGLGTLFGPKRHYAEKDAPFECGFEAFENARMKFDVR 59

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           + LV++LF++FDLE+AF+ PWAV +K    +     F SM+VF+ +LTVGFIYEWKKGAL
Sbjct: 60  YYLVAILFILFDLEVAFMIPWAVVYKDLMAETGAFAFWSMLVFIVVLTVGFIYEWKKGAL 119

Query: 119 EWD 121
           EW+
Sbjct: 120 EWE 122


>gi|189095617|ref|YP_001936201.1| NADH dehydrogenase subunit 3 [Keratoisidinae sp. BAL208-1]
 gi|148540947|gb|ABQ86196.1| NADH dehydrogenase subunit 3 [Keratoisidinae sp. BAL208-1]
          Length = 115

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 80/115 (69%), Gaps = 2/115 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSIIILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G +YEW +G LEW 
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMAL--FGYWVVMLFLFILTLGLVYEWIEGGLEWG 114


>gi|164421138|ref|YP_001648583.1| NADH dehydrogenase subunit 3 [Ectyoplasia ferox]
 gi|158668129|gb|ABW76589.1| NADH dehydrogenase subunit 3 [Ectyoplasia ferox]
          Length = 118

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (73%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           ++VA K PD EK+S YECG+DPF  +R+ F ++F L+ +LF+IFDLEI+FLFPW+V + Q
Sbjct: 27  YMVAIKQPDSEKVSVYECGYDPFGSSRILFSVKFFLIGILFLIFDLEISFLFPWSVTYHQ 86

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
               G+  M +FL ILT+G IYEW  G LEW+
Sbjct: 87  NGLFGYWIMFLFLIILTIGLIYEWVLGGLEWE 118


>gi|57639697|gb|AAW55695.1| NADH dehydrogenase subunit 3 [Berberis bealei]
          Length = 111

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF  A  S   PEKLS +ECGFDP  DAR +FDIRF LVS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGFDPSGDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFFFPWAVSPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|57639713|gb|AAW55703.1| NADH dehydrogenase subunit 3 [Angiopteris lygodiifolia]
          Length = 109

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 60/79 (75%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS YECGFDPFDDAR +FDIRF  V +LF+I DLE+ F FPWAV   +I W GF SM
Sbjct: 31  PEKLSAYECGFDPFDDARSRFDIRFYSVPILFIISDLEVTFPFPWAVSPNKIGWFGFRSM 90

Query: 99  MVFLGILTVGFIYEWKKGA 117
           MVF  I T+G  YEWKKGA
Sbjct: 91  MVFSWISTIGSPYEWKKGA 109


>gi|128720|sp|P27062|NU3M_PANGI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1352869|gb|AAB01588.1| NADH dehydrogenase subunit 3 [Panax ginseng]
          Length = 118

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   P+KLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGVPFPFASNSSTYPDKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|116622681|ref|YP_824837.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116225843|gb|ABJ84552.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 78/115 (67%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           + Y PI +F+AIA +  +V +++  ++   +P   KL  YECG     D+R ++ +RF +
Sbjct: 3   SGYLPIFIFLAIAISFPVVAIVAAKLIRPSAPFAAKLEAYECGIKAASDSRGRYTVRFYI 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++LFVIFD+E  FLFPWAV ++Q+ W G   + VFL IL VG+I+ +KKGALEW
Sbjct: 63  IAILFVIFDVETIFLFPWAVRYRQMQWFGVAEVAVFLVILAVGYIWAYKKGALEW 117


>gi|312796902|ref|YP_004029824.1| NADH-quinone oxidoreductase chain A [Burkholderia rhizoxinica HKI
           454]
 gi|312168677|emb|CBW75680.1| NADH-quinone oxidoreductase chain A (EC 1.6.5.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 119

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + I L+    ++    PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLLVGLGLGIALVSIGKLLGPNKPDSDKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WK+G L W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKRGGLNWE 119


>gi|115278543|ref|YP_762328.1| NADH dehydrogenase subunit 3 [Sorghum bicolor]
 gi|1839016|emb|CAB06623.1| mitochondrial nad3 [Sorghum bicolor]
 gi|114309664|gb|ABI60881.1| NADH dehydrogenase subunit 3 [Sorghum bicolor]
          Length = 118

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|62161348|ref|YP_214976.1| NADH dehydrogenase subunit 3 [Montipora cactus]
 gi|62161421|ref|YP_214924.1| NADH dehydrogenase subunit 3 [Anacropora matthai]
 gi|58220699|gb|AAW67963.1| NADH dehydrogenase subunit 3 [Anacropora matthai]
 gi|58220713|gb|AAW67976.1| NADH dehydrogenase subunit 3 [Montipora cactus]
          Length = 118

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%)

Query: 28  SPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYF 87
           + + +  K PD EK+S YECGF+PF      F +RF LV +LF+IFDLEI+FLFPW V F
Sbjct: 25  ASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRFFLVGILFLIFDLEISFLFPWCVLF 84

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 85  NQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|222053570|ref|YP_002535932.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           FRC-32]
 gi|221562859|gb|ACM18831.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           FRC-32]
          Length = 118

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI++ +A+A A  +  +I   ++  K P   KLS YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPIILLVAVAVAFGLGSIIFSSLIGPKKPSEVKLSPYECGVEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  FL+PWAV FK++   G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|81176543|ref|YP_398425.1| nad3 [Triticum aestivum]
 gi|13704|emb|CAA32475.1| unnamed protein product [Triticum aestivum]
 gi|433682|emb|CAA41864.1| NADH dehydrogenase subunit 3 [Triticum aestivum]
 gi|78675267|dbj|BAE47692.1| nad3 [Triticum aestivum]
 gi|169649076|gb|ACA62637.1| nad3 [Triticum aestivum]
          Length = 118

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LV +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|164420964|ref|YP_001648531.1| NADH dehydrogenase subunit 3 [Callyspongia plicifera]
 gi|158668103|gb|ABW76565.1| NADH dehydrogenase subunit 3 [Callyspongia plicifera]
          Length = 118

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           +IV  K PD  K+  YECGF+PF+  R+ F +RF L  +LF+IFDLEI+FLFPW V + Q
Sbjct: 27  YIVGGKQPDGGKVPVYECGFNPFELLRMPFSVRFFLXGILFMIFDLEISFLFPWCVVYNQ 86

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           I  LG  +M +FL ILT+G IYEW KG LEW+
Sbjct: 87  IGLLGVLTMFLFLIILTIGLIYEWVKGGLEWE 118


>gi|20065794|ref|NP_612826.1|ND3_16049 NADH dehydrogenase subunit 3 [Acropora tenuis]
 gi|19908474|gb|AAM02917.1|AF338425_11 NADH dehydrogenase subunit 3 [Acropora tenuis]
          Length = 118

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (65%), Gaps = 3/111 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF  + SA       + + +  K PD EK+S YECGF+PF      F  RF LV +LF
Sbjct: 11  LLVFSVVLSAF---FSGASYFLGVKQPDREKVSAYECGFEPFGIPGRLFQFRFFLVGILF 67

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +IFDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 68  LIFDLEISFLFPWCVLFNQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|254994891|ref|ZP_05277081.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Mississippi]
 gi|255003024|ref|ZP_05277988.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004147|ref|ZP_05278948.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Virginia]
          Length = 121

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA-RVKFDIRFCLV 66
           Y+ IL+F+ +A+ +  V  + P  +A K     KLS YECGFD  +      FDI+FC+V
Sbjct: 7   YSSILLFIMLAAMVSSVFAVLPAFLAGKRGSLGKLSPYECGFDQGEAPDSSSFDIKFCVV 66

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+E+AFLFPWAV    I   GF SM+ F G+L VGF+YEW  GALEW+
Sbjct: 67  AILFVIFDVEVAFLFPWAVCLGAIGAFGFWSMVFFAGLLAVGFVYEWGVGALEWE 121


>gi|56416680|ref|YP_153754.1| NADH dehydrogenase I chain A [Anaplasma marginale str. St. Maries]
 gi|222475045|ref|YP_002563460.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Florida]
 gi|56387912|gb|AAV86499.1| NADH dehydrogenase I chain A [Anaplasma marginale str. St. Maries]
 gi|222419181|gb|ACM49204.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Florida]
          Length = 135

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA-RVKFDIRFCLV 66
           Y+ IL+F+ +A+ +  V  + P  +A K     KLS YECGFD  +      FDI+FC+V
Sbjct: 21  YSSILLFIMLAAMVSSVFAVLPAFLAGKRGSLGKLSPYECGFDQGEAPDSSSFDIKFCVV 80

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+E+AFLFPWAV    I   GF SM+ F G+L VGF+YEW  GALEW+
Sbjct: 81  AILFVIFDVEVAFLFPWAVCLGAIGAFGFWSMVFFAGLLAVGFVYEWGVGALEWE 135


>gi|160688743|gb|ABX45159.1| NADH dehydrogenase subunit 3 [Polysphondylium pallidum]
          Length = 118

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  IL+F+ I  A+ +++    + + FK    +KL  YECGFDPF  AR +FD+RF
Sbjct: 1   MILEYKYILIFLIIVLAVSMLVFYLGWALMFKVSYEDKLMGYECGFDPFGQARDEFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLEI FLFP++V     T++ +  M++FLGIL +G  YE KKGAL+W
Sbjct: 61  YLVAILFLIFDLEITFLFPFSVSLISNTYISYNFMLLFLGILGIGLFYELKKGALDW 117


>gi|57639691|gb|AAW55692.1| NADH dehydrogenase subunit 3 [Eichhornia crassipes]
          Length = 116

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (67%), Gaps = 1/111 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DPF DAR +FDIRF  V
Sbjct: 2   FAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPFGDARSRFDIRFYPV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           S+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 62  SILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 112


>gi|324309723|gb|ADY18504.1| NADH dehydrogenase subunit 3 [Phaeodactylum tricornutum]
          Length = 126

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 79/120 (65%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S +   Y  +L ++  A  + ++++   + +  ++PD EKLS YECGF+P++D R  FDI
Sbjct: 7   SSVKNEYLTLLFYLVFAVFLTVLIIGLSYFLVRQNPDSEKLSAYECGFEPYEDTRHVFDI 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +FC++ +LF+IFD+EI FL PW +   ++  LGF SM+ FL  L +GF Y W  GAL+WD
Sbjct: 67  KFCVIGILFLIFDIEIMFLVPWCISISKLDILGFWSMIDFLVELGIGFFYVWYVGALDWD 126


>gi|323149045|ref|YP_004222826.1| NADH dehydrogenase subunit 3 [Vigna radiata]
 gi|5305367|gb|AAD41617.1|AF071550_2 nad3 [Vigna radiata]
 gi|32731079|gb|AAP87104.1| NADH dehydrogenase subunit 3 [Pisum sativum subsp. elatius]
 gi|308206751|gb|ADO19888.1| NADH dehydrogenase subunit 3 [Vigna radiata]
          Length = 118

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++L+  PF  A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLILLGLPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|2143312|emb|CAA73769.1| NAD3 subunit of NADH dehydrogenase complex [Sorghum bicolor]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|62184446|ref|YP_220596.1| NADH dehydrogenase subunit 3 [Jenkinsia lamprotaenia]
 gi|58430867|dbj|BAD89209.1| NADH dehydrogenase subunit 3 [Jenkinsia lamprotaenia]
          Length = 116

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  MAIASA+ +VL+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIMAIASALSLVLIIVSFWLPLMTPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         +TW       + LG+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWASQLADPVLTVTWAA-----IVLGLLTLGLIYEWTQGGLEW 114


>gi|269958901|ref|YP_003328690.1| NADH dehydrogenase subunit A [Anaplasma centrale str. Israel]
 gi|269848732|gb|ACZ49376.1| NADH dehydrogenase subunit A [Anaplasma centrale str. Israel]
          Length = 126

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 80/119 (67%), Gaps = 3/119 (2%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y+ +L+F+ +A+ +  V  + P  +A +     KLS YECGFD  D A     FD++
Sbjct: 9   VGGYSSVLLFIVLAAMVSSVFAVLPAFLAKRRESVGKLSPYECGFDR-DGAPGSPSFDVK 67

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           FC++++LFV+FD+E+AFLFPWAV    I   GF SM+ F+G+L VGF+YEW  GALEW+
Sbjct: 68  FCVIAILFVVFDVEVAFLFPWAVCLGTIGAFGFWSMVCFVGLLAVGFVYEWGVGALEWE 126


>gi|57639701|gb|AAW55697.1| NADH dehydrogenase subunit 3 [Platanus occidentalis]
          Length = 111

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF LVS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|291285957|ref|YP_003502773.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883117|gb|ADD66817.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 117

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 77/116 (66%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI++F+ +AS + +++M +  I+  K  +  K S YECG  P D+ R + ++RF 
Sbjct: 1   MSGYLPIVLFLLVASTLGLIVMFAGAIIRPKKYEKVKFSVYECGMPPLDENRKRLNVRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  I   G   M++FL IL  G+ Y W+KGALEW
Sbjct: 61  IIAMLFVIFDVETVFLFPWAVAFDMIGLFGLIEMILFLVILVFGYFYAWQKGALEW 116


>gi|167627153|ref|YP_001677653.1| NADH dehydrogenase I subunit A [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667715|ref|ZP_04755293.1| NADH dehydrogenase I, A subunit [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876259|ref|ZP_05248969.1| NADH dehydrogenase I [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|167597154|gb|ABZ87152.1| NADH dehydrogenase I, A subunit [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254842280|gb|EET20694.1| NADH dehydrogenase I [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 132

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (63%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           +++   +APIL+F+ IA    +A  ++  I   IV   +P+  K  T+ECGF  F DAR 
Sbjct: 3   ANVYAEFAPILIFLIIAFGLGAAFAMIGKILSMIVGANNPNATKGETFECGFPTFGDARE 62

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIY 111
           K D+RF L++VLF++FDLE+AF+ PW +  K       I+   F +M++FL +L +G IY
Sbjct: 63  KLDVRFYLIAVLFLVFDLELAFIIPWGINLKASAGMPAISNHAFFAMIIFLVVLFLGLIY 122

Query: 112 EWKKGALEWD 121
            WKKGALEW+
Sbjct: 123 AWKKGALEWE 132


>gi|114151575|ref|YP_740363.1| NADH dehydrogenase subunit 3 [Zea perennis]
 gi|114151607|ref|YP_740442.1| NADH dehydrogenase subunit 3 [Zea luxurians]
 gi|114151641|ref|YP_740388.1| NADH dehydrogenase subunit 3 [Zea mays subsp. parviglumis]
 gi|115278613|ref|YP_762508.1| NADH dehydrogenase subunit 3 [Tripsacum dactyloides]
 gi|13914|emb|CAA32833.1| unnamed protein product [Zea mays]
 gi|12057071|emb|CAC19841.1| NADH dehydrogenase subunit 3 [Avena sativa]
 gi|93116049|gb|ABE98682.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|93116093|gb|ABE98725.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|93116140|gb|ABE98771.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|102567909|gb|ABF70826.1| NADH dehydrogenase subunit 3 [Zea perennis]
 gi|102567974|gb|ABF70858.1| NADH dehydrogenase subunit 3 [Zea mays subsp. parviglumis]
 gi|102579642|gb|ABF70922.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|110287603|gb|ABG65649.1| NADH dehydrogenase subunit 3 [Zea luxurians]
 gi|114432104|gb|ABI74653.1| NADH dehydrogenase subunit 3 [Tripsacum dactyloides]
 gi|164422235|gb|ABY55208.1| NADH dehydrogenase subunit 3-1 [Bambusa oldhamii]
 gi|164422236|gb|ABY55209.1| NADH dehydrogenase subunit 3-2 [Bambusa oldhamii]
 gi|291498631|gb|ADE08105.1| nad3 [Triticum aestivum]
          Length = 118

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|74325196|ref|YP_316616.1| NADH dehydrogenase subunit 3 [Thalassiosira pseudonana]
 gi|74100262|gb|AAZ99423.1| NADH dehydrogenase subunit 3 [Thalassiosira pseudonana]
          Length = 148

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 82/114 (71%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           + Y+ IL+F+ +A  + +V++   +I+A ++P+ EKLSTYECGF+P++DAR  FD++F L
Sbjct: 33  SEYSVILIFLFVAVLLSVVIVALSYILAVQNPETEKLSTYECGFEPYEDARHTFDVKFYL 92

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           V++LF++FD+E  FL PW     Q+  +GF SM+ F+  L +G+IY +  GAL+
Sbjct: 93  VAILFIVFDIETMFLIPWTNVLGQLDIVGFWSMIDFMFELGIGYIYIYCVGALD 146


>gi|197120287|ref|YP_002140714.1| NADH dehydrogenase I subunit A [Geobacter bemidjiensis Bem]
 gi|253702595|ref|YP_003023784.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M21]
 gi|223635402|sp|B5EFG3|NUOA2_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|197089647|gb|ACH40918.1| NADH dehydrogenase I, A subunit [Geobacter bemidjiensis Bem]
 gi|251777445|gb|ACT20026.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M21]
          Length = 118

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV + IA    +  +I   ++  K P   KL+ YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPILVLVVIAVLFGLGSVIFSSLIGQKKPSTVKLAPYECGCEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E  FL+PWAV FK++   G   M VF+ IL VG++Y WKKGALEW+
Sbjct: 61  YLIAMLFILFDIEAVFLYPWAVLFKRLGMFGLIEMGVFIVILFVGYVYVWKKGALEWE 118


>gi|6647615|sp|O99869|NU3M_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|4106840|gb|AAD03038.1| NADH dehydrogenase subunit 3 [Solanum tuberosum]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEK S YECG DP  DAR + DIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKSSAYECGLDPSGDARSRVDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|50261315|ref|YP_052924.1| NADH dehydrogenase subunit 3 [Saprolegnia ferax]
 gi|48237628|gb|AAT40677.1| NADH dehydrogenase subunit 3 [Saprolegnia ferax]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 78/116 (67%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           ++Y+ I +F+ I+  + I++    FI+  +  D EKL+ YECGF+P+DDAR  FD++F L
Sbjct: 3   SNYSIIFIFLLISLVLSIIIFTLSFILIQQKDDLEKLTAYECGFNPYDDARKVFDVKFYL 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++LF++FDLE  ++FPW +       LGF +M+ FL  L VGFIY W   ALEWD
Sbjct: 63  IALLFIVFDLEAVYVFPWVLTLSSNFSLGFWTMIEFLIELVVGFIYVWCSDALEWD 118


>gi|32731064|gb|AAP87103.1| NADH dehydrogenase subunit 3 [Pisum sativum subsp. abyssinicum]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 81/116 (69%), Gaps = 1/116 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++L+  PF  A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLILLGLPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LVS+LF+I D E+ F FPWAV   +I   G  S+M FL ILT+G +YEWK+GA +
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSIMAFLLILTIGSLYEWKRGASD 116


>gi|78224545|ref|YP_386292.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Geobacter
           metallireducens GS-15]
 gi|123570770|sp|Q39QA7|NUOA2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|78195800|gb|ABB33567.1| NADH dehydrogenase subunit A [Geobacter metallireducens GS-15]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV +AIA    +  ++   ++  K P   KL+ YECG +P   AR +F ++F
Sbjct: 1   MLGAYLPILVLVAIAVIFGLCSLVFSSLIGQKKPSVVKLAPYECGCEPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  FL+PW+V FK++   G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFLYPWSVLFKRLGMFGVMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|57013906|ref|YP_173379.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|57013994|ref|YP_173466.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|1563730|emb|CAA65517.1| NADH-ubiquinone oxidoreductase subunit 3 [Nicotiana sylvestris]
 gi|1563735|emb|CAA65514.1| NADH-ubiquinone oxidoreductase subunit 3 [Nicotiana sylvestris]
 gi|56806630|dbj|BAD83531.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLLPLGLPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|322421850|ref|YP_004201073.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M18]
 gi|320128237|gb|ADW15797.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M18]
          Length = 118

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV + IA    +  +I   ++  K P   KL+ YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPILVLVVIAVLFGMGSVIFSSLIGQKKPSQVKLAPYECGCEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E  FL+PWAV FK++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YMVAMLFILFDIEAVFLYPWAVLFKRLGMFGLVEMGLFIVILFVGYIYVWKKGALEWE 118


>gi|332883544|gb|EGK03827.1| hypothetical protein HMPREF9456_01894 [Dysgonomonas mossii DSM
           22836]
          Length = 122

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 80/121 (66%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  +  + PIL+ +A ++  V   +    ++        K + +ECG DP  DAR  F 
Sbjct: 1   MNSSIYDFIPILMQIAFSAIFVFATVFISKMLGPSRRSARKNANFECGLDPIGDARSPFP 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LFV+FD+EI F++PWAV FK+++W GFG M +F+GI+ VGF+YE K+ AL+W
Sbjct: 61  VKYFLVAILFVLFDIEIIFMYPWAVNFKELSWEGFGKMGIFIGIIVVGFLYEAKRKALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|284106846|ref|ZP_06386289.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830025|gb|EFC34301.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 123

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 76/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y PI VF  IA    +V +++ +IV    P   KL  YE G   F DARV+F +R+ ++
Sbjct: 9   NYIPIAVFAVIALGFGVVSLVAGWIVRPSRPYRAKLLPYESGSPLFMDARVQFPMRYYII 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+EI F+FPWAV F ++  LG   M VF+ IL VGF Y WKKGALEWD
Sbjct: 69  AMLFVVFDIEIVFMFPWAVVFHKLGLLGLIEMGVFIAILVVGFWYVWKKGALEWD 123


>gi|60117112|ref|YP_209575.1| NADH dehydrogenase subunit 3 [Polysphondylium pallidum]
 gi|51339676|gb|AAU00590.1| NADH dehydrogenase subunit 3 [Polysphondylium pallidum]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  IL+F+ +  A+  ++    + + FK    +KL  YECGFDPF  AR +FDIRF
Sbjct: 1   MILEYKYILIFLIVIIAVSALVFYLGWALMFKISYEDKLMGYECGFDPFGQARDEFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLEI FLFP++V     T++ +  M++FLGIL +G  YE KKGAL+W
Sbjct: 61  YLVAILFLIFDLEITFLFPFSVSLISNTFISYNFMLLFLGILGIGLFYELKKGALDW 117


>gi|94968315|ref|YP_590363.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550365|gb|ABF40289.1| NADH dehydrogenase subunit A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y PI +F+ +A  I    ++   +     P   KL  YECG DPFD +R ++ IRF +
Sbjct: 3   QNYVPIFIFLLVAFGIGAGTLMLFKLARPAKPSKVKLMPYECGIDPFDSSRQRYTIRFYI 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           V++LFV+FD+E  FLFPWAV FK +   G   M++FLGIL  G+ + WKKGALEW
Sbjct: 63  VAILFVVFDVETIFLFPWAVQFKALGVFGLVEMLLFLGILIAGYAWVWKKGALEW 117


>gi|229821709|ref|YP_002883235.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beutenbergia
           cavernae DSM 12333]
 gi|229567622|gb|ACQ81473.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beutenbergia
           cavernae DSM 12333]
          Length = 120

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 77/120 (64%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y PIL+ MAIA+ + I  + +  I+  K  +  KL  YECG  P   A    +F++
Sbjct: 1   MTNPYVPILIMMAIAAVMAIGGVATSMIIGPKRYNRAKLEAYECGVQPTPHAVGHGRFNV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           R+ LV++ F+IFD+E+ FL+PWAV F ++   G  +MM FL ++TV F+YEW++G L+WD
Sbjct: 61  RYYLVAMTFIIFDIEVVFLYPWAVAFTELAVFGLVAMMAFLFLITVPFVYEWRRGGLDWD 120


>gi|89257090|ref|YP_514452.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica LVS]
 gi|115315447|ref|YP_764170.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156503304|ref|YP_001429369.1| NADH dehydrogenase I, subunit A [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009482|ref|ZP_02274413.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254368965|ref|ZP_04984978.1| hypothetical protein FTAG_00795 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290952989|ref|ZP_06557610.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313809|ref|ZP_06804382.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144921|emb|CAJ80269.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica LVS]
 gi|115130346|gb|ABI83533.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156253907|gb|ABU62413.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157121886|gb|EDO66056.1| hypothetical protein FTAG_00795 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 132

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (63%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           + +   +APIL+F+ IA    +A  I+  +   IV   +P+  K  T+ECGF  F +AR 
Sbjct: 3   TSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGNARE 62

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIY 111
           KFD+RF L++VLF++FDLE+AF+ PW +  +       I+   F +M++FL +L +G IY
Sbjct: 63  KFDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIY 122

Query: 112 EWKKGALEWD 121
            WKKGALEW+
Sbjct: 123 AWKKGALEWE 132


>gi|57639703|gb|AAW55698.1| NADH dehydrogenase subunit 3 [Eschscholzia californica]
          Length = 110

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (66%), Gaps = 1/109 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF LVS+
Sbjct: 1   PICIYLVISPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYLVSI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 109


>gi|189095567|ref|YP_001936273.1| NADH dehydrogenase subunit 3 [Aphrocallistes vastus]
 gi|150024085|gb|ABR58846.1| NADH dehydrogenase subunit 3 [Aphrocallistes vastus]
          Length = 120

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 17  IASAIVIVLMISPFIVAFKS-PDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDL 75
           I   I  +++I+   +  K+ P  EKL+ YECGF+P +  R+ F I+F L+ +LF+IFDL
Sbjct: 15  IRRTIFTIVIITLSRITRKTLPSNEKLTIYECGFNPLETPRLPFSIKFFLIGILFLIFDL 74

Query: 76  EIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           EI+FLFPW      + W  F  M +FL ILT+GFIYEW K  LEW+
Sbjct: 75  EISFLFPWCTTMNSLKWTAFIRMTLFLSILTIGFIYEWIKKRLEWE 120


>gi|57639689|gb|AAW55691.1| NADH dehydrogenase subunit 3 [Calycanthus floridus]
          Length = 110

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 1/109 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++ +  PF  A  S   PEKLS YECG DP  DAR +FDIRF LV +
Sbjct: 1   PICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRFYLVPI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 109


>gi|1518353|emb|CAA89852.1| NADH dehydrogenase subunit 3 [Magnolia grandiflora]
 gi|1518356|emb|CAA89890.1| NADH dehydrogenase subunit 3 [Magnolia x soulangeana]
          Length = 118

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 77/118 (65%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             VS+LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA + +
Sbjct: 61  YPVSILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE 118


>gi|57639707|gb|AAW55700.1| NADH dehydrogenase subunit 3 [Nymphaea sp. Bergthorsson 0401]
          Length = 111

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF  A  S   P KLS +ECGFDP  DAR + DIRF  VS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPAKLSAHECGFDPSGDARSRSDIRFYPVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLFILTIGFLYEWKRGA 110


>gi|13177|emb|CAA36452.1| unnamed protein product [Oenothera berteroana]
          Length = 118

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API + + I+  + ++L++ PF+ +  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICISLVISPLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFFFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|57639693|gb|AAW55693.1| NADH dehydrogenase subunit 3 [Laurus nobilis]
          Length = 117

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFC 64
           + +API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF 
Sbjct: 1   SEFAPIFIYLVISPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  PVPILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|124358998|ref|YP_001023798.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ10101]
 gi|114177211|gb|ABI53764.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ10101]
          Length = 123

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (66%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           +    PD EK S YECGFDPF   R  F I+F LV +LF+IFD+EI+FLFPW++ F Q+ 
Sbjct: 34  IGLTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEISFLFPWSIVFNQLN 93

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
              F  +  FL +LT+G  YEW KG LEWD
Sbjct: 94  LFSFWIVYTFLIVLTIGLAYEWIKGGLEWD 123


>gi|56707211|ref|YP_169107.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669681|ref|YP_666238.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118498241|ref|YP_899291.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           novicida U112]
 gi|134301246|ref|YP_001121214.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187930988|ref|YP_001890972.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194324425|ref|ZP_03058198.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           novicida FTE]
 gi|208780268|ref|ZP_03247610.1| NADH-quinone oxidoreductase chain 7 [Francisella novicida FTG]
 gi|224456272|ref|ZP_03664745.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254371427|ref|ZP_04987428.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373582|ref|ZP_04989068.1| NADH dehydrogenase I [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254375049|ref|ZP_04990529.1| hypothetical protein FTDG_01237 [Francisella novicida GA99-3548]
 gi|254874049|ref|ZP_05246759.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|54114113|gb|AAV29690.1| NT02FT1736 [synthetic construct]
 gi|56603703|emb|CAG44664.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320014|emb|CAL08047.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118424147|gb|ABK90537.1| NADH dehydrogenase I, A subunit [Francisella novicida U112]
 gi|134049023|gb|ABO46094.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151569666|gb|EDN35320.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151571306|gb|EDN36960.1| NADH dehydrogenase I [Francisella novicida GA99-3549]
 gi|151572767|gb|EDN38421.1| hypothetical protein FTDG_01237 [Francisella novicida GA99-3548]
 gi|187711897|gb|ACD30194.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194321490|gb|EDX18975.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           novicida FTE]
 gi|208743917|gb|EDZ90219.1| NADH-quinone oxidoreductase chain 7 [Francisella novicida FTG]
 gi|254840048|gb|EET18484.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158319|gb|ADA77710.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           tularensis NE061598]
 gi|332184796|gb|AEE27050.1| NADH ubiquinone oxidoreductase chain A [Francisella cf. novicida
           3523]
 gi|332678977|gb|AEE88106.1| NADH ubiquinone oxidoreductase chain A [Francisella cf. novicida
           Fx1]
          Length = 132

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 82/130 (63%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIA----SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           + +   +APIL+F+ IA    +A  I+  +   IV   +P+  K  T+ECGF  F DAR 
Sbjct: 3   TSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGDARE 62

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIY 111
           K D+RF L++VLF++FDLE+AF+ PW +  +       I+   F +M++FL +L +G IY
Sbjct: 63  KLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIY 122

Query: 112 EWKKGALEWD 121
            WKKGALEW+
Sbjct: 123 AWKKGALEWE 132


>gi|238023159|ref|ZP_04603585.1| hypothetical protein GCWU000324_03085 [Kingella oralis ATCC 51147]
 gi|237865542|gb|EEP66682.1| hypothetical protein GCWU000324_03085 [Kingella oralis ATCC 51147]
          Length = 122

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 70/91 (76%), Gaps = 4/91 (4%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITW-- 92
           K    EK + +ECGF+ F++AR+KFD+R+ LV++LF++FDLE+AF+ PWAV +K +    
Sbjct: 32  KRHYAEKDAPFECGFEAFENARMKFDVRYYLVAILFILFDLEVAFMVPWAVVYKDLMHST 91

Query: 93  --LGFGSMMVFLGILTVGFIYEWKKGALEWD 121
               F SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 92  GAYAFWSMLVFIVVLTVGFVYEWKKGALEWE 122


>gi|95928443|ref|ZP_01311191.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135714|gb|EAT17365.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Desulfuromonas acetoxidans DSM 684]
          Length = 118

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PILV + +A    +  +   F+   K P   KL+ YECG      AR +F ++F
Sbjct: 1   MLESYLPILVLITVALLFALGSVTFSFLFGPKKPSAVKLAPYECGMPLIGTARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E  FL+PWAV FK++   GF  M VF+ IL VG++Y WKKGALEW+
Sbjct: 61  YIVAMLFILFDIEAVFLYPWAVVFKRLGMFGFIEMGVFIVILLVGYVYVWKKGALEWE 118


>gi|91203914|emb|CAJ71567.1| similar to to proton-translocating NADH dehydrogenase I chain A
           (NuoA) [Candidatus Kuenenia stuttgartiensis]
          Length = 117

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y PIL+   +A    +  +    I+  K P  EKL+ YECG +P   A  +F ++F 
Sbjct: 1   MIQYLPILILFFVALGFALTNVGISEILGRKKPSEEKLTPYECGVEPVGSAHERFSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LFV+FD+E+ F++PWAV FK +   GF  M++F+GIL + ++Y WK+G LEW+
Sbjct: 61  LIAMLFVVFDIEVIFMYPWAVAFKSLKLFGFIEMVIFIGILLICYLYIWKRGGLEWE 117


>gi|124112059|ref|YP_001019119.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chlorokybus
           atmophyticus]
 gi|223635365|sp|A2CI37|NU3C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|124012175|gb|ABM87957.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chlorokybus
           atmophyticus]
          Length = 120

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   LVF+ IA  I ++ + +  +V  K   PEK +TYE G +P  +A V+F+IR+
Sbjct: 3   ILKGYDSFLVFLIIACLIPVLALSASKLVRPKFGGPEKYTTYESGIEPMGEAWVQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F Q+ ++ F   +VFL IL VG +Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVSFAQMGFISFLEALVFLSILIVGLVYAWRKGALEWS 120


>gi|301353211|ref|YP_003795208.1| NADH dehydrogenase subunit 3 [Proteromonas lacertae]
 gi|301353239|ref|YP_003795236.1| NADH dehydrogenase subunit 3 [Proteromonas lacertae]
 gi|290573159|gb|ADD46346.1| NADH dehydrogenase subunit 3 [Proteromonas lacertae]
 gi|290573187|gb|ADD46374.1| NADH dehydrogenase subunit 3 [Proteromonas lacertae]
          Length = 121

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +  ++  + +++  +  + I++  + +++A + P+  K++ YECGFDPF D+R  F+
Sbjct: 1   MNFVYYNFFALFIYLVASLILSIIIFGASYVLATQQPEINKVAAYECGFDPFGDSRESFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           I++ LV++LF+IFDLEI+FLFPWA+ F  +T  G   ++++L I+T+GF YEW+KGALEW
Sbjct: 61  IQYYLVAILFIIFDLEISFLFPWAISFDVLTDFGLFIVIIYLIIITIGFFYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|229328250|ref|YP_002860263.1| NADH dehydrogenase subunit 3 [Megaceros aenigmaticus]
 gi|186695219|gb|ACC86786.1| NADH dehydrogenase subunit 3 [Nothoceros aenigmaticus]
          Length = 118

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 2/116 (1%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFCL 65
           + PI V++ I+S + ++L+    + AF S    PEKLS +ECG DP DDAR +FDIR  L
Sbjct: 3   FVPICVYLVISSLLPLILIGVSLLFAFPSSSAYPEKLSAHECGSDPSDDARSRFDIRLYL 62

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V    +I D E+   FPWAV   +I   G  SMMVF  I T+GF+YEWKKGA +W+
Sbjct: 63  VLTSSIISDSEVTSSFPWAVPPNKIGLFGSWSMMVFSLISTIGFVYEWKKGASDWE 118


>gi|124359024|ref|YP_001023821.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ2423]
 gi|114177237|gb|ABI53788.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ2423]
          Length = 123

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (66%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           + F  PD EK S YECGFDPF   R  F I+F LV +LF+IFD+E++FLFPW++ F Q+ 
Sbjct: 34  IGFTKPDSEKSSIYECGFDPFGKIRTPFAIKFVLVGILFMIFDIEVSFLFPWSIVFNQLN 93

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
              F  +  FL IL +G  YEW KG LEWD
Sbjct: 94  LFSFWVVYTFLVILALGLAYEWLKGGLEWD 123


>gi|11466326|ref|NP_051154.1| NADH dehydrogenase subunit 3 [Cafeteria roenbergensis]
 gi|6180108|gb|AAF05805.1|AF193903_28 NADH dehydrogenase subunit 3 [Cafeteria roenbergensis]
          Length = 125

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           Y  + +F+ ++ A+  VL I   ++A   P  EK++ YECGF+PF DAR K DIRF +V+
Sbjct: 13  YQKMFLFICLSFALSCVLFIVSLLLASHDPYYEKMTAYECGFEPFQDARHKVDIRFYIVA 72

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF+IFD+E+ FL PW V F  +    F  M+ FL IL +GF YE  KGAL+W
Sbjct: 73  ILFIIFDIEVVFLMPWLVNFVYLGTQTFWLMIFFLAILALGFAYEIVKGALDW 125


>gi|34501321|gb|AAP73640.1| NADH dehydrogenase subunit 4 [Nectarinia balfouri]
          Length = 116

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++  + IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMIALSLTLSIVLTLLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  IT L   S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQTPITTLALASSLIFL--LTLGLIYEWIQGGLEW 114


>gi|148657098|ref|YP_001277303.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
 gi|223635483|sp|A5UXK0|NUOA_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|148569208|gb|ABQ91353.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
          Length = 118

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I VF   A    I+ + + + +  K P P KL TYECG +   D RV+F I++
Sbjct: 1   MLANYAFIGVFFIGAIIFPIIPLAAAYFLGPKRPTPIKLDTYECGLEAIGDIRVQFKIQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV + Q+    F +M +FL IL  G +YEWKKGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAYGQLGLFAFIAMAIFLIILIGGLVYEWKKGALEW 117


>gi|251773167|gb|EES53720.1| putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           ferrodiazotrophum]
          Length = 123

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 77/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y PIL+F+ IA     V ++   ++   +P  +K + YECG  P +DAR +  IR+ ++
Sbjct: 9   HYIPILIFLLIAIGFGAVSLLVGRLIRPNNPYRDKDAPYECGVPPINDARERISIRYYVI 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF++FD+E+ FL+PWAV F+++   G   M++FL IL VG++Y WKK ALEW+
Sbjct: 69  AMLFLVFDVEVVFLYPWAVDFRRLGLFGLVEMLIFLVILIVGYVYAWKKEALEWE 123


>gi|57639695|gb|AAW55694.1| NADH dehydrogenase subunit 3 [Liriodendron tulipifera]
          Length = 111

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF  VS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYPVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|1518341|emb|CAA89848.1| NADH dehydrogenase subunit 3 [Allium cepa]
 gi|12584573|emb|CAA58989.1| NADH dehydrogenase subunit 3 [Allium cepa]
          Length = 118

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ ++  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVMSPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LV +LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVPILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|156742063|ref|YP_001432192.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
 gi|223635482|sp|A7NL04|NUOA_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|156233391|gb|ABU58174.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 118

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I VF   A    +V +++ + +  K P P KL TYECG +   D RV+F I++
Sbjct: 1   MLADYAFIGVFFIGAVIFPLVPLVAAYFLGPKRPTPIKLDTYECGLEAVGDIRVQFKIQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV + QI      +M +FL IL  G +YEWKKGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAYGQIGLFALIAMAIFLVILVGGLVYEWKKGALEW 117


>gi|254525437|ref|ZP_05137489.1| NAD(P)H-quinone oxidoreductase chain 3 [Prochlorococcus marinus
           str. MIT 9202]
 gi|221536861|gb|EEE39314.1| NAD(P)H-quinone oxidoreductase chain 3 [Prochlorococcus marinus
           str. MIT 9202]
          Length = 120

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K  + E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRNGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|283795066|ref|YP_003359482.1| NADH dehydrogenase subunit 3 [Synedra acus]
 gi|261279722|gb|ACX62030.1| NADH dehydrogenase subunit 3 [Synedra acus]
          Length = 128

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 77/111 (69%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + V + ++  + IV+ +  +++A ++P+ EK+S YECGF+P++ AR KFD++F + ++LF
Sbjct: 18  VFVHLIVSLLLSIVIFVFSYVLAIQNPETEKMSVYECGFEPYEGARKKFDVKFYVFAMLF 77

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           VIFD+E  FL PW++   +I ++GF  M+ FL  L+VGF Y W  G L W+
Sbjct: 78  VIFDIETMFLIPWSITLSKINFIGFWVMIDFLFELSVGFFYLWAAGGLNWE 128


>gi|301322963|gb|ADK70253.1| NADH dehydrogenase subunit 3 [Epinecrophylla spodionota]
          Length = 116

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 78/113 (69%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +  +++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSYIIIFL--LTLGLVYEWTQGGLEW 114


>gi|317130744|ref|YP_004097026.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475692|gb|ADU32295.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           cellulosilyticus DSM 2522]
          Length = 123

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 75/115 (65%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y  +L+FM +  A+ +V +    ++   +P  +KL TYE G +P  DA+V++ + + +V
Sbjct: 9   NYIYVLIFMVLGVALPVVALTFGRLLRPNNPYSKKLQTYESGIEPTGDAQVRYHVAYYIV 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ FVIFD+E  FL+PWAV   Q+ W+G  +M++F+ IL +G  Y WKK  LEW+
Sbjct: 69  ALEFVIFDIETVFLYPWAVALGQLGWVGLNAMLIFIAILGLGLAYSWKKKVLEWN 123


>gi|323481959|ref|YP_004237302.1| NADH dehydrogenase subunit 3 [Lophelia pertusa]
 gi|323461312|emb|CBZ41200.1| NADH dehydrogenase subunit 3 [Lophelia pertusa]
          Length = 114

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (63%)

Query: 14  FMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIF 73
           F+ IA  +  V     F +  K PD EK+S YECGF PF      F +RF L+ +LF+IF
Sbjct: 7   FVLIAVVLAGVFSSISFFIGEKRPDREKVSAYECGFVPFSFLGRPFSVRFFLIGILFLIF 66

Query: 74  DLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           DLEI+FLFPW V +  +   GF +M+ FL ILTVG +YEW KG LEW+
Sbjct: 67  DLEISFLFPWCVLYNSLGPFGFWAMVGFLFILTVGLVYEWLKGGLEWE 114


>gi|301322955|gb|ADK70249.1| NADH dehydrogenase subunit 3 [Thamnomanes schistogynus]
          Length = 116

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S+++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSSVIILL--LTLGLVYEWTQGGLEW 114


>gi|157412656|ref|YP_001483522.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9215]
 gi|223635399|sp|A8G2V5|NU3C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|157387231|gb|ABV49936.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9215]
          Length = 120

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL+ Y   L F+ IA+A+ I+ +++  IVA K  + E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLSGYEYFLGFLLIAAAVPILALVTNLIVAPKGRNGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|78778681|ref|YP_396793.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9312]
 gi|123554666|sp|Q31CN8|NU3C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78712180|gb|ABB49357.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9312]
          Length = 120

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|291280357|ref|YP_003497192.1| NADH-quinone oxidoreductase subunit A [Deferribacter desulfuricans
           SSM1]
 gi|290755059|dbj|BAI81436.1| NADH-quinone oxidoreductase, A subunit [Deferribacter desulfuricans
           SSM1]
          Length = 117

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI + + I++ I  + +    +V  K P+  KLS YECG   F DAR ++ ++F 
Sbjct: 1   MSPYLPIALMLIISALIGAITITVGVLVRPKKPEKVKLSVYECGMPEFSDARKRYSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  I   G   M++F+ IL  G+ Y W+KGALEW
Sbjct: 61  IIAMLFVIFDVETVFLFPWAVAFDMIGLFGLVEMIIFIIILVFGYFYAWRKGALEW 116


>gi|9695392|ref|NP_037614.1| NADH dehydrogenase subunit 3 [Phytophthora infestans]
 gi|6692645|gb|AAF24788.1|U17009_20 NADH dehydrogenase subunit 3 [Phytophthora infestans]
 gi|58012150|gb|AAW62558.1| NADH dehydrogenase subunit 3 [Phytophthora infestans]
 gi|58201989|gb|AAW67044.1| NADH dehydrogenase subunit 3 [Phytophthora infestans]
 gi|58202036|gb|AAW67090.1| NADH dehydrogenase subunit 3 [Phytophthora infestans]
          Length = 117

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y+ I +F+ ++  + I++ I  F +  +  D EKL+ YECGF+P+DDAR  FD++F
Sbjct: 1   MLLNYSNIFIFLVLSLFLSILIFILSFGLIKQKDDLEKLTAYECGFNPYDDARKVFDVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLE  F+FPW +        GF +M+ FL  L +GFIY W   ALEW
Sbjct: 61  YLVAILFIIFDLEAVFVFPWVLTLSSNFSWGFWTMIEFLVELVIGFIYIWCSDALEW 117


>gi|124359012|ref|YP_001023814.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ49]
 gi|327179839|ref|YP_004327736.1| NADH dehydrogenase subunit 3 [Placozoan sp. 'Shirahama']
 gi|114177225|gb|ABI53777.1| NADH dehydrogenase subunit 3 [Placozoan sp. BZ49]
 gi|298561258|dbj|BAJ09641.1| NADH dehydrogenase subunit 3 [Placozoan sp. 'Shirahama']
          Length = 123

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 59/90 (65%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           +    PD EK S YECGFDPF   R  F I+F LV +LF+IFD+EI+FLFPW++ F Q+ 
Sbjct: 34  IGLTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEISFLFPWSIVFNQLN 93

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
              F  +  FL +L +G  YEW KG LEWD
Sbjct: 94  LFSFWIVYTFLIVLAIGLAYEWIKGGLEWD 123


>gi|124515816|gb|EAY57325.1| putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           rubarum]
 gi|206602060|gb|EDZ38542.1| Putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           sp. Group II '5-way CG']
          Length = 123

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 76/116 (65%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PI +F+ +A     V +    ++  ++P  +K + YECG  P +DAR +F +R+ +
Sbjct: 8   EHYVPIFLFLLVAIGFGAVSLTVGRLIRPRNPYKDKNAPYECGVPPINDARERFSVRYYV 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++LF++FD+E+ FL+PWAV F ++   G   MM+F+ IL VG++Y WKK ALEW+
Sbjct: 68  IAMLFLVFDVEVVFLYPWAVDFGRLGLFGLVEMMIFIFILLVGYVYAWKKEALEWE 123


>gi|123967854|ref|YP_001008712.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. AS9601]
 gi|223635411|sp|A2BP94|NU3C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123197964|gb|ABM69605.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. AS9601]
          Length = 120

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|126695656|ref|YP_001090542.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9301]
 gi|223635394|sp|A3PB16|NU3C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|126542699|gb|ABO16941.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9301]
          Length = 120

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRAGERRLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|108860658|ref|YP_654087.1| NADH dehydrogenase subunit 3 [Trichoplax adhaerens]
 gi|94962397|gb|ABF48515.1| NADH dehydrogenase subunit 3 [Trichoplax adhaerens]
          Length = 123

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (66%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           +    PD EK S YECGFDPF   R  F I+F LV +LF+IFD+E++FLFPW++ F Q+ 
Sbjct: 34  IGSTRPDSEKSSIYECGFDPFGKIRTPFAIKFVLVGILFMIFDIEVSFLFPWSIVFNQLN 93

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
              F  +  FL IL++G  YEW KG LEWD
Sbjct: 94  LFSFWVVYTFLVILSLGLAYEWLKGGLEWD 123


>gi|298674245|ref|YP_003725995.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Methanohalobium evestigatum Z-7303]
 gi|298287233|gb|ADI73199.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methanohalobium evestigatum Z-7303]
          Length = 131

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S ++ SY P+ +F+ +   +  + M+   +++ +S   +K +TYE G DP  DAR++F++
Sbjct: 8   SSIINSYVPVAIFLIVGVVMPPITMLIVKLLSPRSKSKQKFTTYESGSDPTGDARIQFNV 67

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFK--QITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            + + ++ FV+FD+EI FL+PWA  ++   IT +   +++ F+ I+ +GFIYEWKKGAL+
Sbjct: 68  EYYIYAIAFVLFDVEILFLYPWATVYRGHGITSIATTAILAFIVIMVIGFIYEWKKGALQ 127

Query: 120 WD 121
           W 
Sbjct: 128 WS 129


>gi|88910855|gb|ABD58734.1| NADH dehydrogenase subunit 3 [Catharacta skua]
          Length = 116

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSLTLSIILTTLNFWLAQTNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV  +     +TW       V + +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLQSPSTTLTWAS-----VIIALLTLGLIYEWTQGGLEW 114


>gi|166895604|ref|YP_001661398.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
 gi|166706936|dbj|BAF98400.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
          Length = 118

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +API +++ I+S + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIR   V
Sbjct: 4   FAPIRIYLVISSLVPLIPLGVPFPFAPNSSTYPEKLSAHECGSDPSGDARSRFDIRSHPV 63

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + F+I D E+ F FP AV   +I   G  SMMVF  I T+G  +EWKKGA +W+
Sbjct: 64  PISFIISDPEVTFSFPRAVPPNKIDPFGSRSMMVFSLIPTIGSPHEWKKGASDWE 118


>gi|264669333|gb|ACY72127.1| NADH dehydrogenase subunit 3 [Hypsipetes mcclellandii]
 gi|293652689|gb|ADE61198.1| NADH dehydrogenase subunit 3 [Hypsipetes mcclellandii]
          Length = 116

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 75/109 (68%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IAMSLALSIILTMINFWLAQMAPDQEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV     IT L + S+++ +  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLNTPITTLAWASVLILM--LTLGLVYEWAQGGLEW 114


>gi|25057460|ref|NP_739640.1| NADH dehydrogenase subunit 3 [Carapus bermudensis]
 gi|25005503|dbj|BAC23171.1| NADH dehydrogenase subunit 3 [Carapus bermudensis]
          Length = 116

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%), Gaps = 11/117 (9%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P+++F++ A+A+ IVLM+  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PLVMFISTAAALSIVLMLVAFWLPVATPDSEKLSPYECGFDPLGSARLPFSLRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWA----VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA         +TW       + L +LT+G  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWADQAPSPLMTLTWTN-----IVLALLTLGLAYEWVQGGLEW 114


>gi|57639687|gb|AAW55690.1| NADH dehydrogenase subunit 3 [Agave attenuata]
          Length = 114

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 1/111 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +API +++ ++  + ++ +  PF  A  S   P+KLS +ECG DP  DAR +FDIRF  V
Sbjct: 3   FAPICIYLVMSPLVSLIPLGVPFPFASNSSTYPDKLSAHECGSDPSGDARSRFDIRFYPV 62

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           S+LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 63  SILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|39995447|ref|NP_951398.1| NADH dehydrogenase I subunit A [Geobacter sulfurreducens PCA]
 gi|81703478|sp|Q74GA8|NUOA1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|39982210|gb|AAR33671.1| NADH dehydrogenase I, A subunit [Geobacter sulfurreducens PCA]
 gi|298504446|gb|ADI83169.1| NADH dehydrogenase I, A subunit [Geobacter sulfurreducens KN400]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PI+V +A+A    +  +    ++  K P   KL+ YECG +P   AR +F ++F
Sbjct: 1   MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECGCEPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  F++PW+V FK++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFVGYIYVWKKGALEWE 118


>gi|122935337|gb|ABM68376.1| NADH dehydrogenase subunit 3 [Thamnomanes caesius]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++S++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LTLSSSLSIILTLLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  +T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLTTLTWSSAIILL--LTLGLVYEWTQGGLEW 107


>gi|113477003|ref|YP_723064.1| NADH dehydrogenase subunit A [Trichodesmium erythraeum IMS101]
 gi|123160441|sp|Q10YT3|NU3C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|110168051|gb|ABG52591.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Trichodesmium erythraeum IMS101]
          Length = 135

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 76/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+ Y   L F+ I+S + I+ + +  ++  K+  PE+ +TYE G +P   A ++F+IR+ 
Sbjct: 19  LSGYEYFLGFLMISSLVPIIALTASKLLRPKTRGPERRTTYESGVEPIGGAWIQFNIRYY 78

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 79  MFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALVYAWRKGALEWS 135


>gi|254796790|ref|YP_003081627.1| NADH dehydrogenase i, a subunit [Neorickettsia risticii str.
           Illinois]
 gi|254590038|gb|ACT69400.1| NADH dehydrogenase i, a subunit [Neorickettsia risticii str.
           Illinois]
          Length = 151

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  I +F  +A  I  V++I P  +A  S +  K  +YECGFD       +F++RF
Sbjct: 34  VMEGYIFIGLFFVVACFISCVMLILPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRF 93

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF++FDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 94  YLVGILFIVFDLEIIFLFPWAVSARELGPAAFVSVLIFLVILTVGFVYEFVSGALDW 150


>gi|164421165|ref|YP_001648649.1| NADH dehydrogenase subunit 3 [Hippospongia lachne]
 gi|158939007|gb|ABW83929.1| NADH dehydrogenase subunit 3 [Hippospongia lachne]
          Length = 116

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (67%)

Query: 20  AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAF 79
            I ++  +  +++  K P+ EK S YECGFDP++ AR+ F +RF LV +LF+IFDLE+ F
Sbjct: 15  GISLLAFVLSYLLVEKVPEQEKSSVYECGFDPYEIARIPFSVRFFLVGILFIIFDLEVVF 74

Query: 80  LFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LFPW V +  I  LG   + +FL IL VG +YEWK G L+W+
Sbjct: 75  LFPWGVIYIIIGGLGTWVVYLFLWILVVGLVYEWKVGGLDWE 116


>gi|112799179|gb|ABI22913.1| NADH dehydrogenase subunit 3 [Batis molitor]
          Length = 116

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  MA++  + I+L    F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMMALSLGLSIILTTLNFWLTQINPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  IT L + S ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQTPITTLAWASTLIFL--LTLGLVYEWFQGGLEW 114


>gi|200004083|ref|YP_002221533.1| NADH dehydrogenase subunit 3 [Hydra magnipapillata]
 gi|194578745|tpe|CAP49322.1| TPA: NADH dehydrogenase subunit 3 [Hydra vulgaris]
          Length = 115

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 74/111 (66%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + ++++I+  +  +++     ++FKSPD EK+S YECGF+PF      F IRF L+S+LF
Sbjct: 5   LFIYLSISFILSFIVLFFSIFLSFKSPDKEKVSIYECGFNPFHSTGQPFSIRFFLISILF 64

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++FDLEI +LFPW+V    I +     + +F+ IL +G +YEW +G LEW+
Sbjct: 65  LVFDLEIIYLFPWSVNSNLIDYYSQFIIYLFIMILVIGLVYEWLRGGLEWE 115


>gi|91069904|gb|ABE10833.1| putative NADH dehydrogenase complex I subunit chain 3 [uncultured
           Prochlorococcus marinus clone ASNC2150]
          Length = 120

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLNGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|159472440|ref|XP_001694359.1| NADH:ubiquinone oxidoreductase ND3 subunit [Chlamydomonas
           reinhardtii]
 gi|33943533|gb|AAQ55461.1| putative NADH dehydrogenase subunit 3 precursor [Chlamydomonas
           reinhardtii]
 gi|33943535|gb|AAQ55462.1| putative NADH:ubiquinone oxidoreductase subunit 3 precursor
           [Chlamydomonas reinhardtii]
 gi|158277022|gb|EDP02792.1| NADH:ubiquinone oxidoreductase ND3 subunit [Chlamydomonas
           reinhardtii]
          Length = 279

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 75/114 (65%), Gaps = 2/114 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           S+ P ++   IA+AI  V +++P ++A    D +K S YECGFD F +AR  F + F LV
Sbjct: 166 SFYPYVIATVIATAISTVFIVAPLVIAPSRVDLDKSSAYECGFDAFGEARQTFSVSFYLV 225

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           S+++++FD+EIA+LFP+A+    +    + +M +FL IL  GF YEW  GALEW
Sbjct: 226 SIMYLLFDIEIAYLFPYAMTHASLPM--YWTMNLFLAILVAGFAYEWGMGALEW 277


>gi|37928550|gb|AAP68817.1| NADH dehydrogenase subunit 3 [Nectarinia venusta]
          Length = 116

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++ A+ I L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITLSLALSIALTLLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  IT +   S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPITTMALASSLIFL--LTLGLIYEWIQGGLEW 114


>gi|21673596|ref|NP_661661.1| NADH dehydrogenase I, subunit 3 [Chlorobium tepidum TLS]
 gi|81791548|sp|Q8KEC3|NUOA_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|21646710|gb|AAM72003.1| NADH dehydrogenase I, subunit 3 [Chlorobium tepidum TLS]
          Length = 143

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V+   ++  ++    P+PEK STYECG      A VKF+
Sbjct: 1   MDQTLSGFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNPEKNSTYECGEHAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+       +++F+GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGAFALVEVLIFVGILVLGLVYAWVKGDLDW 120


>gi|84374214|gb|ABC58201.1| NADH dehydrogenase subunit 3 [Zosterops atricapillus atricapillus]
 gi|84374216|gb|ABC58202.1| NADH dehydrogenase subunit 3 [Zosterops atricapillus atricapillus]
 gi|220900416|gb|ACL82408.1| NADH dehydrogenase subunit 3 [Zosterops atricapilla]
          Length = 116

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   ITLSMTLSIVLTLLNFWIAQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  IT L + S ++FL  LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQNPITTLIWTSTLIFL--LTLGLIYEWAQGGLEW 114


>gi|148922790|ref|YP_001293808.1| NADH dehydrogenase subunit 3 [Spratelloides delicatulus]
 gi|148762682|dbj|BAF64121.1| NADH dehydrogenase subunit 3 [Spratelloides delicatulus]
          Length = 116

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  M IASA+ +VL+   F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIMLIASALSLVLIFVSFWLPLMSPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         ++W       + L ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWASQLPNPVLTVSWAA-----LVLAILTLGLVYEWLQGGLEW 114


>gi|37928524|gb|AAP68804.1| NADH dehydrogenase subunit 3 [Anthreptes fraseri]
          Length = 116

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++  + I L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMITLSLTLSIALTLLNFWLAQTSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L   S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTTTLTLASSLIFL--LTLGLIYEWIQGGLEW 114


>gi|37928534|gb|AAP68809.1| NADH dehydrogenase subunit 3 [Nectarinia bouvieri]
          Length = 116

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++ A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITLSLALSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  IT L   S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPITTLALASSIIFL--LTLGLIYEWIQGGLEW 114


>gi|154818309|ref|YP_001425533.1| NADH dehydrogenase subunit 3 [Paleosuchus trigonatus]
 gi|154425205|emb|CAM35779.1| NADH dehydrogenase subunit 3 [Paleosuchus trigonatus]
          Length = 115

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 75/112 (66%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+  ++AS    +L+IS  ++A  SPDPEKLS YECGFDP   AR+   IRF ++++LF
Sbjct: 3   LLIMFSMASITATILIISNLMMAETSPDPEKLSPYECGFDPLGSARLPLSIRFFMIAILF 62

Query: 71  VIFDLEIAFLFP--WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P  W+++    T     ++ +FL +L +G +YEW +G LEW
Sbjct: 63  LLFDLEIAILLPLAWSIHTLHPTKTIMCTIAIFL-LLFIGLMYEWLQGGLEW 113


>gi|45511364|gb|AAS67222.1| NADH dehydrogenase subunit 3 [Aimophila botterii]
          Length = 116

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSLALSILLTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      IT L + S ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLHSPITTLTWASALIFL--LTLGLVYEWIQGGLEW 114


>gi|164421195|ref|YP_001648692.1| NADH dehydrogenase subunit 3 [Vaceletia sp. GW948]
 gi|158939053|gb|ABW83972.1| NADH dehydrogenase subunit 3 [Vaceletia sp. GW948]
          Length = 116

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (67%)

Query: 20  AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAF 79
            I ++  +  +++  K P+ EK S YECGFDP++ AR+ F +RF LV +LF+IFDLE+ F
Sbjct: 15  GISLLAFVLSYLLVEKVPEQEKSSVYECGFDPYEIARIPFSVRFFLVGILFIIFDLEVVF 74

Query: 80  LFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LFPW + +  I  LG   + +FL IL VG +YEWK G L+W+
Sbjct: 75  LFPWGIVYIIIGGLGTWVVYLFLWILVVGLVYEWKVGGLDWE 116


>gi|87300571|ref|ZP_01083413.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 5701]
 gi|87284442|gb|EAQ76394.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 5701]
          Length = 120

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  +VA KS D E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKMVAPKSRDGERRLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFISILVVALAYAWRKGALEWS 120


>gi|224178042|ref|YP_002600946.1| subunit 3 of NADH-plastoquinone oxidoreductase [Pyramimonas
           parkeae]
 gi|215882709|gb|ACJ71082.1| subunit 3 of NADH-plastoquinone oxidoreductase [Pyramimonas
           parkeae]
          Length = 120

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  + +F  IA  + I+ + +  ++  +   PE+ +TYE G +P  +AR++F+IR+
Sbjct: 3   VLNEYTYVFLFFVIACLVPILALTTSKLLRPEGVGPERRTTYESGIEPMGEARIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + ++LFV+FD+E  FL+PW+V F+Q+    F   +VF+ IL +G +Y W+KGALEW 
Sbjct: 63  YMFALLFVLFDVETLFLYPWSVTFRQLGLSAFLEALVFVCILILGLVYAWRKGALEWS 120


>gi|301322983|gb|ADK70263.1| NADH dehydrogenase subunit 3 [Myrmotherula hauxwelli]
          Length = 116

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +   ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSFTIIFL--LTLGLMYEWTQGGLEW 114


>gi|148922720|ref|YP_001293821.1| NADH dehydrogenase subunit 3 [Spratelloides gracilis]
 gi|148762696|dbj|BAF64134.1| NADH dehydrogenase subunit 3 [Spratelloides gracilis]
          Length = 116

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  M IASA+ +VL++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIMLIASALSLVLIVVSFWLPLMTPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         ++W       + L ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWANQLPDPILTVSWAA-----LVLAILTLGLVYEWIQGGLEW 114


>gi|194333675|ref|YP_002015535.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Prosthecochloris aestuarii DSM 271]
 gi|223635472|sp|B4S751|NUOA_PROA2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|194311493|gb|ACF45888.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Prosthecochloris aestuarii DSM 271]
          Length = 138

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ + +  V+   ++  ++    P+PEKL+ YECG D    + VKF+
Sbjct: 1   MDQTLSDFGAVFVFLLLGTVFVVGGYLTARLLRPSRPNPEKLAVYECGEDAVGTSWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILIIGLAYAWVKGDLDW 120


>gi|49237495|gb|AAT58009.1| NADH dehydrogenase subunit 3 [Nectarinia chalybea]
          Length = 111

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + IVL    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSIVLTALNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  IT L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPITTLALASSLIFL--LTLGLIYEWVQGGLEW 109


>gi|62901776|gb|AAY18839.1| NADH dehydrogenase subunit 3 [Halcyon badia]
          Length = 116

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S  I I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLTLSLTISIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA      IT L + SM++ L  LT G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLNSPITTLTWTSMIILL--LTSGLIYEWLQGGLEW 114


>gi|159901491|ref|YP_001547738.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|223635467|sp|A9B477|NUOA_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|159894530|gb|ABX07610.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 118

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 78/118 (66%), Gaps = 2/118 (1%)

Query: 4   LLTSYAPILVF-MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +LT+YA I +F +A  +  ++ L++S F+     P P KLSTYECG +   D  V+F ++
Sbjct: 1   MLTNYAFIGIFALAAITFPLLPLVLSAFLRP-NRPTPVKLSTYECGLEAIGDIWVQFKVQ 59

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + L ++ FVIFD+E  FL+PWAV + Q+       M+VFL ILT+G +Y WKKGALEW
Sbjct: 60  YYLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEW 117


>gi|109156469|ref|YP_654364.1| NADH dehydrogenase subunit 3 [Mussa angulosa]
 gi|109156497|ref|YP_654351.1| NADH dehydrogenase subunit 3 [Colpophyllia natans]
 gi|108744102|gb|ABG02325.1| NADH dehydrogenase subunit 3 [Colpophyllia natans]
 gi|108744116|gb|ABG02338.1| NADH dehydrogenase subunit 3 [Mussa angulosa]
          Length = 113

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 68/109 (62%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           VF  +A  +  +  I  F +  K PD EK+S YECGF PF      F IRF L+ +LF+I
Sbjct: 5   VFCFLAIVLAGLFSIVSFFLGEKVPDREKVSAYECGFVPFSFLGRPFSIRFFLIGILFLI 64

Query: 73  FDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           FDLEI+F FPW V +  I   GF +M+ F  ILT+G +YEW KG LEW+
Sbjct: 65  FDLEISFFFPWCVLYNSIAPFGFWTMVGFFFILTLGLVYEWLKGGLEWE 113


>gi|23428672|gb|AAM00148.1| NADH dehydrogenase subunit 3 [Xiphorhynchus spixii juruanus]
          Length = 116

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++ ++ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSMSLSIVLTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLSTLTWTSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|773393|emb|CAA60117.1| NADH dehydrogenase subunit 3 [Pinus sylvestris]
          Length = 118

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 74/118 (62%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+S + ++ +  PF  A   S  PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISSLVCLIPLGVPFPFAPNGSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             V + F+I D E+ F  P AV   +I   G  SMMVF  I T+GF +EWKKGA + +
Sbjct: 61  YPVPISFIISDPEVTFSSPRAVPLNKIDPFGSRSMMVFSLISTIGFPHEWKKGASDRE 118


>gi|28202177|ref|NP_777418.1| NADH dehydrogenase subunit 3 [Anthoceros formosae]
 gi|29337180|sp|Q31792|NU3C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|27807879|dbj|BAC55354.1| NADH dehydrogenase ND3 subunit [Anthoceros formosae]
 gi|27808005|dbj|BAC55449.1| NADH dehydrogenase ND3 subunit [Anthoceros formosae]
          Length = 120

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L++ Y    +F+ IAS I  +      ++A  S  PEK ++YECG +P  DA ++F IR+
Sbjct: 3   LVSKYNYFWIFLLIASLIPTIAFSISRVIAPISKGPEKFTSYECGIEPMGDAWIQFQIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWA+ FKQ+    F  + +F+ IL +G IY W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAMSFKQLGIPAFIEVFIFVFILIIGLIYAWRKGALEWS 120


>gi|110598467|ref|ZP_01386738.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           ferrooxidans DSM 13031]
 gi|110339917|gb|EAT58421.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           ferrooxidans DSM 13031]
          Length = 143

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  + VF+A+    V    ++  ++  + P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSNFGNVFVFLALGIVFVAGGFLTARMLRPQRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        ++F GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALVEALLFAGILVLGLVYAWVKGDLDW 120


>gi|34501410|ref|NP_904197.1| NADH dehydrogenase subunit 3 [Physcomitrella patens subsp. patens]
 gi|75294074|sp|Q6YXR0|NU3C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|34494780|dbj|BAC85047.1| NADH dehydrogenase ND3 subunit [Physcomitrella patens subsp.
           patens]
          Length = 121

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAI-VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           LL  Y    +F+ +AS I ++   IS F+    +  PEKL++YE G +P  DA ++F IR
Sbjct: 3   LLPKYNSFFIFLLLASVIPILAFSISKFLAPNNTQGPEKLTSYESGIEPMGDAWIQFQIR 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + +++FVIFD+E  FL+PWA+ F  +    F   +VF+ IL +G +Y W+KGALEW 
Sbjct: 63  YYMFALVFVIFDVETVFLYPWAMSFNDLGLSAFIEALVFVFILIIGLVYAWRKGALEWS 121


>gi|148922650|ref|YP_001293704.1| NADH dehydrogenase subunit 3 [Dorosoma petenense]
 gi|148762570|dbj|BAF64017.1| NADH dehydrogenase subunit 3 [Dorosoma petenense]
          Length = 116

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AIAS + I+L+I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILAIASLLSIILVIVSFWLPQMSPDSEKLSPYECGFDPRGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVY----FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      F  + W         + +LT+G IYEW +GALEW
Sbjct: 64  LLFDLEIALLLPLPWASQLSNPFTSVLWAA-----AIIMLLTLGLIYEWTQGALEW 114


>gi|215399175|ref|YP_002332303.1| NADH dehydrogenase subunit 3 [Podarcis siculus]
 gi|62900875|gb|AAY18763.1| NADH dehydrogenase subunit 3 [Podarcis siculus]
 gi|213983310|gb|ACJ54992.1| NADH dehydrogenase subunit 3 [Podarcis siculus]
          Length = 115

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++ + IA+ I ++LM+  F +    PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 3   LMLMLIIATLISLILMLVSFWLPHMLPDMEKLSPYECGFDPLGSARLPFSIRFFLVAILF 62

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+   Q  T + + SM++ L  LT G IYEW +G L+W
Sbjct: 63  LLFDLEIALLLPTPWAINLSQPSTTMMWTSMIIML--LTAGLIYEWTQGGLDW 113


>gi|309380504|gb|ADO66099.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 76/116 (65%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLVTPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        ITW    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTITW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|31282833|gb|AAP15264.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282835|gb|AAP15265.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
          Length = 116

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 72/113 (63%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVVFMLTLSLTLSIILTALNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L        + ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPT-LTLAWTSALITILTLGLVYEWIQGGLEW 114


>gi|38639890|ref|NP_943611.1| NADH dehydrogenase subunit 3 [Erpetoichthys calabaricus]
 gi|38304765|gb|AAR16110.1| NADH dehydrogenase subunit 3 [Erpetoichthys calabaricus]
          Length = 115

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 4/113 (3%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PIL  + I+S I I L+   F +   +PD EKLS YECGFDP   AR+ F +RF L+++L
Sbjct: 3   PILTMILISSLISITLVFVAFWLPQMNPDMEKLSPYECGFDPLGSARLPFSMRFFLIAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW+++   +  L +  M++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWSIHLNPLYVLMWAFMIIML--LTIGLIYEWVQGGLEW 113


>gi|197935714|ref|YP_002213658.1| NADH dehydrogenase subunit 3 [Chelydra serpentina]
 gi|78157488|gb|ABB22862.1| NADH dehydrogenase subunit 3 [Chelydra serpentina]
 gi|197791008|gb|ABK81685.2| NADH dehydrogenase subunit 3 [Chelydra serpentina]
          Length = 116

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M IA  + I+LM+  + +    PD EKLS YECGFDP + A + F IRF LV++LF++FD
Sbjct: 8   MTIALTLSIILMLLNYWLTLMKPDNEKLSPYECGFDPLESAHLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV     T   F   ++ L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLPHPT-HTFLWALIILFLLTLGLIYEWVQGGLEW 114


>gi|313672277|ref|YP_004050388.1| NADH dehydrogenase subunit a [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939033|gb|ADR18225.1| NADH dehydrogenase subunit A [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 117

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 77/116 (66%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI + + +A+ I I+ +   F++  + P+  KLS YECG   F DAR ++++RF 
Sbjct: 1   MSGYLPIALMLVVAALIGIISVSVGFLIRPRKPEKVKLSVYECGMPEFSDARQRYNVRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  +   G   M++F+ IL  G+ Y WKKGALEW
Sbjct: 61  VIAMLFVIFDVETVFLFPWAVSFDVLGLFGLIEMIIFIIILVFGYFYAWKKGALEW 116


>gi|23598310|gb|AAN35040.1| NADH dehydrogenase subunit 3 [Empidonax oberholseri]
          Length = 116

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ I+L      +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFTLSSSLSIILTTLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + + M+FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQCPLTTLLWATTMLFL--LTLGLVYEWSQGGLEW 114


>gi|13561082|emb|CAC36263.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561114|emb|CAC36257.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|260841975|gb|ACX51048.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380498|gb|ADO66096.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380506|gb|ADO66100.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380508|gb|ADO66101.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380510|gb|ADO66102.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 76/116 (65%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        ITW    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTITW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|12584570|emb|CAA58912.1| NADH dehydrogenase subunit 3 [Magnolia grandiflora]
          Length = 118

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API + + I+  + ++L++ PF+ +  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICISLVISPLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
             VS+LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA +
Sbjct: 61  YPVSILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASD 116


>gi|55140264|gb|AAV41691.1| NADH dehydrogenase subunit 3 [Nectarinia olivacea]
          Length = 116

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ IVL +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMITLSLILSIVLTLVNFWLAQMSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L   + ++FL  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLTLAASLIFL--LTLGLIYEWIQGGLEW 114


>gi|189500539|ref|YP_001960009.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           phaeobacteroides BS1]
 gi|223635437|sp|B3EKA1|NUOA_CHLPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189495980|gb|ACE04528.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           phaeobacteroides BS1]
          Length = 142

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V+   ++  ++    P+PEKL+ YECG +    A VKF+
Sbjct: 1   MDQTLSDFGTVFVFLLLGIIFVVGGYLTARLLRPSRPNPEKLAIYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILVIGLVYAWVKGDLDW 120


>gi|299825740|ref|YP_003734670.1| NADH dehydrogenase subunit 3 [Anchoviella sp. LBP 2297]
 gi|299758147|dbj|BAJ09841.1| NADH dehydrogenase subunit 3 [Anchoviella sp. LBP 2297]
          Length = 116

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA+A+ +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILAIATALSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW     +    + W     +M  +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLEPKTTLIW-----VMAVIGLLTLGLIYEWLQGGLEW 114


>gi|264669327|gb|ACY72124.1| NADH dehydrogenase subunit 3 [Ixos everetti catarmanensis]
          Length = 116

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S A+ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTTSLALSIVLTMLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     I  L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPIATLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|213136285|gb|ACJ43824.1| NADH dehydrogenase subunit 3 [Pleurodeles waltl]
          Length = 114

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL+ + I +A+ I+L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ILLMILITTALSILLITISFWLPLNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  + + ++++ L  LTVG IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLLPMNTMVWSTIILLL--LTVGLIYEWIQGGLEW 113


>gi|163847547|ref|YP_001635591.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aurantiacus J-10-fl]
 gi|222525397|ref|YP_002569868.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus sp. Y-400-fl]
 gi|223635434|sp|A9WEE0|NUOA_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|163668836|gb|ABY35202.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449276|gb|ACM53542.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           sp. Y-400-fl]
          Length = 118

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I +F+  A +  ++ ++  F +  K P P K STYECG +   D  V+F +++
Sbjct: 1   MLANYALIGIFLVAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F  +   G  +  +FL +L  G +YEW+KGALEW
Sbjct: 61  YLYALAFVIFDIEVIFLYPWAVAFNAVGLYGLIAATIFLLMLFAGLLYEWRKGALEW 117


>gi|83031257|gb|ABB96807.1| NADH dehydrogenase subunit 3 [Myiarchus swainsoni]
          Length = 116

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (67%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S ++  +L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMFILSLSLSTILTMLNLWLAQTTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  +T L + S M+FL  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPLTTLTWASTMLFL--LTLGLVYEWSQGGLEW 114


>gi|302842767|ref|XP_002952926.1| NADH:ubiquinone oxidoreductase ND3 subunit [Volvox carteri f.
           nagariensis]
 gi|300261637|gb|EFJ45848.1| NADH:ubiquinone oxidoreductase ND3 subunit [Volvox carteri f.
           nagariensis]
          Length = 271

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 74/114 (64%), Gaps = 2/114 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           S+ P ++  AI++ I  V ++ P +VA    D +K S YECGFD F +AR  F + F LV
Sbjct: 158 SFYPYVIATAISTVIATVFIVVPLVVAPSRVDLDKSSAYECGFDAFGEARQTFSVSFYLV 217

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           S+++++FD+EIA+LFP+A+    +    + +M +FL IL  GF YEW  GALEW
Sbjct: 218 SIMYLLFDIEIAYLFPYAMSHASLPM--YWTMNLFLAILVAGFAYEWGMGALEW 269


>gi|109156553|ref|YP_654338.1| NADH dehydrogenase subunit 3 [Astrangia sp. JVK-2006]
 gi|108744088|gb|ABG02312.1| NADH dehydrogenase subunit 3 [Astrangia sp. JVK-2006]
          Length = 113

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 68/109 (62%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           VF  +A  +  +  I  F +  K PD EK+S YECGF PF      F IRF L+ +LF+I
Sbjct: 5   VFCFLAIVLAGLFSIVSFFLGEKVPDREKVSAYECGFVPFSFLGRPFSIRFFLIGILFLI 64

Query: 73  FDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           FDLEI+F FPW V +  I   GF +M+ F  +LT+G +YEW KG LEW+
Sbjct: 65  FDLEISFFFPWCVLYNSIAPFGFWTMVGFFFVLTLGLVYEWLKGGLEWE 113


>gi|23598278|gb|AAN35024.1| NADH dehydrogenase subunit 3 [Empidonax affinis pulverius]
 gi|23598312|gb|AAN35041.1| NADH dehydrogenase subunit 3 [Empidonax oberholseri]
          Length = 116

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ I+L      +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFTLSSSLSIILTTLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + + M+FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQCPLTTLLWATAMLFL--LTLGLVYEWSQGGLEW 114


>gi|51572546|gb|AAU07773.1| NADH dehydrogenase subunit 3 [Hypsipetes borbonicus]
 gi|51572548|gb|AAU07774.1| NADH dehydrogenase subunit 3 [Hypsipetes borbonicus]
          Length = 116

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLAASLALSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|122935383|gb|ABM68399.1| NADH dehydrogenase subunit 3 [Thamnophilus divisorius]
          Length = 109

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 75/109 (68%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LALSSSLSIILTLLNFWLAQTNPNLEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  +T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLTTLTWSSAIILL--LTLGLVYEWIQGGLEW 107


>gi|84488628|ref|YP_448823.1| NADH dehydrogenase subunit 3 [Psammobates pardalis]
 gi|67005641|gb|AAY62438.1| NADH dehydrogenase subunit 3 [Psammobates pardalis]
          Length = 116

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I+ A+  +L++  + +    PD EKLS YECGFDP + AR+ F IRF LV++LF++FD
Sbjct: 8   MIISLALSTILIMLNYWLTLMKPDNEKLSPYECGFDPLESARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+     T   F   +  L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLPHPT-HSFTWALTILSLLTLGLIYEWIQGGLEW 114


>gi|159899598|ref|YP_001545845.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892637|gb|ABX05717.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 129

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 70/118 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  + PI +   +   I +  ++   I+  K     KL  YE G  P  DA  +  +RF
Sbjct: 12  MLRPFLPIFIIFVVGVVIPVAALVLSAILGPKKATKRKLIPYESGMTPLGDAMQRMPVRF 71

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+EI FL P+A+YF+Q+   G   M  F+GIL VGF+Y W+KGAL WD
Sbjct: 72  YVVAMLFILFDIEIIFLMPYALYFRQMGLFGLAEMGAFMGILLVGFVYIWRKGALRWD 129


>gi|240266590|ref|YP_002970961.1| NADH dehydrogenase subunit 3 [Limnonectes bannaensis]
 gi|58220740|gb|AAW67999.1| NADH dehydrogenase subunit 3 [Limnonectes bannaensis]
          Length = 113

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F++IA  +VIVL    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLIFVSIAVLLVIVLATISFWLPMINPDTEKLSPYECGFDPQGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITW-LGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA  F   T  + + S ++FL  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWATQFSNPTLTILWSSTILFL--LTIGFIYEWFQGGLEW 111


>gi|220900468|gb|ACL82434.1| NADH dehydrogenase subunit 3 [Zosterops fuscicapilla]
          Length = 116

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   ITLSMTLSIILTLLNFWIAQMSPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQNPTTTLIWASTLIFL--LTLGLMYEWTQGGLEW 114


>gi|84374172|gb|ABC58180.1| NADH dehydrogenase subunit 3 [Zosterops maderaspatanus comorensis]
 gi|84374174|gb|ABC58181.1| NADH dehydrogenase subunit 3 [Zosterops maderaspatanus comorensis]
 gi|84374176|gb|ABC58182.1| NADH dehydrogenase subunit 3 [Zosterops maderaspatanus comorensis]
          Length = 116

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I+L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMITLSMILSIILTLLNFWIAQMSPDAEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQNPTTTLIWASTLIFL--LTLGLMYEWMQGGLEW 114


>gi|23428704|gb|AAM00164.1| NADH dehydrogenase subunit 3 [Xiphorhynchus spixii elegans]
          Length = 116

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ ++ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSMSLSIVLTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPLSTLTWTSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|293652709|gb|ADE61208.1| NADH dehydrogenase subunit 3 [Ixonotus guttatus]
          Length = 116

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIALTALNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++ L  LT G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQTPSTTLAWASTLILL--LTAGLVYEWTQGGLEW 114


>gi|296130551|ref|YP_003637801.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           flavigena DSM 20109]
 gi|296022366|gb|ADG75602.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           flavigena DSM 20109]
          Length = 120

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 75/118 (63%), Gaps = 2/118 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIRF 63
             Y P+LV + IA+ + +  + +  I+  K  +  KL  YECG +P   A    +F I++
Sbjct: 3   NPYVPLLVMIGIAAVLALGGVGASAILGPKRYNRAKLEAYECGIEPTPHAIGGGRFPIKY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++ F++FD+E+ FL+PWAV F ++   G  +MMVFL I+TV F YEWK+G LEWD
Sbjct: 63  YLVAMTFIVFDIEVVFLYPWAVGFAELATFGLVAMMVFLLIITVPFAYEWKRGGLEWD 120


>gi|148657778|ref|YP_001277983.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
 gi|148569888|gb|ABQ92033.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
          Length = 118

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL    +A  I + +++    +  + P+  KL  YE G +P   A+ +F I+F
Sbjct: 1   MLIDYLPILTLFLVAMFIAVFVIVLSRYLGPQRPNRRKLMPYESGMEPIGPAQRRFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+EI FLFP+A+ ++Q+   G  +M VF  +L +G IYEW++GAL W+
Sbjct: 61  NLVAMLFILFDIEIIFLFPYALVYRQLGIPGLAAMGVFFVVLVIGLIYEWRRGALRWE 118


>gi|194476961|ref|YP_002049140.1| NADH dehydrogenase alpha subunit [Paulinella chromatophora]
 gi|223635371|sp|B1X4R1|NU3C_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3, organellar
           chromatophore; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|171191968|gb|ACB42930.1| NADH dehydrogenase alpha subunit [Paulinella chromatophora]
          Length = 120

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  I+A KS + E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIATAVPVLALLTNKILAPKSRNGERELTYESGMEPVGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|256576284|gb|ACU87921.1| NADH dehydrogenase subunit 3 [Dicrurus hottentottus]
          Length = 116

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S  + +L+ +  F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMLIMSLTLSILLTALNFWLAQANPDPEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITW-LGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T  L + S++V +  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAMQLQSPTLTLMWASIIVVM--LTLGLIYEWAQGGLEW 114


>gi|193212958|ref|YP_001998911.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobaculum
           parvum NCIB 8327]
 gi|223635436|sp|B3QP58|NUOA_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|193086435|gb|ACF11711.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobaculum
           parvum NCIB 8327]
          Length = 144

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  + VF+ +    V+   ++  ++    P+ EKLSTYECG      A VKF+
Sbjct: 1   MDQTLSNFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNEEKLSTYECGEPAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+       +++F GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGMFALVEVLIFAGILVLGLVYAWVKGDLDW 120


>gi|89212930|gb|ABD63935.1| NADH dehydrogenase subunit 3 [Xanthomixis cinereiceps]
          Length = 116

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++  + I+L    + +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITMSLTLSIILTALNYWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPIPWATQLQNPTTTLTWASTLIFL--LTLGLIYEWTQGGLEW 114


>gi|11467815|ref|NP_050866.1| NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
 gi|17433147|sp|Q9TKX9|NU3C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|5880744|gb|AAD54837.1|AF137379_60 subunit 3 of NADH-plastoquinoneoxidoreductase [Nephroselmis
           olivacea]
          Length = 120

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F  IAS I ++ + +  ++  +   PE+ +TYE G +P  +A ++F+IR+
Sbjct: 3   ILEGYGSVLAFFVIASLIPVIALSASKLLRPRGGGPERRTTYESGIEPMGEAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F+++    F  +++F+ +L +G +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETLFLYPWAVTFQRLGLSAFFEVLIFIIVLLIGLVYAWRKGALEWS 120


>gi|83031281|gb|ABB96819.1| NADH dehydrogenase subunit 3 [Ramphotrigon megacephalum]
          Length = 116

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    +++++ I+L++    +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFILSTSLSIILIMLNLWMAQTSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +   M+FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLESPLTTLTWAFTMLFL--LTLGLIYEWTQGGLEW 114


>gi|309380500|gb|ADO66097.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (65%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F ++AS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSVASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        ITW    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTITW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|148238588|ref|YP_001223975.1| NADH dehydrogenase subunit A [Synechococcus sp. WH 7803]
 gi|223635442|sp|A5GIB3|NU3C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|147847127|emb|CAK22678.1| NAD(P)H-quinone oxidoreductase chain 3 [Synechococcus sp. WH 7803]
          Length = 120

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S D E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQDGERQLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS 120


>gi|83031267|gb|ABB96812.1| NADH dehydrogenase subunit 3 [Poecilotriccus albifascies]
          Length = 116

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ ++L+     ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFILSSSLSVILITLNLWISQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S+++F  ILT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWTSIIIF--ILTLGLIYEWLQGGLEW 114


>gi|223931070|ref|YP_002586931.1| NADH-plastoquinone oxidoreductase subunit 3 [Syntrichia ruralis]
 gi|219562284|gb|ACL27615.1| NADH-plastoquinone oxidoreductase subunit 3 [Syntrichia ruralis]
          Length = 121

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAI-VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           LL  Y    +F+ IAS I +++  IS  I       PEKL++YE G +P  DA ++F IR
Sbjct: 3   LLPKYNSFFIFLLIASLIPILIFSISKIIAPINRKGPEKLTSYESGIEPMGDAWIQFQIR 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + +++FVIFD+E  FL+PWA+ F  +    F   ++F+ IL  G +Y W+KGALEW 
Sbjct: 63  YYMFALVFVIFDIETVFLYPWAMSFNHLGLSAFIEALIFVFILIFGLVYAWRKGALEWS 121


>gi|315487866|gb|ADU32583.1| NADH dehydrogenase subunit III [Ammodramus humeralis]
          Length = 116

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S  + +L+ +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMLIMSLTLSILLTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA      +T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLHSPLTTLAWASTLIFL--LTLGLVYEWIQGGLEW 114


>gi|57639685|gb|AAW55689.1| NADH dehydrogenase subunit 3 [Amborella trichopoda]
          Length = 111

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFV 71
           +++ I+  + ++ +  PF  A  S   PEKLS +ECGFDP  DAR +FDIRF  V +LF+
Sbjct: 2   IYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGFDPSGDARSRFDIRFYPVPILFI 61

Query: 72  IFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 62  IPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 107


>gi|308745867|ref|YP_003934281.1| NADH dehydrogenase subunit 3 [Hoplobatrachus tigerinus]
 gi|307777722|dbj|BAJ21249.1| NADH dehydrogenase subunit 3 [Hoplobatrachus tigerinus]
          Length = 113

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+FM+I + +VI++    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFMSITTLLVIIMAAISFWLPLIKPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA  F       F + ++ L +LT GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPSPWASQFSCPMTTTFWASVILL-LLTAGFIYEWAQGGLEW 111


>gi|318042791|ref|ZP_07974747.1| NADH:ubiquinone oxidoreductase subunit A [Synechococcus sp. CB0101]
          Length = 120

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  IV+ KS   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIAAAVPVLALVTNKIVSPKSRTGERDLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEWS 120


>gi|57864901|gb|AAW57075.1| NADH dehydrogenase subunit C [cyanobacterium endosymbiont of
           Rhopalodia gibba]
          Length = 120

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+  +S + I+ + +  ++      PE+++TYE G +P D A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLASSLVPILALTASKLLRPSGGGPERVTTYESGMEPIDGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFSQLGLLAFVEALIFIAILVIALVYAWRKGALEWS 120


>gi|309380620|gb|ADO66157.1| NADH dehydrogenase subunit 3 [Rana nigromaculata]
          Length = 113

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L I  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAIVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  + + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPIMTIIWASVIVIL--LTLGFIYEWLQGGLEW 111


>gi|189346373|ref|YP_001942902.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           limicola DSM 245]
 gi|223635435|sp|B3EI93|NUOA_CHLL2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189340520|gb|ACD89923.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           limicola DSM 245]
          Length = 143

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+A+    V    ++  ++    P+PEK STYECG +    A VKF+
Sbjct: 1   MDQTLSGFGNVFVFLALGIVFVAGGYLTARMLRPSRPNPEKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALFEALVFAGILILGLAYAWVKGDLDW 120


>gi|122935379|gb|ABM68397.1| NADH dehydrogenase subunit 3 [Thamnophilus unicolor]
          Length = 109

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LTMSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  +T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLTTLTWSSAIILL--LTLGLVYEWIQGGLEW 107


>gi|51572590|gb|AAU07795.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis
           psaroides]
          Length = 116

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWAV      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAVQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|66276080|ref|YP_238223.1| NADH dehydrogenase subunit 3 [Gavia stellata]
 gi|34223659|gb|AAQ63014.1| NADH dehydrogenase subunit 3 [Gavia stellata]
          Length = 116

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S A+  +L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLILSLALSTILTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +   T L + S M+ L  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQYPTTTLTWASTMILL--LTLGLVYEWMQGGLEW 114


>gi|108793414|ref|YP_637004.1| NADH dehydrogenase subunit 3 [Nipponia nippon]
 gi|84579392|dbj|BAE72083.1| NADH dehydrogenase subunit 3 [Nipponia nippon]
          Length = 116

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L+   F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSFTLTIILITLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +   T L + S+++ L  LTVG IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQSPTTTLTWASIIIIL--LTVGLIYEWIQGGLEW 114


>gi|219848535|ref|YP_002462968.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aggregans DSM 9485]
 gi|219542794|gb|ACL24532.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aggregans DSM 9485]
          Length = 118

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I +F+  A +  ++ ++  F +  K P P K STYECG +   D  ++F +++
Sbjct: 1   MLADYALIGIFLIAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHIQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F  I   G  +  +FL +L  G +YEW+KGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAFNSIGLYGLIAATIFLLMLFAGLLYEWRKGALEW 117


>gi|49237407|gb|AAT57965.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237415|gb|AAT57969.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237417|gb|AAT57970.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237419|gb|AAT57971.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237433|gb|AAT57978.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237435|gb|AAT57979.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
          Length = 111

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSIALTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  IT L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPITTLALASSLIFL--LTLGLIYEWIQGGLEW 109


>gi|332830188|gb|EGK02816.1| hypothetical protein HMPREF9455_01066 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 122

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 76/121 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS  L  + PIL+ +A +   V   +++  ++  K  +  K + +ECG DP  +AR  F 
Sbjct: 1   MSSNLYDFLPILMQIAFSVVFVFATVLASNMLGPKRKNARKQANFECGLDPIGNARSPFP 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           I++ LV++LFV+FD+EI F++PWAV FK I W G   M  F+ +L VG++Y  K+ ALEW
Sbjct: 61  IKYFLVAILFVLFDIEIVFMYPWAVNFKAIGWDGLLKMGGFIALLLVGYLYIVKRKALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|62824452|gb|AAY15829.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824454|gb|AAY15830.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824456|gb|AAY15831.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824458|gb|AAY15832.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824460|gb|AAY15833.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824462|gb|AAY15834.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824464|gb|AAY15835.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824466|gb|AAY15836.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824468|gb|AAY15837.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
 gi|62824470|gb|AAY15838.1| NADH dehydrogenase subunit 3 [Percnostola saturata saturata]
          Length = 114

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S + I L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 2   ILFMLTLSSLLSITLTMLNFWLAQMSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 61

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 62  LLFDLEIALLLPLPWATQLEFPLTTLTWSSAIILL--LTLGLVYEWIQGGLEW 112


>gi|152148745|gb|ABS29896.1| NADH dehydrogenase subunit 3 [Rana mocquardii]
          Length = 113

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F + A+ I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MILFFSAATLISMILALISFWLPLISPNTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  IT L + S ++ L  LT+GF YEW +GALEW
Sbjct: 61  LLFDLEIALLLPVPWAIQLQNPITTLTWASTIIIL--LTLGFAYEWLQGALEW 111


>gi|148241312|ref|YP_001226469.1| NADH dehydrogenase subunit A [Synechococcus sp. RCC307]
 gi|223635416|sp|A5GQF7|NU3C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|147849622|emb|CAK27116.1| NAD(P)H-quinone oxidoreductase chain 3 [Synechococcus sp. RCC307]
          Length = 120

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +I+  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALITNAVLAPRSRQGERRLTYESGMEPVGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEWS 120


>gi|325460976|gb|ADZ14599.1| NADH dehydrogenase subunit 3 [Fejervarya limnocharis]
          Length = 114

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
            FM  AS ++I+L +  F +    PD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 4   TFMFTASVLIIILTLISFWIPLIKPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 63

Query: 73  FDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA        + F +  V L +LT+GF+YEW +G LEW
Sbjct: 64  FDLEIALLLPSPWATQIIHPPQMAFFAYFVLL-LLTLGFVYEWYQGGLEW 112


>gi|218157365|ref|YP_002364595.1| NADH dehydrogenase subunit 3 [Eurystomus orientalis]
 gi|163311710|gb|ABY26864.1| NADH dehydrogenase subunit 3 [Eurystomus orientalis]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + +++ + I+L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSTTLAIILTTLNFWLAQMNPESEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +     +TW       + L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPIHTLTWTA-----IILSLLTLGLIYEWTQGGLEW 114


>gi|87045767|gb|ABD17718.1| NADH dehydrogenase subunit 3 [Agaricia humilis]
          Length = 78

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/78 (61%), Positives = 58/78 (74%)

Query: 44  TYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLG 103
            YECGF+PF      F +RF LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG
Sbjct: 1   AYECGFEPFGVPGRPFSVRFFLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLG 60

Query: 104 ILTVGFIYEWKKGALEWD 121
           +LT+G IYEW KG LEW+
Sbjct: 61  VLTLGLIYEWVKGGLEWE 78


>gi|301323031|gb|ADK70287.1| NADH dehydrogenase subunit 3 [Cercomacra manu]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + +++++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSTSLSIILTLLNFWLAQTNPNLEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +   ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSFTIIFL--LTLGLVYEWTQGGLEW 114


>gi|187764083|ref|YP_001876532.1| NADH dehydrogenase subunit 3 [Dictyostelium fasciculatum]
 gi|160688791|gb|ABX45206.1| NADH dehydrogenase subunit 3 [Dictyostelium fasciculatum]
          Length = 120

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 23  IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFP 82
           +VL    + + FK    +KL  YECGFDPF  AR +FD+RF +V++LF+IFDLEI FLFP
Sbjct: 22  VVLFYVGWALMFKVSYEDKLMGYECGFDPFGQARDEFDVRFFIVAILFLIFDLEITFLFP 81

Query: 83  WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++V     T++ +  M+VFL +L +GFI+E KKGAL+W
Sbjct: 82  FSVSLLYNTYVSYNLMLVFLIVLGIGFIFEIKKGALDW 119


>gi|23428696|gb|AAM00160.1| NADH dehydrogenase subunit 3 [Xiphorhynchus triangularis
           intermedius]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ ++ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LALSMSLSIVLTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLSTLTWTSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|264669351|gb|ACY72136.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis camiguinensis]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  +S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   VITFMLASSLILSITLTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|6714880|gb|AAF26193.1| NADH dehydrogenase subunit III [Pteroptochos castaneus]
 gi|6714881|gb|AAF26194.1| NADH dehydrogenase subunit III [Pteroptochos castaneus]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I++++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTISASLSIILTTLNFWLAQMNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + + ++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSTSIIV--ILTLGLVYEWLQGGLEW 114


>gi|170079339|ref|YP_001735977.1| NADH dehydrogenase subunit A [Synechococcus sp. PCC 7002]
 gi|75527213|sp|Q8KX40|NU3C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|22652004|gb|AAN03553.1|AF381040_3 NADH dehydrogenase subunit C [Synechococcus sp. PCC 7002]
 gi|169887008|gb|ACB00722.1| NADH dehydrogenase subunit C [Synechococcus sp. PCC 7002]
          Length = 120

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ ++S + I+ + +  ++  K   PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYFLGFLIVSSLVPILALTASKLLRPKGGGPERKTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVIALVYAWRKGALEWS 120


>gi|308197401|gb|ADO17751.1| NADH dehydrogenase subunit 3 [Premnoplex brunnescens]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (66%), Gaps = 6/111 (5%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLIMSLALSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +  I+   + S+++FL  LT+G IYEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPISTFTWTSIILFL--LTLGLIYEWTQGGLEW 114


>gi|123965562|ref|YP_001010643.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9515]
 gi|223635403|sp|A2BUS5|NU3C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123199928|gb|ABM71536.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9515]
          Length = 120

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYEYFLGFLIIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS 120


>gi|157098397|gb|ABV23445.1| NADH dehydrogenase subunit 3 [Myrmotherula axillaris]
          Length = 116

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTFLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +   ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSFAIIIL--LTLGLVYEWTQGGLEW 114


>gi|23428742|gb|AAM00183.1| NADH dehydrogenase subunit 3 [Xiphorhynchus triangularis bangsi]
          Length = 109

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ ++ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LALSMSLSIVLTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLSTLTWTSTIIIL--LTLGLVYEWAQGGLEW 107


>gi|108793330|ref|YP_637160.1| NADH dehydrogenase subunit 3 [Pelobates cultripes]
 gi|88683166|emb|CAI38765.1| NADH dehydrogenase subunit 3 [Pelobates cultripes]
          Length = 114

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I++A+VI+L I  F +   +PD  K S YECGFDP   AR+ F +RF LV++LF
Sbjct: 2   ILSTILISTALVILLAIISFWLPMMTPDTNKNSPYECGFDPLGSARLPFSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV+       I W       V L +LTVG IYEW +G LEW
Sbjct: 62  LLFDLEIALLLPSPWAVHLNTSLITILW-----ATVILTLLTVGLIYEWIQGGLEW 112


>gi|14389441|ref|NP_116774.1|ND3_15690 NADH dehydrogenase subunit 3 [Rana nigromaculata]
 gi|134303123|ref|YP_001122920.1| NADH dehydrogenase subunit 3 [Rana plancyi]
 gi|14278909|dbj|BAB58994.1| NADH dehydrogenase subunit 3 [Rana nigromaculata]
 gi|120969579|gb|ABM45878.1| NADH dehydrogenase subunit 3 [Rana plancyi]
          Length = 113

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L +  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAVVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  + + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPIMTIIWASVIVIL--LTLGFIYEWLQGGLEW 111


>gi|11467593|ref|NP_043739.1| NADH dehydrogenase, subunit 3 [Allomyces macrogynus]
 gi|6647622|sp|Q37399|NU3M_ALLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1236423|gb|AAC49240.1| NADH dehydrogenase, subunit 3 [Allomyces macrogynus]
          Length = 114

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%)

Query: 12  LVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFV 71
           LV++     + + L++  ++++   PD EK+S YECGF P  DAR KFD+ F L+++LF+
Sbjct: 4   LVYIVFTIVLTVGLILVSYLLSQAQPDSEKVSAYECGFSPLGDARQKFDVSFYLIAILFI 63

Query: 72  IFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           IFDLE+ F+ P+A     ++ LG    ++FL ILT+GFIYE+  GA+
Sbjct: 64  IFDLEVVFILPFASVIHNVSLLGGWITIIFLVILTIGFIYEFVSGAI 110


>gi|189426187|ref|YP_001953364.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter
           lovleyi SZ]
 gi|223635463|sp|B3E9W9|NUOA_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189422446|gb|ACD96844.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter
           lovleyi SZ]
          Length = 118

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI++ + +A A  +  ++   ++  K     K++ YECG +P   AR +F I+F
Sbjct: 1   MLGTYLPIMLLILVALAFGLGSVVFSSLIGQKKFSKVKMAPYECGCEPIGTARERFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E  FL+PWAV +K++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YLIAMLFILFDIEAVFLYPWAVLYKKLGLFGLVEMGLFVVILFVGYIYVWKKGALEWE 118


>gi|88608319|ref|YP_506315.1| NADH dehydrogenase I, A subunit [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600488|gb|ABD45956.1| NADH dehydrogenase I, A subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 151

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 71/108 (65%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F  +A  I  V++  P  +A  S +  K  +YECGFD       +F++RF LV +LF+I
Sbjct: 43  LFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRFYLVGILFII 102

Query: 73  FDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 103 FDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDW 150


>gi|62161204|ref|YP_214817.1| NADH dehydrogenase subunit 3 [Ambystoma californiense]
 gi|49066314|gb|AAT49256.1| NADH dehydrogenase subunit 3 [Ambystoma californiense]
          Length = 115

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (66%), Gaps = 5/112 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+FM  +S + ++L++  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 5   MLMFM-FSSMLSLILIMVGFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 64  LLFDLEIALLLPTPWALQLNPTNTLTWATLI--LALLTVGLIYEWIQGGLDW 113


>gi|264669329|gb|ACY72125.1| NADH dehydrogenase subunit 3 [Ixos everetti everetti]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTVSLTLSIVLTMLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+     I  L + S ++   ILT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLHTPIATLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|220900352|gb|ACL82376.1| NADH dehydrogenase subunit 3 [Alcippe brunneicauda]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I+L    F +A  +PD EKLS YECGFDP   AR  F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIILTALNFWLAQMNPDTEKLSPYECGFDPLGSARSPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  IT L + S ++FL  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQNPITTLTWTSTIIFL--LTLGLVYEWIQGGLEW 114


>gi|301322973|gb|ADK70258.1| NADH dehydrogenase subunit 3 [Myrmotherula sclateri]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTTLNFWLAQMNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +    + + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLAWS--FIIITLLTLGLVYEWVQGGLEW 114


>gi|264669337|gb|ACY72129.1| NADH dehydrogenase subunit 3 [Ixos philippinus mindorensis]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTTSLTLSIALTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  IT L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLYTPITTLAWASALIL--ILTLGLVYEWTQGGLEW 114


>gi|126216068|gb|ABN81090.1| NADH dehydrogenase subunit 3 [Turdus maculirostris]
          Length = 111

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   IALSLALSITLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQHPTTTLIWASALIFL--LTLGLIYEWIQGGLEW 109


>gi|215399148|ref|YP_002332278.1| NADH dehydrogenase subunit 3 [Podarcis muralis]
 gi|62900865|gb|AAY18754.1| NADH dehydrogenase subunit 3 [Podarcis muralis]
 gi|213983296|gb|ACJ54979.1| NADH dehydrogenase subunit 3 [Podarcis muralis]
          Length = 115

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I + I ++LM+  F +    PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 3   IVLMLMITTLISLILMLVSFWLPQMMPDMEKLSPYECGFDPLGSARLPFSIRFFLVAILF 62

Query: 71  VIFDLEIAFLF--PWAVYFKQITW-LGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV   Q T  + + S ++FL  LT G IYEW +G L+W
Sbjct: 63  LLFDLEIALLLPTPWAVNLSQPTMTMVWTSTIIFL--LTAGLIYEWSQGGLDW 113


>gi|11545716|ref|NP_071460.1| NADH dehydrogenase subunit 3 [Sardinops melanostictus]
 gi|11526566|dbj|BAB18609.1| NADH dehydrogenase subunit 3 [Sardinops melanostictus]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (65%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  MAI+SA+ I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIMAISSALSIILIIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW     +   T L   +++V   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGTQLLEPLTTVLWATAILV---ILTLGLVYEWIQGGLEW 114


>gi|51572554|gb|AAU07777.1| NADH dehydrogenase subunit 3 [Hypsipetes parvirostris moheliensis]
 gi|51572556|gb|AAU07778.1| NADH dehydrogenase subunit 3 [Hypsipetes parvirostris moheliensis]
 gi|264669325|gb|ACY72123.1| NADH dehydrogenase subunit 3 [Hypsipetes leucocephalus]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLAASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWTQGGLEW 114


>gi|55140266|gb|AAV41692.1| NADH dehydrogenase subunit 3 [Nectarinia olivacea]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ I L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMITLSLILSIALTLVNFWLAQMSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L   + ++FL  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLTLAASLIFL--LTLGLIYEWIQGGLEW 114


>gi|58578607|ref|YP_203297.1| NADH dehydrogenase subunit 3 [Rhizopus oryzae]
 gi|57338994|gb|AAW49464.1| NADH dehydrogenase subunit 3 [Rhizopus oryzae]
          Length = 124

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 66/86 (76%)

Query: 35  KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG 94
             P  EK+S YECGF P  DAR KF I+F LV++LF++FDLE+ FLFP+AV   +I+ +G
Sbjct: 28  NKPYSEKVSPYECGFTPLGDARQKFSIQFYLVAILFIVFDLEVLFLFPFAVSLYEISTMG 87

Query: 95  FGSMMVFLGILTVGFIYEWKKGALEW 120
           F  +++FL +LT+GF+YE+ KGAL++
Sbjct: 88  FWVVILFLVVLTIGFVYEFGKGALKF 113


>gi|293652725|gb|ADE61216.1| NADH dehydrogenase subunit 3 [Urosphena squameiceps]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF +V++L
Sbjct: 3   MITFMITTSLILSIALTTLNFWIAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFMVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S+++ L  LTVG +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQDPTTTLTWASILILL--LTVGLVYEWTQGGLEW 114


>gi|299828972|ref|YP_003734800.1| NADH dehydrogenase subunit 3 [Lycengraulis grossidens]
 gi|299758211|dbj|BAJ09886.1| NADH dehydrogenase subunit 3 [Lycengraulis grossidens]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AI +A+ +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILAITTALSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW     +    + W     +M  +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLEPKTTLIW-----VMAVIGLLTLGLIYEWLQGGLEW 114


>gi|152148742|gb|ABS29894.1| NADH dehydrogenase subunit 3 [Rana eschatia]
          Length = 113

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTILISLLLTVISFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + SM++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWASMIIIL--LTLGFIYEWLQGALEW 111


>gi|119365175|ref|YP_913426.1| NADH dehydrogenase subunit 3 [Barbonymus gonionotus]
 gi|119225115|dbj|BAF41487.1| NADH dehydrogenase subunit 3 [Barbonymus gonionotus]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI +A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILAITTALSLILGIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW    +  T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLQNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|289187951|gb|ADC92514.1| NADH dehydrogenase subunit 3 [Pitohui cristatus]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L    ++ A+ I+L      +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   VLFMFTLSLALSIILTTLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  IT L + + ++ L  LTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQTPITTLTWSTTLILL--LTVGLMYEWAQGGLEW 114


>gi|162448792|ref|YP_001611159.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
 gi|161159374|emb|CAN90679.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
          Length = 118

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 71/117 (60%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y P+ +   +A+ I + +     ++  ++P PEK+  YECG D      VK  ++F 
Sbjct: 1   MATYIPLFLLFLVAAIIALAMFTLTSLLGPRNPTPEKMIPYECGSDSTGGRFVKPSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L ++LFV+FD+E   ++PW+V F+ + W G  +M  F+ +L V  +Y WKKGALEW+
Sbjct: 61  LTAILFVVFDIEAVLIYPWSVQFRNLGWTGLATMSSFVALLVVALVYVWKKGALEWE 117


>gi|113171316|gb|ABI30704.1| NADH dehydrogenase subunit 3 [Yuhina everetti]
 gi|220900370|gb|ACL82385.1| NADH dehydrogenase subunit 3 [Yuhina everetti]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIALTALNFWIAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +   T L + S ++    LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQNPTTTLIWTSTLII--TLTLGLVYEWTQGGLEW 114


>gi|51572562|gb|AAU07781.1| NADH dehydrogenase subunit 3 [Hypsipetes crassirostris]
 gi|51572564|gb|AAU07782.1| NADH dehydrogenase subunit 3 [Hypsipetes crassirostris]
 gi|51572566|gb|AAU07783.1| NADH dehydrogenase subunit 3 [Hypsipetes crassirostris]
 gi|51572568|gb|AAU07784.1| NADH dehydrogenase subunit 3 [Hypsipetes crassirostris]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLAASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|213135991|gb|ACJ43551.1| NADH dehydrogenase subunit 3 [Cynops cyanurus]
          Length = 115

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + + +A++ A+   L++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   VTLMLAMSVALSTALIMVSFWLPLSNPDTEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L F S ++ L ILTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMHPVNTL-FWSTIILL-ILTVGLVYEWAQGGLEW 113


>gi|299823698|ref|YP_003734492.1| NADH dehydrogenase subunit 3 [Amazonsprattus scintilla]
 gi|299758105|dbj|BAJ09965.1| NADH dehydrogenase subunit 3 [Amazonsprattus scintilla]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA+A+ +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILVIATALSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW     +    + W     +M  +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLMEPKTTLIW-----VMAVIGLLTLGLIYEWLQGGLEW 114


>gi|51572550|gb|AAU07775.1| NADH dehydrogenase subunit 3 [Hypsipetes olivaceus]
 gi|51572552|gb|AAU07776.1| NADH dehydrogenase subunit 3 [Hypsipetes olivaceus]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS A+ I L    F +A  +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   MVTFMLAASLALSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSVRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLDTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|51572570|gb|AAU07785.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572572|gb|AAU07786.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572574|gb|AAU07787.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
          Length = 116

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLAASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|326535903|ref|YP_004300349.1| NADH dehydrogenase subunit 3 [Emberiza tristrami]
 gi|325305653|gb|ADZ10817.1| NADH dehydrogenase subunit 3 [Emberiza tristrami]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSLALSILLTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S ++   +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTTTLTWASTLI--SLLTLGLVYEWIQGGLEW 114


>gi|51572592|gb|AAU07796.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis
           psaroides]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWAV      T L + S  +   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAVQLHTPTTTLAWASAXIL--ILTLGLVYEWAQGGLEW 114


>gi|301322969|gb|ADK70256.1| NADH dehydrogenase subunit 3 [Myrmotherula obscura]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L    F ++  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTTLNFWLSQMNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW       + + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTW-----SFIIIALLTLGLVYEWIQGGLEW 114


>gi|280978049|ref|YP_003345002.1| NADH dehydrogenase subunit 3 [Pythonichthys microphthalmus]
 gi|271280216|dbj|BAI53166.1| NADH dehydrogenase subunit 3 [Pythonichthys microphthalmus]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I SA+  +L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITSALSCILIIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T   F +  + + +LTVG IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPTTTQTFFWATSILI-LLTVGLIYEWAQGGLEW 114


>gi|108793512|ref|YP_637108.1| NADH dehydrogenase subunit 3 [Podiceps cristatus]
 gi|108755530|dbj|BAE95761.1| NADH dehydrogenase subunit 3 [Podiceps cristatus]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM + S  + I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLVLSLTLSIILTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +  IT L + S+++ L  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPITTLTWTSIIIML--LTLGLLYEWMQGGLEW 114


>gi|264669331|gb|ACY72126.1| NADH dehydrogenase subunit 3 [Ixos everetti everetti]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTMSLTLSIVLTMLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+     I  L + S ++   ILT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLHTPIATLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|45511402|gb|AAS67241.1| NADH dehydrogenase subunit 3 [Procnias albus]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + +A+++ I+L      +A  +PD EKLS YECGFDP   AR+ F IRF L+++LF++FD
Sbjct: 8   LTLATSLSILLTSLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  +T L + S ++FL  LT+G  YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLTTLTWTSTIIFL--LTLGLTYEWAQGGLEW 114


>gi|49146684|ref|YP_025969.1| NADH dehydrogenase subunit 3 [Ninox novaeseelandiae]
 gi|37960716|gb|AAP47813.1| NADH dehydrogenase subunit 3 [Ninox novaeseelandiae]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%), Gaps = 6/111 (5%)

Query: 14  FMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM + S I+   +I+  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLMTSLILSTALITLNFWLTQMNPDQEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA+  +  IT L + S M+ L  LT+G IYEW +G LEW
Sbjct: 66  FDLEIALLLPLPWAIQLESPITTLTWTSTMIIL--LTLGLIYEWMQGGLEW 114


>gi|309380502|gb|ADO66098.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLIIPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        ITW    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTITW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|317968578|ref|ZP_07969968.1| NADH:ubiquinone oxidoreductase subunit A [Synechococcus sp. CB0205]
          Length = 120

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  IV+ KS   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIAAAVPVLALVTNKIVSPKSRVGERDLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEWS 120


>gi|223635534|sp|Q2GDY1|NUOA_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 130

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  + +F  +A  I  V++  P  +A  S +  K  +YECGFD       +F++RF
Sbjct: 13  VVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRF 72

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF+IFDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 73  YLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDW 129


>gi|164420817|ref|YP_001648637.1| NADH dehydrogenase subunit 3 [Hydra oligactis]
 gi|158668157|gb|ABW76615.1| NADH dehydrogenase subunit 3 [Hydra oligactis]
          Length = 115

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 22  VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF 81
           +IVL  S F+ +FKSPD EK+S YECGF+P       F IRF L+++LF+IFDLEI +LF
Sbjct: 17  LIVLFFSIFL-SFKSPDKEKVSIYECGFNPXHSTGQPFSIRFFLIAILFLIFDLEIIYLF 75

Query: 82  PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           PW+V    I +     + +F+ ILT+G IYEW +G LEW+
Sbjct: 76  PWSVNTNLINYYSQSIIFIFIIILTLGLIYEWLRGGLEWE 115


>gi|78211755|ref|YP_380534.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9605]
 gi|123770819|sp|Q3AN53|NU3C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78196214|gb|ABB33979.1| putative NADH dehydrogenase subunit [Synechococcus sp. CC9605]
          Length = 120

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  +VA KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLVAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 120


>gi|288908835|dbj|BAI77086.1| NADH dehydrogenase subunit 3 [Caulophryne pelagica]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L  + IA A+  +L++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   VLTVITIALALSTLLIVVSFWLPLMAPDHEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW V  +    L F   ++ L +LTVG IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGVQLET-PHLTFYWAVLVLALLTVGLIYEWIQGGLEW 114


>gi|213136131|gb|ACJ43681.1| NADH dehydrogenase subunit 3 [Mertensiella caucasica]
          Length = 115

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ +A+++ +  +L I  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMLMLALSTILSFMLTIIGFWLPLSNPDAEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L + S+++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLLPSNTLFWSSIILFL--LTIGLIYEWIQGGLEW 113


>gi|264669355|gb|ACY72138.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis fugensis]
 gi|264669357|gb|ACY72139.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis fugensis]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTTSLILSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|296140851|ref|YP_003648094.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Tsukamurella
           paurometabola DSM 20162]
 gi|296028985|gb|ADG79755.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Tsukamurella
           paurometabola DSM 20162]
          Length = 119

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDP--FDDARVKFDIR 62
           +  Y PILV  AIA+A  +  +     V  +  +  KL  YECG DP        +F ++
Sbjct: 1   MNPYVPILVLGAIATAFAVFSVGVAQYVGPRRRNRAKLEAYECGIDPSPHPTGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F L ++LF+IFD+EI FL+PWAV+F  +   G  +M +FL  +TV + YEW++G LEWD
Sbjct: 61  FYLTAMLFIIFDIEIVFLYPWAVHFDVLGAYGLAAMALFLVNVTVAYAYEWRRGGLEWD 119


>gi|293652691|gb|ADE61199.1| NADH dehydrogenase subunit 3 [Hypsipetes leucocephalus]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVTFMLAASLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|71733156|ref|YP_271960.1| NADH dehydrogenase subunit 3 [Montastraea faveolata]
 gi|71733170|ref|YP_271947.1| NADH dehydrogenase subunit 3 [Montastraea franksi]
 gi|71733184|ref|YP_271934.1| NADH dehydrogenase subunit 3 [Montastraea annularis]
 gi|71043524|dbj|BAE16187.1| NADH dehydrogenase subunit 3 [Montastraea annularis]
 gi|71043538|dbj|BAE16200.1| NADH dehydrogenase subunit 3 [Montastraea annularis]
 gi|71043552|dbj|BAE16213.1| NADH dehydrogenase subunit 3 [Montastraea franksi]
 gi|71043566|dbj|BAE16226.1| NADH dehydrogenase subunit 3 [Montastraea franksi]
 gi|71043580|dbj|BAE16239.1| NADH dehydrogenase subunit 3 [Montastraea faveolata]
 gi|71043594|dbj|BAE16252.1| NADH dehydrogenase subunit 3 [Montastraea faveolata]
          Length = 113

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 61/92 (66%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           F +  K PD EK+S YECGF PF      F IRF L+ +LF+IFDLEI+F FPW V +  
Sbjct: 22  FFLGEKVPDREKVSAYECGFVPFSFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYNS 81

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           I   GF +M+ F  ILT+G +YEW KG LEW+
Sbjct: 82  IAPFGFWTMVGFFFILTLGLVYEWLKGGLEWE 113


>gi|156741309|ref|YP_001431438.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
 gi|156232637|gb|ABU57420.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 118

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL    +A  I + +++    +  + P+  KL  YE G +P   A+ +F I+F
Sbjct: 1   MLIDYLPILTLFLVAMFIAVFVIVLSRYLGPQRPNRRKLMPYESGMEPIGPAQRRFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+EI FLFP+A+ ++Q+   G   M VF  +L +G +YEW++GAL W+
Sbjct: 61  NLVAMLFILFDIEIIFLFPYALVYRQLGVPGLAVMGVFFVVLVIGLVYEWRRGALRWE 118


>gi|88910843|gb|ABD58728.1| NADH dehydrogenase subunit 3 [Chionis minor]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 68/104 (65%), Gaps = 6/104 (5%)

Query: 19  SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIA 78
           S+I+I L    F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA
Sbjct: 15  SSILITL---NFWLAQMSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIA 71

Query: 79  FL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L   PWA+  +  T L      + + +LT+G IYEW +G LEW
Sbjct: 72  LLLPLPWAIQLQHPT-LTLTWATIIIALLTLGLIYEWMQGGLEW 114


>gi|16330875|ref|NP_441603.1| NADH dehydrogenase subunit A [Synechocystis sp. PCC 6803]
 gi|128691|sp|P19045|NU3C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|581791|emb|CAA35484.1| unnamed protein product [Synechocystis sp. PCC 6803]
 gi|1653369|dbj|BAA18283.1| NADH dehydrogenase subunit 3 [Synechocystis sp. PCC 6803]
          Length = 120

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y   L F+ I S + ++ + +  ++  +   PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLTGYEYFLGFLFICSLVPVLALTASKLLRPRDGGPERQTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEWS 120


>gi|315487878|gb|ADU32589.1| NADH dehydrogenase subunit III [Alauda arvensis]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMLIMSLTLSIALTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +  IT L + S  V + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQDPITTLTWAS--VLIALLTLGLIYEWVQGGLEW 114


>gi|261888549|gb|ACY06224.1| NADH dehydrogenase subunit 3 [Ambystoma barbouri]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (67%), Gaps = 5/112 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL+F+  A+  V++++I  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 6   ILMFILSATLSVLLILIG-FWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 64

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     + L + +++  L +LTVG IYEW +G L+W
Sbjct: 65  LLFDLEIALLLPTPWALQLNPTSTLLWATLI--LTLLTVGLIYEWIQGGLDW 114


>gi|309380476|gb|ADO66085.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
          Length = 113

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +  L + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTLMWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|193215724|ref|YP_001996923.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
 gi|223635395|sp|B3QUX5|NUOA1_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|193089201|gb|ACF14476.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
          Length = 121

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PI V ++IA  + +VL+    I+  K  +PEKL+ YE G DP    R +  +RF
Sbjct: 1   MLESYFPIFVVISIAIILAVVLLSIGKIIGPKRNNPEKLTPYESGMDPVGSTRTRVTVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV+++F++FD+E+ F++PWAV F++++ + G   M+ F+ IL  G+ Y  KK AL+WD
Sbjct: 61  YLVAMIFIVFDIEVIFMYPWAVSFRELSGFYGLIPMVTFVLILLAGYYYILKKKALDWD 119


>gi|20330582|ref|NP_620321.1| NADH dehydrogenase subunit 3 [Arenaria interpres]
 gi|20270006|gb|AAL74026.1| NADH dehydrogenase subunit 3 [Arenaria interpres]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LALSLALSIILTTVNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+        +TW         + +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLPSPLLTLTWTS-----TIIALLTLGLVYEWAQGGLEW 114


>gi|164512246|emb|CAO78456.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512249|emb|CAO78458.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512255|emb|CAO78462.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512258|emb|CAO78464.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512261|emb|CAO78466.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512264|emb|CAO78468.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512267|emb|CAO78470.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512270|emb|CAO78472.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512273|emb|CAO78474.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512276|emb|CAO78476.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512279|emb|CAO78478.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512282|emb|CAO78480.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512285|emb|CAO78482.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512288|emb|CAO78484.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512291|emb|CAO78486.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512294|emb|CAO78488.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512581|emb|CAP09079.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512584|emb|CAP09081.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512587|emb|CAP09083.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512590|emb|CAP09085.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512593|emb|CAP09087.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512596|emb|CAP09089.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512599|emb|CAP09091.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512602|emb|CAP09093.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512605|emb|CAP09095.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512608|emb|CAP09097.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512611|emb|CAP09099.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512614|emb|CAP09101.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512617|emb|CAP09103.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512620|emb|CAP09105.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512623|emb|CAP09107.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512626|emb|CAP09109.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512629|emb|CAP09111.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512632|emb|CAP09113.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512635|emb|CAP09115.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512638|emb|CAP09117.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512641|emb|CAP09119.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512644|emb|CAP09121.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512647|emb|CAP09123.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512650|emb|CAP09125.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512653|emb|CAP09127.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512656|emb|CAP09129.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512659|emb|CAP09131.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512662|emb|CAP09133.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512665|emb|CAP09135.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512668|emb|CAP09137.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512671|emb|CAP09139.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512674|emb|CAP09141.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512677|emb|CAP09143.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512680|emb|CAP09145.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512683|emb|CAP09147.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512686|emb|CAP09149.1| NADH dehydrogenase subunit 3 [Rana esculenta]
 gi|164512689|emb|CAP09151.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512692|emb|CAP09153.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|164512695|emb|CAP09155.1| NADH dehydrogenase subunit 3 [Rana lessonae]
 gi|309380590|gb|ADO66142.1| NADH dehydrogenase subunit 3 [Rana bergeri]
 gi|309380592|gb|ADO66143.1| NADH dehydrogenase subunit 3 [Rana bergeri]
 gi|309380594|gb|ADO66144.1| NADH dehydrogenase subunit 3 [Rana bergeri]
          Length = 113

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + IVL    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSIASLLSIVLAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|62901808|gb|AAY18855.1| NADH dehydrogenase subunit 3 [Merops pusillus]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A ++A+  VL    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LAFSAALSTVLAALSFWLAQTTPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +     +TW      +  + +LT+G  YEW +G L+W
Sbjct: 68  LEIALLLPLPWATQLQSPISTLTW-----TLAIISLLTLGLAYEWMQGGLKW 114


>gi|189095508|ref|YP_001936296.1| NADH dehydrogenase subunit 3 [Syrmaticus ellioti]
 gi|189095522|ref|YP_001936477.1| NADH dehydrogenase subunit 3 [Syrmaticus humiae]
 gi|171702184|dbj|BAG16216.1| NADH dehydrogenase subunit 3 [Syrmaticus ellioti]
 gi|171702198|dbj|BAG16229.1| NADH dehydrogenase subunit 3 [Syrmaticus humiae]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (62%), Gaps = 4/112 (3%)

Query: 12  LVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM + S A+   L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLLLSFALSTALTILNFWLAQMNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  T +        + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPT-MTLTWTATIITLLTLGLIYEWTQGGLEW 114


>gi|164512252|emb|CAO78460.1| NADH dehydrogenase subunit 3 [Rana lessonae]
          Length = 113

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + IVL    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSIASLLSIVLAAVSFWLPLITPDAEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|309380572|gb|ADO66133.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
          Length = 113

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +  L + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTLVWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|256576010|gb|ACU87805.1| NADH dehydrogenase subunit 3 [Dicaeum agile]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + IVL    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   ITLSLTLSIVLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  IT L   S ++FL IL  G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPITTLALASSLIFLLIL--GLVYEWGQGGLEW 114


>gi|319412288|gb|ADV41825.1| NADH dehydrogenase subunit 3 [Bigelowiella natans]
          Length = 121

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKF 59
           M   +  Y  ILVF+  + A+ ++L+   F+++ K   DPEKLS YECGFDPF D R +F
Sbjct: 1   MQPYVYEYGSILVFLCFSVALGLILLALSFLLSRKRTLDPEKLSAYECGFDPFSDCRAEF 60

Query: 60  DIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           ++ F L+ +LF++FDLE+  LFPWAVY   +      S + FL  LT+GF Y W  GALE
Sbjct: 61  NVHFYLIGILFIVFDLEVVLLFPWAVYVGALGPFAVWSAVDFLVELTIGFAYVWLVGALE 120


>gi|281428837|ref|YP_003355014.1| NADH dehydrogenase subunit 3 [Ircinia strobilina]
 gi|251765337|gb|ACT15489.1| NADH dehydrogenase subunit 3 [Ircinia strobilina]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (69%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           +++  K P+ EK S YECGFDP++ AR+ F +R  LV +LF+IFDLE+ FLFPW V +  
Sbjct: 25  YLLVEKVPEQEKSSVYECGFDPYEIARIPFSVRXFLVGILFIIFDLEVVFLFPWGVIYII 84

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +  LG   + +FL IL VG +YEWK G L+W+
Sbjct: 85  MGGLGTWVVYLFLWILVVGLVYEWKVGGLDWE 116


>gi|51572514|gb|AAU07757.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572518|gb|AAU07759.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572520|gb|AAU07760.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572522|gb|AAU07761.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572524|gb|AAU07762.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572526|gb|AAU07763.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572528|gb|AAU07764.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572530|gb|AAU07765.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572532|gb|AAU07766.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572534|gb|AAU07767.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572536|gb|AAU07768.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572538|gb|AAU07769.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572540|gb|AAU07770.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572544|gb|AAU07772.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|89212996|gb|ABD63968.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariencis]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVTFMFAASLALSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLDTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|57639711|gb|AAW55702.1| NADH dehydrogenase subunit 3 [Pinus thunbergii]
          Length = 111

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+S + ++ +  PF  A   S  PEKLS +ECG DP  DAR +FDIRF  V 
Sbjct: 1   APICIYLVISSLVSLIPLGVPFPFAPNGSTYPEKLSAHECGSDPSGDARSRFDIRFYPVP 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           + F+I D E+ F  P AV   +I   G  SMMVF  I T+GF +EWKKGA
Sbjct: 61  ISFIISDPEVTFSSPRAVPLNKIDSFGSRSMMVFSLISTIGFPHEWKKGA 110


>gi|152148793|gb|ABS29928.1| NADH dehydrogenase subunit 3 [Rana mocquardii]
          Length = 113

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F + A+ I +VL +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MIMFFSTATLISLVLALVSFWLPLISPNTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  I  L + S +V L  LT+GF YEW +GALEW
Sbjct: 61  LLFDLEIALLLPVPWAIQLQSPIMALTWASTIVIL--LTLGFAYEWLQGALEW 111


>gi|87045773|gb|ABD17721.1| NADH dehydrogenase subunit 3 [Porites porites]
          Length = 78

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%)

Query: 44  TYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLG 103
            YECGF+PF      F +RF LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG
Sbjct: 1   AYECGFEPFGIPGRPFSVRFFLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLG 60

Query: 104 ILTVGFIYEWKKGALEWD 121
           +LT+G +YEW KG LEW+
Sbjct: 61  VLTLGLLYEWIKGGLEWE 78


>gi|190349476|ref|YP_001974547.1| NADH dehydrogenase subunit 3 [Platalea minor]
 gi|134268950|gb|ABO68973.1| NADH dehydrogenase subunit 3 [Platalea minor]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ +++ S  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTLSFILTIILTSLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +   T L + S+++ L  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPTTTLTWTSVIIIL--LTLGLVYEWTQGGLEW 114


>gi|213136299|gb|ACJ43837.1| NADH dehydrogenase subunit 3 [Salamandra salamandra]
          Length = 115

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I++ +  +LMI  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITLMLIISTTLSTILMIIGFWLPLNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     ++ L +  +++ L  LTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMLPLSTLLWSFIILLL--LTVGLMYEWTQGGLEW 113


>gi|301322985|gb|ADK70264.1| NADH dehydrogenase subunit 3 [Myrmotherula schisticolor]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L +  F ++  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTLLNFWLSQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +   ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSFAIIIL--LTLGLVYEWIQGGLEW 114


>gi|21950348|gb|AAM23056.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
          Length = 116

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 73/111 (65%), Gaps = 6/111 (5%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF L+++LF++
Sbjct: 6   FMLILSMSLSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +  ++ L + S M+ L  LT+G IYEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLSTLTWTSTMLIL--LTLGLIYEWTQGGLEW 114


>gi|301322971|gb|ADK70257.1| NADH dehydrogenase subunit 3 [Myrmotherula ambigua]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 9/115 (7%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTTLNFWLAQMNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMM---VFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +        ++M   + + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQS----PLTTLMWTFIIIALLTLGLVYEWIQGGLEW 114


>gi|37361564|gb|AAQ91100.1| NADH dehydrogenase subunit 3 [Acanthisitta chloris]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ A+  +L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSLALSTILTAVNFWLAQTNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      +T L + S ++ L  LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLHSPLTTLTWTSTIILL--LTIGLAYEWTQGGLEW 114


>gi|18251396|gb|AAL65993.1|AF447674_1 NADH dehydrogenase subunit 3 [Aphanotriccus audax]
 gi|18251398|gb|AAL65994.1|AF447675_1 NADH dehydrogenase subunit 3 [Aphanotriccus audax]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ ++L      +A  +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ILFMFILSSSLSMILTTLNMWLAQSNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +  L   S ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQFPLNTLALASTILFL--LTLGLIYEWTQGGLEW 114


>gi|83031287|gb|ABB96822.1| NADH dehydrogenase subunit 3 [Ramphotrigon ruficauda]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (69%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   + 
Sbjct: 25  LAQTTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQLQS 84

Query: 90  -ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +T L + S M+FL  LT+G IYEW +G LEW
Sbjct: 85  PLTTLSWASTMLFL--LTLGLIYEWTQGGLEW 114


>gi|67925381|ref|ZP_00518731.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Crocosphaera
           watsonii WH 8501]
 gi|67852777|gb|EAM48186.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Crocosphaera
           watsonii WH 8501]
          Length = 120

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S I I+ + +  I+      PE+++TYE G +P   A ++F+IR+
Sbjct: 3   ILNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERVTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   +VF+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGLLAFVEALVFISILVVALVYAWRKGALEWS 120


>gi|84374204|gb|ABC58196.1| NADH dehydrogenase subunit 3 [Zosterops olivaceus chloronothos]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   ITLSMTLSIILTLLNFWIAQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPTTTLIWTSTLIFL--LTLGLMYEWAQGGLEW 114


>gi|301323021|gb|ADK70282.1| NADH dehydrogenase subunit 3 [Cercomacra parkeri]
          Length = 116

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ILFMITLSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +  +++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLAWSFVIILL--LTLGLVYEWIQGGLEW 114


>gi|255077695|gb|ACU00333.1| NADH dehydrogenase subunit 3 [Siren intermedia]
          Length = 114

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           + M I+  + ++L+I  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF++
Sbjct: 5   IMMVISVMLTMILIIVGFWLPISNPDAEKLSPYECGFDPLGSARLPFSIRFFLIAILFLL 64

Query: 73  FDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PW         L + S+++ L  LT+G IYEW KG LEW
Sbjct: 65  FDLEIALLLPTPWGTQLSPSMTLFWSSLILML--LTMGLIYEWLKGGLEW 112


>gi|44843555|emb|CAE48110.1| NADH deydrogenase subunit 3 [Bufo melanostictus]
          Length = 113

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F+ +A+AIV +L    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   LFVLLATAIVFILATLSFWLPTISPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA      T   F S ++ + +LT+GF+YEW +G LEW
Sbjct: 63  FDLEIALLLPTPWAAQLPYPTLSIFWSSIILI-LLTLGFVYEWLQGGLEW 111


>gi|77556488|gb|ABA99284.1| Mitochondrial ribosomal protein S3, putative [Oryza sativa Japonica
           Group]
          Length = 752

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/103 (47%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFD 60
           S  L+ +API +++ I+  + ++ +  PF  A  S   PEKLS YECGFDP  DAR +FD
Sbjct: 640 SAFLSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFD 699

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLG 103
           IRF  V +LF+I DLE+ F FPWAV   +I   G  SM+V  G
Sbjct: 700 IRFYPVPILFIIPDLEVTFFFPWAVPPNKIDLFGSWSMIVATG 742


>gi|13560221|emb|CAC36192.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560225|emb|CAC36188.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|13560231|emb|CAC36193.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560233|emb|CAC36194.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560235|emb|CAC36195.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560237|emb|CAC36196.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560239|emb|CAC36197.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560241|emb|CAC36198.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560243|emb|CAC36199.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13560245|emb|CAC36200.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|13561100|emb|CAC36261.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512189|emb|CAO78418.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512192|emb|CAO78420.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512198|emb|CAO78424.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512201|emb|CAO78426.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512204|emb|CAO78428.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512207|emb|CAO78430.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512210|emb|CAO78432.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512213|emb|CAO78434.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512216|emb|CAO78436.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512219|emb|CAO78438.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512222|emb|CAO78440.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512225|emb|CAO78442.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512228|emb|CAO78444.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512231|emb|CAO78446.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512234|emb|CAO78448.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512237|emb|CAO78450.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512240|emb|CAO78452.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164512243|emb|CAO78454.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513883|emb|CAP12733.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513886|emb|CAP12735.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513889|emb|CAP12737.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513892|emb|CAP12739.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513895|emb|CAP12741.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513898|emb|CAP12743.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513901|emb|CAP12745.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513904|emb|CAP12747.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513907|emb|CAP12749.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513910|emb|CAP12751.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513913|emb|CAP12753.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513916|emb|CAP12755.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513919|emb|CAP12757.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513922|emb|CAP12759.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513925|emb|CAP12761.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513928|emb|CAP12763.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513931|emb|CAP12765.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513934|emb|CAP12767.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513937|emb|CAP12769.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513940|emb|CAP12771.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513943|emb|CAP12773.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513946|emb|CAP12775.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513949|emb|CAP12777.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513952|emb|CAP12779.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|164513955|emb|CAP12781.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841977|gb|ACX51049.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841991|gb|ACX51056.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842003|gb|ACX51062.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842005|gb|ACX51063.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842011|gb|ACX51066.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842017|gb|ACX51069.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380430|gb|ADO66062.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380434|gb|ADO66064.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380436|gb|ADO66065.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380464|gb|ADO66079.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician East']
 gi|309380466|gb|ADO66080.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician East']
 gi|309380512|gb|ADO66103.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380514|gb|ADO66104.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380516|gb|ADO66105.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380518|gb|ADO66106.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380522|gb|ADO66108.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380524|gb|ADO66109.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380534|gb|ADO66114.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380536|gb|ADO66115.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380546|gb|ADO66120.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|84374206|gb|ABC58197.1| NADH dehydrogenase subunit 3 [Zosterops olivaceus chloronothos]
          Length = 115

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 7   ITLSMTLSIILTLLNFWIAQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 66

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 67  LEIALLLPLPWATQLQSPTTTLIWTSTLIFL--LTLGLMYEWAQGGLEW 113


>gi|25057588|ref|NP_739770.1| NADH dehydrogenase subunit 3 [Caulophryne pelagica]
 gi|25005685|dbj|BAC23340.1| NADH dehydrogenase subunit 3 [Caulophryne jordani]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L  +AIA  +  +L++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   VLTVIAIALTLSTLLIVVSFWLPLVAPDHEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW V  +    L F    + L +LTVG IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGVQLEAPH-LTFYWATLVLALLTVGLIYEWLQGGLEW 114


>gi|58047414|ref|YP_192934.1| NADH dehydrogenase subunit 3 [Discoglossus galganoi]
 gi|46242535|gb|AAS83388.1| NADH dehydrogenase subunit 3 [Discoglossus galganoi]
          Length = 114

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + +  A+A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 2   ISIILLFAAALATILAMVAFWLPQITPDTEKLSPYECGFDPLGSARLPFSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV        I W      ++ LG+LTVG IYEW +G LEW
Sbjct: 62  LLFDLEIALLLPAPWAVQLDHPATTIIW-----AVIILGLLTVGLIYEWLQGGLEW 112


>gi|152148538|gb|ABS29758.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148541|gb|ABS29760.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148544|gb|ABS29762.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148547|gb|ABS29764.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148550|gb|ABS29766.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148553|gb|ABS29768.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
 gi|152148556|gb|ABS29770.1| NADH dehydrogenase subunit 3 [Rana parvaccola]
          Length = 113

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L ++ F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTILISLILALTSFWLPLISPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWASVIIIL--LTLGFIYEWLQGALEW 111


>gi|6714876|gb|AAF26189.1| NADH dehydrogenase subunit III [Scelorchilus rubecula]
 gi|6714877|gb|AAF26190.1| NADH dehydrogenase subunit III [Scelorchilus rubecula]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I+ ++ I+L +  F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLMISISLSIILTMLNFWLAQTSPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + + ++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQFPLTTLTWAASLII--ILTLGLVYEWFQGGLEW 114


>gi|13560223|emb|CAC36187.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|13560227|emb|CAC36189.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|309380588|gb|ADO66141.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Middle East']
          Length = 113

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMAIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|260434300|ref|ZP_05788270.1| NADH dehydrogenase i, subunit 3 [Synechococcus sp. WH 8109]
 gi|260412174|gb|EEX05470.1| NADH dehydrogenase i, subunit 3 [Synechococcus sp. WH 8109]
          Length = 120

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 74/117 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+  + +I+  +VA KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPTLALITNKLVAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 120


>gi|193882364|gb|ACF25859.1| NADH dehydrogenase subunit 3 [Illadopsis puveli]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 73/113 (64%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           I++FM I S  + ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   IIMFMFILSLTLSVILTALNFWLAGTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L      + + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQNPT-LTLMWASILISLLTLGLIYEWLQGGLEW 114


>gi|89212990|gb|ABD63965.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis]
 gi|264669359|gb|ACY72140.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis batanensis]
 gi|264669361|gb|ACY72141.1| NADH dehydrogenase subunit 3 [Microscelis amaurotis batanensis]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTTSLILSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHTPTTTLTWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|295821507|gb|ADG36478.1| NADH dehydrogenase subunit 3 [Xiphocolaptes major]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW         + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLYTLTWTS-----TIITLLTLGLVYEWAQGGLEW 114


>gi|49237409|gb|AAT57966.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237423|gb|AAT57973.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237425|gb|AAT57974.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
 gi|49237427|gb|AAT57975.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
          Length = 111

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSIALTALNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPTTTLALASSLIFL--LTLGLIYEWIQGGLEW 109


>gi|86609772|ref|YP_478534.1| NADH dehydrogenase subunit A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123501308|sp|Q2JJB0|NU3C_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|86558314|gb|ABD03271.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 120

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +LVF+ + S + I+ + +  ++A K     + STYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLVFLIVCSLLPILALGASALLAPKRRGSLRRSTYESGMEPFGQAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL VG +Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFVEALIFIAILVVGLVYAWRKGALEWS 120


>gi|62161237|ref|YP_214778.1| NADH dehydrogenase subunit 3 [Ambystoma tigrinum tigrinum]
 gi|49066272|gb|AAT49217.1| NADH dehydrogenase subunit 3 [Ambystoma tigrinum tigrinum]
          Length = 115

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (66%), Gaps = 5/112 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+FM  +S + ++L++  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 5   MLMFM-FSSMLSLILIMIGFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 64  LLFDLEIALLLPTPWALQLDPTNTLTWATLI--LALLTVGLIYEWIQGGLDW 113


>gi|15088740|ref|NP_150110.1| NADH dehydrogenase subunit 3 [Hyaloraphidium curvatum]
 gi|15077947|gb|AAK83432.1|AF402142_16 NADH dehydrogenase subunit 3 [Hyaloraphidium curvatum]
          Length = 109

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 64/88 (72%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT 91
           ++  S   +KLSTYECGFDP+ DAR+KFDI + LV++LF++FDLE+ FLFP+A    +++
Sbjct: 21  LSVSSRTADKLSTYECGFDPYSDARLKFDILYYLVAILFLLFDLEVIFLFPFATLLTEMS 80

Query: 92  WLGFGSMMVFLGILTVGFIYEWKKGALE 119
           +      ++F  ILT+G++YE   G+LE
Sbjct: 81  FWNLSVYLIFFSILTIGYLYELNSGSLE 108


>gi|317097116|ref|YP_004123250.1| NADH dehydrogenase subunit 3 [Pelteobagrus nitidus]
 gi|302201433|gb|ADL09002.1| NADH dehydrogenase subunit 3 [Pelteobagrus nitidus]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V MAI++A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMVMMAISTALSMILALVSFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       ++    +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLPDPSYTLLWAATVLI-LLTLGLIYEWVQGGLEW 114


>gi|49237421|gb|AAT57972.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
          Length = 111

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSIALTALNFWLAQANPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPTTTLALASSLIFL--LTLGLIYEWIQGGLEW 109


>gi|23428720|gb|AAM00172.1| NADH dehydrogenase subunit 3 [Xiphocolaptes promeropirhynchus]
          Length = 115

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 3   ILFMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 62

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW         + +LT+G +YEW +G LEW
Sbjct: 63  LLFDLEIALLLPLPWATQLQSPLYTLTWTS-----TIITLLTLGLVYEWAQGGLEW 113


>gi|45439391|ref|NP_990983.1| NADH dehydrogenase subunit 3 [Ambystoma mexicanum]
 gi|44843541|emb|CAE48097.1| NADH deydrogenase subunit 3 [Ambystoma mexicanum]
 gi|49066258|gb|AAT49204.1| NADH dehydrogenase subunit 3 [Ambystoma mexicanum]
          Length = 115

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 70/105 (66%), Gaps = 4/105 (3%)

Query: 18  ASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEI 77
           +S + ++L++  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEI
Sbjct: 11  SSMLSLILIMIGFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEI 70

Query: 78  AFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           A L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 71  ALLLPTPWALQLNPTNTLTWTTLI--LALLTVGLIYEWIQGGLDW 113


>gi|83031293|gb|ABB96825.1| NADH dehydrogenase subunit 3 [Todirostrum latirostre]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    +AS++ I+L+     ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFILASSLSIILITLNLWISQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S+++   ILT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWTSVIIL--ILTLGLTYEWLQGGLEW 114


>gi|23428734|gb|AAM00179.1| NADH dehydrogenase subunit 3 [Xiphorhynchus susurrans]
          Length = 111

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   LALSMSLSIILTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPLSTLTWTSTIIIL--LTLGLVYEWAQGGLEW 109


>gi|23598318|gb|AAN35044.1| NADH dehydrogenase subunit 3 [Empidonax traillii]
 gi|23598320|gb|AAN35045.1| NADH dehydrogenase subunit 3 [Empidonax traillii]
          Length = 116

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ I+L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFTLSSSLSIILTMLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +  L + + M+ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLATLMWATAMLVL--LTLGLVYEWSQGGLEW 114


>gi|282901527|ref|ZP_06309449.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Cylindrospermopsis raciborskii CS-505]
 gi|281193570|gb|EFA68545.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Cylindrospermopsis raciborskii CS-505]
          Length = 120

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ + S +  + + +  I+   S  PE+ +TYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLILCSLVPALALSASKILRPSSYSPERRTTYESGMEPFGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALVYAWRKGALEWS 120


>gi|220900402|gb|ACL82401.1| NADH dehydrogenase subunit 3 [Oculocincta squamifrons]
          Length = 116

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIMLTMLNFWLAQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQNPTTTLIWTSTIIFL--LTLGLMYEWAQGGLEW 114


>gi|31282837|gb|AAP15266.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
          Length = 116

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVVFMXTLSLTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L        + ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPT-LTLAWTSALITILTLGLVYEWIQGGLEW 114


>gi|332669449|ref|YP_004452457.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           fimi ATCC 484]
 gi|332338487|gb|AEE45070.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           fimi ATCC 484]
          Length = 120

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIRF 63
             YAP+LV M IA+ + +  + +  I+  K  +  KL  YECG +P   A    +F I++
Sbjct: 3   NPYAPLLVLMGIAAVLALGGVGASAILGPKRYNRAKLEAYECGIEPTPHAIGGGRFPIKY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++ F++FD+E+ FL+PWAV F  +   G  +M+ FL ++TV F+YEW++G  EWD
Sbjct: 63  YLVAMTFIVFDIEVVFLYPWAVAFADLAVFGLVAMLAFLVLITVPFVYEWRRGGFEWD 120


>gi|163848440|ref|YP_001636484.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aurantiacus J-10-fl]
 gi|222526368|ref|YP_002570839.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus sp. Y-400-fl]
 gi|163669729|gb|ABY36095.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aurantiacus J-10-fl]
 gi|222450247|gb|ACM54513.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           sp. Y-400-fl]
          Length = 118

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+   IA  I   ++    ++  +   P KL+ YE G DP   A  +  ++F
Sbjct: 1   MLESYVPVLILFLIAVFIAAFVITLSALLGPRRSTPRKLAPYESGMDPVGPAIRRIPVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E+ F +P+A+ F+Q+   G  +M VF  +L VGF+YEWKKGAL W+
Sbjct: 61  YVVAMLFIVFDIEVVFFYPFALVFRQLGPAGLAAMGVFFLVLLVGFVYEWKKGALRWE 118


>gi|295697745|ref|YP_003590983.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
 gi|295413347|gb|ADG07839.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
          Length = 121

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 74/121 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+    SY  +++F+ +A A+ +V +     +    P  EKL  YE G +P  DARV+++
Sbjct: 1   MTAYWNSYLFVVIFVVLAIALAVVALTLGKWLRPAHPSREKLEPYESGVEPVGDARVQYN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            R+ L ++LFV+FD+EI FL+PWAV F ++   G    ++F+ +L +G +Y W+K  LEW
Sbjct: 61  ARYYLFALLFVVFDVEILFLYPWAVAFHELGLFGLVEALIFMAMLVIGLVYAWRKKVLEW 120

Query: 121 D 121
            
Sbjct: 121 K 121


>gi|31282859|gb|AAP15277.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
          Length = 116

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIVFMLTLSLTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L        + ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPT-LTLAWTSALITILTLGLVYEWIQGGLEW 114


>gi|197259890|ref|YP_002149685.1| NADH dehydrogenase subunit 3 [Madracis mirabilis]
 gi|169809238|gb|ACA84076.1| NADH dehydrogenase subunit 3 [Madracis mirabilis]
          Length = 114

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           F++  K PD EK+S YECGF PF+     F IRF L+ +LF+IFDLEI+F FPW V +  
Sbjct: 23  FLIGEKVPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYNS 82

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           I   GF +M+ F  +L +G IYEW  G LEW+
Sbjct: 83  IAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114


>gi|88910841|gb|ABD58727.1| NADH dehydrogenase subunit 3 [Pluvianellus socialis]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ A+  +L+   F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSLALSTILITLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +  T L        + +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQHPT-LTLTWASAIIALLTLGLVYEWMQGGLEW 114


>gi|124302911|ref|YP_001023706.1| NADH dehydrogenase subunit 3 [Angiopteris evecta]
 gi|223635379|sp|A2T338|NU3C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|110628309|gb|ABG79605.1| NADH-plastoquinone oxidoreductase subunit 3 [Angiopteris evecta]
          Length = 120

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    +F+ IAS I +       I+A  S  PEKL++YE G +P  DA ++F IR+
Sbjct: 3   LLPKYDSFWLFLLIASLIPVSAFSISKILAPVSQGPEKLTSYESGIEPMGDAWIQFQIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWA+ FK++    F   ++F+ IL +G IY W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAMSFKELGISAFIEALIFVLILIIGLIYAWRKGALEWS 120


>gi|94968343|ref|YP_590391.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550393|gb|ABF40317.1| NADH dehydrogenase subunit A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 135

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 77/124 (62%), Gaps = 5/124 (4%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +    Y P+L+ +A+ + I + ++I  + V     +  K+S YECG +P  DA+ +F ++
Sbjct: 4   NYFVRYVPLLIHLAVVTIIPVGMVILSWFVGQHKYNKAKMSAYECGMEPVGDAQSRFSVK 63

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG-----FGSMMVFLGILTVGFIYEWKKGA 117
           F LV++LF++FD+E  F++PWA+ FK +   G     +  M+V++ I+  GF Y WKKG 
Sbjct: 64  FYLVAILFILFDVEAVFMYPWAIIFKDLKNAGAALFAYSEMLVYVLIVLAGFFYIWKKGV 123

Query: 118 LEWD 121
           L+W+
Sbjct: 124 LDWN 127


>gi|13561112|emb|CAC36258.1| NADH dehydrogenase subunit 3 [Rana cretensis]
 gi|14331078|emb|CAC41091.1| NADH dehydrogenase subunit 3 [Rana cretensis]
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFFIASLLSVILAAVSFWLPLVTPDTEKLSPYECGFDPMGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +T + + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPAPWAIQLPNPLTAIVWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|309380560|gb|ADO66127.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS I ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLISVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|148922776|ref|YP_001293782.1| NADH dehydrogenase subunit 3 [Nematalosa japonica]
 gi|148762654|dbj|BAF64095.1| NADH dehydrogenase subunit 3 [Nematalosa japonica]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IAS + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTIASLLSIILVIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW          ++W         L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLTNPLITVSW-----ATAILALLTLGLVYEWTQGGLEW 114


>gi|87123075|ref|ZP_01078926.1| NADH dehydrogenase alpha subunit [Synechococcus sp. RS9917]
 gi|86168795|gb|EAQ70051.1| NADH dehydrogenase alpha subunit [Synechococcus sp. RS9917]
          Length = 120

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQQGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS 120


>gi|309380566|gb|ADO66130.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380574|gb|ADO66134.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380576|gb|ADO66135.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIVW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|315487858|gb|ADU32579.1| NADH dehydrogenase subunit III [Motacilla alba]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L    ++ A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   VLFMFTLSLALSILLTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTTTLIWASSLIFL--LTLGLVYEWLQGGLEW 114


>gi|308745920|ref|YP_003934408.1| NADH dehydrogenase subunit 3 [Leiocassis longirostris]
 gi|290758089|gb|ADD53036.1| NADH dehydrogenase subunit 3 [Leiocassis longirostris]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V MAI++A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMVMMAISTALSMILALVSFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       ++    +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLPDPSYTLLWAATVLI-LLTLGLIYEWIQGGLEW 114


>gi|309380616|gb|ADO66155.1| NADH dehydrogenase subunit 3 [Rana shqiperica]
 gi|309380618|gb|ADO66156.1| NADH dehydrogenase subunit 3 [Rana shqiperica]
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPSPLVTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|309380596|gb|ADO66145.1| NADH dehydrogenase subunit 3 [Rana cretensis]
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFFIASLLSVILAAVSFWLPLVTPDTEKLSPYECGFDPMGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +T + + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPXPWAIQLPNPLTAIVWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|213136033|gb|ACJ43590.1| NADH dehydrogenase subunit 3 [Cynops orphicus]
          Length = 115

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 4/100 (4%)

Query: 23  IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF- 81
           IVL++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF++FDLEIA L  
Sbjct: 16  IVLILVSFWLPLNNPDTEKLSPYECGFDPVGSARLPFSIRFFLIAILFLLFDLEIALLLP 75

Query: 82  -PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            PWA     +  L + +  + L ILTVG +YEW +G LEW
Sbjct: 76  TPWASQMHPVNTLFWST--IILIILTVGLVYEWAQGGLEW 113


>gi|21950292|gb|AAM23028.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
 gi|21950294|gb|AAM23029.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
 gi|21950298|gb|AAM23031.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
 gi|21950300|gb|AAM23032.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
 gi|21950302|gb|AAM23033.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + +++++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF L+++LF++FD
Sbjct: 8   LILSTSLSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +     +TW         L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLSTLTWTS-----TILVLLTLGLIYEWTQGGLEW 114


>gi|311033319|ref|ZP_07711409.1| NADH dehydrogenase subunit A [Bacillus sp. m3-13]
          Length = 124

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 74/115 (64%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y  ++VF+A+   + +V +    ++    P   K +TYE G DPF D+RV+F++R+ +
Sbjct: 9   NNYLIVVVFLALGVLLPVVALAIGRVLRPNKPSAAKQTTYESGIDPFHDSRVQFNVRYYI 68

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV ++++       M++F+ +L +G IY WKK  L+W
Sbjct: 69  FALLFVIFDVETVFLYPWAVAYEKLGIFALIEMLIFVVLLLIGLIYAWKKKVLKW 123


>gi|148266254|ref|YP_001232960.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Geobacter
           uraniireducens Rf4]
 gi|223635440|sp|A5G9B9|NUOA2_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|146399754|gb|ABQ28387.1| NADH dehydrogenase subunit A [Geobacter uraniireducens Rf4]
          Length = 118

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 64/91 (70%)

Query: 31  IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQI 90
           ++  K P   K++ YECG +P   AR +F I+F ++++LF++FD+E  FL+PWAV FK++
Sbjct: 28  LIGQKKPSVVKMAPYECGCEPVGSARERFSIKFYIIAMLFILFDIEAVFLYPWAVLFKRL 87

Query: 91  TWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
              G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 88  GMFGLMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|194336922|ref|YP_002018716.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|223635468|sp|B4SBZ3|NUOA_PELPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|194309399|gb|ACF44099.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 143

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  +  F+A+    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSNFGNVFAFLALGVVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALIEALVFAGILVLGLAYAWVKGDLDW 120


>gi|192293772|ref|YP_001994334.1| NADH dehydrogenase subunit 3 [Normichthys operosus]
 gi|190715192|dbj|BAG49430.1| NADH dehydrogenase subunit 3 [Normichthys operosus]
          Length = 115

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I +A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF++FD
Sbjct: 7   MLITAALSVILTIVAFWLPLMNPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFD 66

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA          F    V L +LT+G IYEW +G LEW
Sbjct: 67  LEIALLLPLPWATQLLTPV-HTFLWATVVLALLTLGLIYEWTQGGLEW 113


>gi|157098401|gb|ABV23447.1| NADH dehydrogenase subunit 3 [Myrmotherula longicauda]
 gi|301322981|gb|ADK70262.1| NADH dehydrogenase subunit 3 [Myrmotherula klagesi]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ILFMLTLSSSLSIILTMLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW       V +  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTW-----SFVIIIFLTLGLVYEWTQGGLEW 114


>gi|157098399|gb|ABV23446.1| NADH dehydrogenase subunit 3 [Myrmotherula brachyura]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L    F ++  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTTLNFWLSQMNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW         + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTW-----SFAIITLLTLGLVYEWIQGGLEW 114


>gi|57639709|gb|AAW55701.1| NADH dehydrogenase subunit 3 [Zamia integrifolia]
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +API +++ I+S + ++ +  PF  A  S   PE+LS +ECG DP  DAR +FDIR   V
Sbjct: 2   FAPICIYLVISSLVPLIPLGVPFPFAPNSSTYPERLSAHECGSDPSGDARSRFDIRSHPV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            + F+I D E+ F FP AV   +I   G  SMMVF  I T+G  +EWKKGA
Sbjct: 62  PISFIISDPEVTFSFPRAVPPNKIDPFGSRSMMVFSLIPTIGSPHEWKKGA 112


>gi|6714882|gb|AAF26195.1| NADH dehydrogenase subunit III [Pteroptochos tarnii]
 gi|6714883|gb|AAF26196.1| NADH dehydrogenase subunit III [Pteroptochos tarnii]
 gi|6714884|gb|AAF26197.1| NADH dehydrogenase subunit III [Pteroptochos tarnii]
 gi|6714885|gb|AAF26198.1| NADH dehydrogenase subunit III [Pteroptochos tarnii]
 gi|6714886|gb|AAF26199.1| NADH dehydrogenase subunit III [Pteroptochos tarnii]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I+ ++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLMISISLSIILTTLNFWLAQMNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + + ++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWATSIII--ILTLGLVYEWLQGGLEW 114


>gi|309380444|gb|ADO66069.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|309380446|gb|ADO66070.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
          Length = 113

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|31282887|gb|AAP15291.1| NADH dehydrogenase subunit 3 [Malurus melanocephalus]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++  + IVL    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMLTLSLTLSIVLTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +    L F      + ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPI-LTFTWTSALIIILTLGLVYEWTQGGLEW 114


>gi|31282817|gb|AAP15256.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282819|gb|AAP15257.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282821|gb|AAP15258.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282825|gb|AAP15260.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282829|gb|AAP15262.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282831|gb|AAP15263.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|31282839|gb|AAP15267.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282841|gb|AAP15268.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282843|gb|AAP15269.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282845|gb|AAP15270.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282847|gb|AAP15271.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282849|gb|AAP15272.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282851|gb|AAP15273.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leucopterus]
 gi|31282853|gb|AAP15274.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282855|gb|AAP15275.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282857|gb|AAP15276.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282861|gb|AAP15278.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282863|gb|AAP15279.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282865|gb|AAP15280.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282867|gb|AAP15281.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282869|gb|AAP15282.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282871|gb|AAP15283.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282873|gb|AAP15284.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282875|gb|AAP15285.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282877|gb|AAP15286.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282881|gb|AAP15288.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|31282883|gb|AAP15289.1| NADH dehydrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|312126003|gb|ADQ27945.1| NADH dehyrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|312126005|gb|ADQ27946.1| NADH dehyrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|312126007|gb|ADQ27947.1| NADH dehyrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|312126009|gb|ADQ27948.1| NADH dehyrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|312126011|gb|ADQ27949.1| NADH dehyrogenase subunit 3 [Malurus leucopterus edouardi]
 gi|312126013|gb|ADQ27950.1| NADH dehyrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|312126015|gb|ADQ27951.1| NADH dehyrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|312126017|gb|ADQ27952.1| NADH dehyrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|312126019|gb|ADQ27953.1| NADH dehyrogenase subunit 3 [Malurus leucopterus leuconotus]
 gi|312126021|gb|ADQ27954.1| NADH dehyrogenase subunit 3 [Malurus leucopterus leuconotus]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVVFMLTLSLTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L        + ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPT-LTLAWTSALITILTLGLVYEWIQGGLEW 114


>gi|33860852|ref|NP_892413.1| NADH dehydrogenase subunit A [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|81711988|sp|Q7TUF8|NU3C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33633794|emb|CAE18753.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
          Length = 120

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ I+ +++  IV+ K    E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYEYFLGFLIIAAAVPILALVTNLIVSPKGRTGERKLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFITILVIALAYAWRKGALEWS 120


>gi|165932529|ref|YP_001650769.1| NADH dehydrogenase subunit 3 [Solenostomus cyanopterus]
 gi|154758744|dbj|BAF74893.1| NADH dehydrogenase subunit 3 [Solenostomus cyanopterus]
          Length = 116

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + I+ A+ I+L++  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   LMISMALSIILILVSFFLPAMSPDNEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA + +    L F      L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWANHMET-PLLTFTWAYSVLTLLTLGLIYEWIQGGLEW 114


>gi|119360213|ref|YP_913335.1| NADH dehydrogenase subunit 3 [Tinca tinca]
 gi|119225017|dbj|BAF41396.1| NADH dehydrogenase subunit 3 [Tinca tinca]
          Length = 116

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIITITMALSLILAIVSFWLPQMAPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F + MV + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATMVLV-LLTLGLIYEWTQGGLEW 114


>gi|25006430|dbj|BAC23926.1| NADH dehydrogenase subunit 3 [Erpetoichthys calabaricus]
 gi|44843569|emb|CAE48123.1| NADH deydrogenase subunit 3 [Erpetoichthys calabaricus]
 gi|296099536|gb|ADG95147.1| NADH dehydrogenase subunit 3 [Erpetoichthys calabaricus]
          Length = 115

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I+S I I L    F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   ILTMILISSLISITLAFVAFWLPQMNPDMEKLSPYECGFDPLGSARLPFSMRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW+++   +  L +  M++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWSIHLNPLYVLMWAFMIIML--LTIGLIYEWVQGGLEW 113


>gi|13561098|emb|CAC36251.1| NADH dehydrogenase subunit 3 [Rana cf. ridibunda]
          Length = 113

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILTAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMAIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|299825768|ref|YP_003734696.1| NADH dehydrogenase subunit 3 [Coilia lindmani]
 gi|299758161|dbj|BAJ09851.1| NADH dehydrogenase subunit 3 [Coilia lindmani]
          Length = 116

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I++A+ +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTVLMISTALSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW    ++       +++V +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLQEPKTTLIWAILV-IGLLTLGLIYEWLQGGLEW 114


>gi|220909535|ref|YP_002484846.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 7425]
 gi|219866146|gb|ACL46485.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7425]
          Length = 120

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ I S + ++ + +  IV  KS    +++TYE G +P  +A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLLICSLVPVLALGASAIVRPKSQGVSRVTTYESGMEPIGEAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL  G +Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGVLAFIEALIFIAILVFGLVYAWRKGALEWS 120


>gi|62161373|ref|YP_214804.1| NADH dehydrogenase subunit 3 [Ambystoma dumerilii]
 gi|49066300|gb|AAT49243.1| NADH dehydrogenase subunit 3 [Ambystoma dumerilii]
          Length = 115

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 75/112 (66%), Gaps = 5/112 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+FM  +S + ++L++  F +   +PD EKLS YECGFDP+  AR+ F IRF LV++LF
Sbjct: 5   MLMFM-FSSMLSLILIMVGFWIPMSNPDTEKLSPYECGFDPWGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEI  L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 64  LLFDLEIGLLLPTPWALQLNPTNTLTWATLI--LALLTVGLIYEWIQGGLDW 113


>gi|47777260|ref|YP_022508.1| NADH dehydrogenase subunit 3 [Buergeria buergeri]
 gi|47604876|dbj|BAD20558.1| NADH dehydrogenase subunit 3 [Buergeria buergeri]
          Length = 114

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 9/115 (7%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+ F+ +AS +  +++   F +   +PDPEKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 2   IIAFIILASTVSAIVLTIAFWLPTITPDPEKLSPYECGFDPLGSARLPYSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMM---VFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     T     ++M   + L +LT GF YEWK+  LEW
Sbjct: 62  LLFDLEIALLLPTPWAIQLPHPT----SAIMWASIILILLTAGFAYEWKQAGLEW 112


>gi|62901792|gb|AAY18847.1| NADH dehydrogenase subunit 3 [Chloroceryle americana]
          Length = 116

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 71/113 (62%), Gaps = 6/113 (5%)

Query: 12  LVFM-AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM  +++AI   L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLTLSTAISTALTTLNFWLAQTTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      +  L + S ++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLHSPMNTLAWTSTILML--LTLGLIYEWLQGGLEW 114


>gi|295821503|gb|ADG36476.1| NADH dehydrogenase subunit 3 [Dendrexetastes rufigula]
          Length = 116

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +   +  F    + + +LT+G IYEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLY-TFTWTSIIITLLTLGLIYEWTQGGLEW 114


>gi|269218337|ref|ZP_06162191.1| NADH dehydrogenase I, A subunit [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269212196|gb|EEZ78536.1| NADH dehydrogenase I, A subunit [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 119

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 75/119 (63%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFD--PFDDARVKFDIR 62
           + SY P+LV +A A+A+ I  ++    +  K  +  KL  YECG +  P    R +F I+
Sbjct: 1   MNSYVPLLVMIAAAAALSIGGLVMSSFLGPKRHNRVKLENYECGVEATPAASGRGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++ F++FD+E+ FL+PWAV F ++   G  +M+ F+ ++ V F+YEW++G LEWD
Sbjct: 61  YYLTAMTFIVFDIEVVFLYPWAVSFHKLGLFGVVAMLSFVFLIAVPFVYEWRRGGLEWD 119


>gi|116071576|ref|ZP_01468844.1| NADH dehydrogenase alpha subunit [Synechococcus sp. BL107]
 gi|116065199|gb|EAU70957.1| NADH dehydrogenase alpha subunit [Synechococcus sp. BL107]
          Length = 120

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 120


>gi|322422655|ref|YP_004222221.1| NADH dehydrogenase subunit 3 [Pollachius pollachius]
 gi|317423500|emb|CBY85649.1| NADH dehydrogenase 3 [Pollachius pollachius]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ +VL++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLVLIVVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       + L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPS-LTFAWATSVLALLTLGLIYEWLQGGLEW 114


>gi|301322977|gb|ADK70260.1| NADH dehydrogenase subunit 3 [Myrmotherula pacifica]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++S++ I+L +    +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSSSLSIILTLLNLWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L    +M+ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQFPLTTLTCSFVMIIL--LTLGLIYEWIQGGLEW 114


>gi|264669403|gb|ACY72162.1| NADH dehydrogenase subunit 3 [Iole palawanensis]
 gi|264669405|gb|ACY72163.1| NADH dehydrogenase subunit 3 [Iole palawanensis]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  ++++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMISLSLTLSIALTALNFWLALMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV  +  T  L + S ++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLESPTITLMWASTLII--ILTLGLVYEWTQGGLEW 114


>gi|164421027|ref|YP_001648478.1| NADH dehydrogenase subunit 3 [Aplysina fulva]
 gi|158668076|gb|ABW76539.1| NADH dehydrogenase subunit 3 [Aplysina fulva]
          Length = 117

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I + +  + ++  V+  + +IV  K PD EK+S YECGFDPF+ +R  F +RF 
Sbjct: 1   MSDYLGIFLLLLFSVSLSTVISGASYIVGVKQPDCEKVSIYECGFDPFESSRAPFSVRFF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV +LF+IFDLEI+FLFPW+V   QI  LGF  +++FL ILT+G IYEW  G L+W+
Sbjct: 61  LVGILFMIFDLEISFLFPWSVTSNQIDLLGFWILILFLIILTLGLIYEWILGGLDWE 117


>gi|78183814|ref|YP_376248.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9902]
 gi|123582228|sp|Q3B0C3|NU3C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78168108|gb|ABB25205.1| putative NADH dehydrogenase subunit [Synechococcus sp. CC9902]
          Length = 120

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 120


>gi|13560229|emb|CAC36190.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|14331068|emb|CAC41086.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|309380540|gb|ADO66117.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380542|gb|ADO66118.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380550|gb|ADO66122.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
          Length = 113

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|57639699|gb|AAW55696.1| NADH dehydrogenase subunit 3 [Philodendron hederaceum var.
           oxycardium]
          Length = 105

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIRF LVS
Sbjct: 1   APICIYLVISPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYE 112
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YE
Sbjct: 61  ILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYE 105


>gi|88808083|ref|ZP_01123594.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 7805]
 gi|88788122|gb|EAR19278.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 7805]
          Length = 120

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQAGERQLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS 120


>gi|213136425|gb|ACJ43954.1| NADH dehydrogenase subunit 3 [Tylototriton asperrimus]
          Length = 115

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I +A+  +L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMLMLLITTALSTLLIALGFWLPLNNPDMEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L + ++++ L  LTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMLPTNTLLWSTIILLL--LTVGLVYEWAQGGLEW 113


>gi|309380432|gb|ADO66063.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380438|gb|ADO66066.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380440|gb|ADO66067.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFCIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|6714875|gb|AAF26188.1| NADH dehydrogenase subunit III [Scytalopus magellanicus]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ ++  +L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTVSISLSTILTTLNFWLAQTNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW      M  + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTW-----AMTIIILLTLGLVYEWTQGGLEW 114


>gi|23428684|gb|AAM00154.1| NADH dehydrogenase subunit 3 [Xiphorhynchus spixii ornatus]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L  + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   MLFMLTLSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +  L + S ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLXTLTWTSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|309380580|gb|ADO66137.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380582|gb|ADO66138.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380584|gb|ADO66139.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
          Length = 113

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|280978525|ref|YP_003345444.1| NADH dehydrogenase subunit 3 [Myrichthys maculosus]
 gi|271280646|dbj|BAI53426.1| NADH dehydrogenase subunit 3 [Myrichthys maculosus]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PIL  ++I  A+  +LM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PILSTISITMALSCILMTISFWLPQMNPDLEKLSPYECGFDPIGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW      +T   F +M + + +LT G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDVTQTLFWAMFILI-LLTAGLIYEWVQGGLEW 114


>gi|94481744|gb|ABF21453.1| NADH dehydrogenase subunit 3 [Merlangius merlangus]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++LM+  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILMLVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPA-LTFTWTTSVLALLTLGLIYEWLQGGLEW 114


>gi|23428676|gb|AAM00150.1| NADH dehydrogenase subunit 3 [Xiphorhynchus ocellatus brevirostris]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LVLSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLSTLTWTSTIIVL--LTLGLIYEWAQGGLEW 114


>gi|49146202|ref|YP_025982.1| NADH dehydrogenase subunit 3 [Anseranas semipalmata]
 gi|41058354|gb|AAP47787.1| NADH dehydrogenase subunit 3 [Anseranas semipalmata]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 73/113 (64%), Gaps = 6/113 (5%)

Query: 12  LVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM   S  + I L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLTLSFTLSIALTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWTSTILFL--LTLGLVYEWIQGGLEW 114


>gi|219524170|ref|YP_002456317.1| NADH dehydrogenase subunit 3 [Accipiter gentilis]
 gi|218783319|dbj|BAH03688.1| NADH dehydrogenase subunit 3 [Accipiter gentilis]
          Length = 116

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 6/113 (5%)

Query: 12  LVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + FM + S  + I+L+     +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ITFMLMLSLTLSIILITLNLWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +   T L +  +M++L  LT+G IYEW +GALEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPTTTLTWAFIMIYL--LTLGLIYEWIQGALEW 114


>gi|157381853|gb|ABV46747.1| NADH dehydrogenase subunit 3 [Heniochus varius]
          Length = 115

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IA+A+ ++L+I  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMTIITIAAALSLILIIVSFWLPLMNPDHEKLSPYECGFDPLGTARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLSS-PLLTFLWASAVLALLTLGLIYEWLQGGLEW 114


>gi|258593434|emb|CBE69773.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PI + + +A+   +V ++   ++  + P   KL+ YECG DP   AR +F ++F
Sbjct: 1   MLISYLPIFILILLAAGFALVTLLLSHVLGPRRPTRSKLTPYECGIDPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFD+EI FL+PWAV    +   G   M++FLGIL +G +Y WKKG LEW
Sbjct: 61  YLVAMLFIIFDIEIVFLYPWAVILNSLKLFGLIEMILFLGILLIGLLYVWKKGGLEW 117


>gi|164565486|ref|YP_001649202.1| NADH dehydrogenase subunit 3 [Seriatopora caliendrum]
 gi|148669082|gb|ABR01629.1| NADH dehydrogenase subunit 3 [Seriatopora caliendrum]
          Length = 114

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           F++  K+PD EK+S YECGF PF+     F IRF L+ +LF+IFDLEI+F FPW V +  
Sbjct: 23  FLIGEKTPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYNS 82

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
               GF +M+ F  +L +G IYEW  G LEW+
Sbjct: 83  TAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114


>gi|238908287|emb|CAX36711.1| NADH dehydrogenase subunit 3 [Charadrius modestus]
 gi|238908289|emb|CAX36712.2| NADH dehydrogenase subunit 3 [Charadrius modestus]
 gi|238908291|emb|CAX36713.2| NADH dehydrogenase subunit 3 [Charadrius modestus]
 gi|238908293|emb|CAX36714.2| NADH dehydrogenase subunit 3 [Charadrius modestus]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTLSFILSIILTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  ++ L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPLSTLAWASTIITL--LTLGLIYEWTQGGLEW 114


>gi|308745798|ref|YP_003934217.1| NADH dehydrogenase subunit 3 [Chrysolophus pictus]
 gi|238550656|gb|ACR44502.1| NADH dehydrogenase subunit 3 [Chrysolophus pictus]
 gi|307133852|gb|ADN32862.1| NADH dehydrogenase subunit 3 [Chrysolophus pictus]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 4/112 (3%)

Query: 12  LVFM-AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM +++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLSLSFTLSIALTTLNFWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  T +      + + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPT-MTLTWTTIIIALLTLGLIYEWMQGGLEW 114


>gi|282897134|ref|ZP_06305136.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Raphidiopsis
           brookii D9]
 gi|281197786|gb|EFA72680.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Raphidiopsis
           brookii D9]
          Length = 120

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ + S +  + + +  I+   S  PE+ +TYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLILCSLVPALALSASKILRPSSYSPERRTTYESGMEPFGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVIALVYAWRKGALEWS 120


>gi|237648859|dbj|BAH58955.1| NADH dehydrogenase subunit 3 [Notopterus notopterus]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/106 (50%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IA+A+  VL I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF++FDLE
Sbjct: 10  IATALSCVLAIIAFWIPQMSPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F    V L +LT+G +YEW +G LEW
Sbjct: 70  IALLLPLPWGDQLTTPT-LTFIWATVILTLLTLGLVYEWLQGGLEW 114


>gi|71067599|gb|AAZ22823.1| NADH dehydrogenase subunit 3 [Pogonocichla stellata]
 gi|71067601|gb|AAZ22824.1| NADH dehydrogenase subunit 3 [Pogonocichla stellata]
 gi|71067603|gb|AAZ22825.1| NADH dehydrogenase subunit 3 [Pogonocichla stellata]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMIALSLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S ++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTTTLIWASALIL--ILTLGLVYEWIQGGLEW 114


>gi|238550558|gb|ACR44411.1| NADH dehydrogenase subunit 3 [Alectoris chukar]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 73/113 (64%), Gaps = 6/113 (5%)

Query: 12  LVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM  +S A+   L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLSSSFALSTALTTINFWLAQMNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  +T L + + ++   +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQFPMTTLTWATTLI--ALLTLGLIYEWTQGGLEW 114


>gi|157098391|gb|ABV23442.1| NADH dehydrogenase subunit 3 [Myrmochanes hemileucus]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLALSSSLSIILTLLNFWLAQMNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +  ++V    LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQFPLTTLTWSFIIVI--FLTLGLVYEWIQGGLEW 114


>gi|134303117|ref|YP_001122868.1| NADH dehydrogenase subunit 3 [Macrochelys temminckii]
 gi|116739707|gb|ABK20579.1| NADH dehydrogenase subunit 3 [Macrochelys temminckii]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M IA A+ ++LM+  + +    PD EKLS YECGFDP + A + F IRF LV++LF++FD
Sbjct: 8   MTIALALSMILMLLNYWLTLMKPDNEKLSPYECGFDPLESAHLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV     T     + ++ L ++T+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLLSPTHTLLWAFII-LFLMTLGLIYEWIQGGLEW 114


>gi|37928542|gb|AAP68813.1| NADH dehydrogenase subunit 3 [Nectarinia minulla]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++  + I L +  F +A  +PD EKLS YECGFDP   AR+ F IRF +V++LF
Sbjct: 4   ILFMITLSLTLSIALTLLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFMVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV  +   T L     ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLQSPATTLALAFSLIFL--LTLGLIYEWIQGGLEW 114


>gi|165932459|ref|YP_001650743.1| NADH dehydrogenase subunit 3 [Macroramphosus scolopax]
 gi|154758870|dbj|BAF75010.1| NADH dehydrogenase subunit 3 [Macroramphosus scolopax]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA A+ +VL +  F +   +PDPEKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIVAIAVALSMVLALVSFWLPQITPDPEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW        +T+L   S+   L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLSSPLVTFLWAASV---LTLLTIGLIYEWVQGGLEW 114


>gi|49237429|gb|AAT57976.1| NADH dehydrogenase subunit 3 [Nectarinia mediocris]
          Length = 111

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSIALTALNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  T  L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPTATLALASSLIFL--LTLGLIYEWIQGGLEW 109


>gi|13605458|gb|AAK32723.1| NADH dehydrogenase subunit 3 [Allium sativum]
          Length = 107

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 57/81 (70%)

Query: 39  PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSM 98
           PEKLS +ECG DP  DAR +FDIRF LV +LF+I D E+ F  PWAV   +I   G  SM
Sbjct: 25  PEKLSAHECGSDPSGDARSRFDIRFYLVPILFIIPDPEVTFSSPWAVPPNKIDPFGSWSM 84

Query: 99  MVFLGILTVGFIYEWKKGALE 119
           M FL ILT+G +YEWK+GA +
Sbjct: 85  MAFLLILTIGSLYEWKRGASD 105


>gi|161867870|ref|YP_001600212.1| NADH dehydrogenase subunit 3 [Boreogadus saida]
 gi|94481658|gb|ABF21374.1| NADH dehydrogenase subunit 3 [Boreogadus saida]
 gi|161724991|emb|CAP46965.1| NADH dehydrogenase 3 [Boreogadus saida]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFTWATSVLALLTLGLIYEWLQGGLEW 114


>gi|14331074|emb|CAC41089.1| NADH dehydrogenase subunit 3 [Rana cf. ridibunda]
 gi|309380586|gb|ADO66140.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 2']
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSMILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|254054997|ref|YP_003058237.1| NADH dehydrogenase subunit 3 [Oryzias minutillus]
 gi|253960457|dbj|BAH84939.1| NADH dehydrogenase subunit 3 [Oryzias minutillus]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + V M I+ AI +VL I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTVMMLISMAISMVLAIVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWADQLSS-PLLTFSWASAILVLLTLGLIYEWTQGGLEW 114


>gi|309380468|gb|ADO66081.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician East']
 gi|309380472|gb|ADO66083.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician East']
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +    + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTTIWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|296940301|ref|YP_003667980.1| NADH dehydrogenase subunit 3 [Acryllium vulturinum]
 gi|224503975|gb|ACN53560.1| NADH dehydrogenase subunit 3 [Acryllium vulturinum]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M+++ A+   L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   MSLSFALSTALTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +  +T L + + ++   +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQYPLTTLTWATTII--SLLTLGLIYEWTQGGLEW 114


>gi|193882360|gb|ACF25857.1| NADH dehydrogenase subunit 3 [Illadopsis puveli]
 gi|193882366|gb|ACF25860.1| NADH dehydrogenase subunit 3 [Illadopsis puveli]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 73/113 (64%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           I++FM I S  + ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   IIMFMFILSLTLSVILTALNFWLAGINPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L      + + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQNPT-LTLMWASILISLLTLGLIYEWLQGGLEW 114


>gi|325460991|gb|ADZ14609.1| NADH dehydrogenase subunit 3 [Limnonectes kohchangae]
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F+++   I+++L +  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLIFISMTILIIVILAMVSFWLPLINPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      I  + + S+++ L  LTVGFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWATQLSNPILTILWASLILIL--LTVGFIYEWFQGGLEW 111


>gi|109727627|gb|ABG46111.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1539]
 gi|109727630|gb|ABG46113.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1735]
 gi|109727645|gb|ABG46123.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 829]
 gi|152148778|gb|ABS29918.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1225]
 gi|152148781|gb|ABS29920.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1226]
 gi|152148784|gb|ABS29922.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1227]
 gi|152148787|gb|ABS29924.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1228]
 gi|152148790|gb|ABS29926.1| NADH dehydrogenase subunit 3 [Rana cf. labialis FRIM 1231]
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTILISLILAVISFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S  V + +LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWAS--VIITLLTLGFIYEWLQGALEW 111


>gi|309380538|gb|ADO66116.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF L+++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLMAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|218440673|ref|YP_002379002.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 7424]
 gi|218173401|gb|ACK72134.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7424]
          Length = 120

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S + I+ + +  ++      PE+L+TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLTCSLVPILALTASKLLRPSGGGPERLTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGILAFVEALIFIAILVVALVYAWRKGALEWS 120


>gi|113171314|gb|ABI30703.1| NADH dehydrogenase subunit 3 [Yuhina castaniceps]
 gi|220900372|gb|ACL82386.1| NADH dehydrogenase subunit 3 [Yuhina castaniceps]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIALTALNFWIAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +   T L + S ++   ILT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQNPTTTLIWTSTLII--ILTLGLVYEWAQGGLEW 114


>gi|23428736|gb|AAM00180.1| NADH dehydrogenase subunit 3 [Xiphorhynchus ocellatus chunchotambo]
          Length = 111

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   LVLSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPLSTLTWTSTIIVL--LTLGLIYEWAQGGLEW 109


>gi|300508221|dbj|BAJ10953.1| NADH dehydrogenase subunit 3 [Rana rugosa]
          Length = 113

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 76/112 (67%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++AS + ++L +  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MIMFFSMASLLSVILAMISFWLPLITPDAEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLFP--WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P  WA+     T + F + ++ + +LT GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTTWAMQLPYPTLMIFWASIIII-LLTAGFIYEWLQGGLEW 111


>gi|238550642|gb|ACR44489.1| NADH dehydrogenase subunit 3 [Lophophorus sclateri]
          Length = 116

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  
Sbjct: 23  FWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQL 82

Query: 88  KQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +     +TW      M+ + +LT+G IYEW +G LEW
Sbjct: 83  QSPITTLTW-----TMIIITLLTLGLIYEWMQGGLEW 114


>gi|280978329|ref|YP_003345262.1| NADH dehydrogenase subunit 3 [Facciolella oxyrhyncha]
 gi|271280753|dbj|BAI53477.1| NADH dehydrogenase subunit 3 [Facciolella oxyrhyncha]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 72/113 (63%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I S +  +L++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITSTLSCILIVVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW     + T   F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPEATQTFFWAMSILI-LLTLGLVYEWIQGGLEW 114


>gi|194303813|gb|ACF41344.1| NADH dehydrogenase subunit 3 [Gadus morhua]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ +VL++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLVLILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFMWATSVLALLTLGLIYEWLQGGLEW 114


>gi|108937499|ref|YP_654157.1| NADH dehydrogenase subunit 3 [Batrachuperus mustersi]
 gi|84371681|gb|ABC56119.1| NADH dehydrogenase subunit 3 [Batrachuperus mustersi]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 78/114 (68%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I++ + ++L+ + F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMIMVMISAILSLILITASFWLPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWA--VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA  + F + T++   S M+ L +L+VG IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLIFPEYTFM--WSTMI-LALLSVGLIYEWIQGGLEW 114


>gi|302201516|gb|ADL09079.1| NADH dehydrogenase subunit 3 [Nyctibius griseus]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM I S  +  +L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMFILSITLSTILTLLNFWLAQITPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWAV  +   T L + ++++FL  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAVQLQSPTTTLTWATIIIFL--LTLGLVYEWIQGGLEW 114


>gi|256576350|gb|ACU87954.1| NADH dehydrogenase subunit 3 [Rhipidura superciliaris]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 75/117 (64%), Gaps = 12/117 (10%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMIILSMALSIALTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +     +TW    S ++ L  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQNPAITLTW---ASTIIVL--LTLGLVYEWTQGGLEW 114


>gi|116075554|ref|ZP_01472813.1| NADH dehydrogenase subunit A [Synechococcus sp. RS9916]
 gi|116066869|gb|EAU72624.1| NADH dehydrogenase subunit A [Synechococcus sp. RS9916]
          Length = 134

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+  + +I+  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 18  LPGYDAFLGFLLIAAAVPALALITNKLLAPRSQQGEREITYESGMEPIGGAWIQFNIRYY 77

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 78  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS 134


>gi|74315085|ref|YP_313649.1| NADH dehydrogenase subunit 3 [Merlangius merlangus]
 gi|66802165|gb|AAY56616.1| NADH dehydrogenase subunit 3 [Merlangius merlangus]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++LM+  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILMLVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       + L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPS-LTFMWATSVLALLTLGLIYEWLQGGLEW 114


>gi|164519159|ref|YP_001648858.1| NADH dehydrogenase subunit 3 [Hyla japonica]
 gi|164454419|dbj|BAF96758.1| NADH dehydrogenase subunit 3 [Hyla japonica]
          Length = 113

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 14  FMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIF 73
           ++ IA  + +VL    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF++F
Sbjct: 4   YVLIALVLSLVLAFISFWLPSLSPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLF 63

Query: 74  DLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           DLEIA L   PWA  F     + F S ++ L +LT+GFIYEW +G LEW
Sbjct: 64  DLEIALLLPTPWAAQFSHPILVIFWSSVILL-LLTLGFIYEWAQGGLEW 111


>gi|110348335|gb|ABG72860.1| NADH dehydrogenase subunit 3 [Ficedula superciliaris]
          Length = 116

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMIALSLGLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +  +++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPMTTLTWTYVLIFL--LTLGLVYEWIQGGLEW 114


>gi|119356789|ref|YP_911433.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           phaeobacteroides DSM 266]
 gi|223635446|sp|A1BF32|NUOA_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|119354138|gb|ABL65009.1| NADH dehydrogenase subunit A [Chlorobium phaeobacteroides DSM 266]
          Length = 143

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+S+  +  F+A+    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSSFGNVFAFLALGIVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FK +       ++VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKSLGVFALVEVLVFAGILILGLVYAWVKGDLDW 120


>gi|108793372|ref|YP_637095.1| NADH dehydrogenase subunit 3 [Gavia pacifica]
 gi|108755477|dbj|BAE95712.1| NADH dehydrogenase subunit 3 [Gavia pacifica]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  
Sbjct: 23  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +   T L + S+M+ L  LT+G IYEW +G LEW
Sbjct: 83  QSPTTTLTWASIMILL--LTLGLIYEWMQGGLEW 114


>gi|309380564|gb|ADO66129.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380568|gb|ADO66131.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
 gi|309380570|gb|ADO66132.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIVW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|31282823|gb|AAP15259.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 70/113 (61%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVVFMLTLSLTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L        + ILT G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQSPT-LTLAWTSALITILTXGLVYEWIQGGLEW 114


>gi|78188612|ref|YP_378950.1| NADH dehydrogenase I, subunit 3 [Chlorobium chlorochromatii CaD3]
 gi|123580177|sp|Q3ASW8|NUOA_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|78170811|gb|ABB27907.1| NADH dehydrogenase subunit A [Chlorobium chlorochromatii CaD3]
          Length = 146

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   LT +  + VF+ +    V+   ++  ++    P+P+K STYECG +    A VKF+
Sbjct: 1   MDQTLTQFGSVFVFLLLGVIFVVGGYLTSRLLRPSRPNPQKNSTYECGEEAIGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FK +       ++VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKPLGTFALIEVLVFAGILILGLAYAWVKGDLDW 120


>gi|152148685|gb|ABS29856.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148706|gb|ABS29870.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148709|gb|ABS29872.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148712|gb|ABS29874.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148715|gb|ABS29876.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148727|gb|ABS29884.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148730|gb|ABS29886.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148736|gb|ABS29890.1| NADH dehydrogenase subunit 3 [Rana eschatia]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTILISLLLTVISFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWASVIIIL--LTLGFIYEWLQGALEW 111


>gi|83031251|gb|ABB96804.1| NADH dehydrogenase subunit 3 [Mionectes oleagineus]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAI-ASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I ++++ I+L +    V   +PD EKLS YECGFDP   AR+ F IRF L+++L
Sbjct: 3   MIIFMFILSTSLSILLTMLNLWVTQSTPDSEKLSPYECGFDPLGSARLPFSIRFFLIAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +  +T L + S ++   +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPLTTLTWTSTIIL--VLTLGLIYEWAQGGLEW 114


>gi|88910861|gb|ABD58737.1| NADH dehydrogenase subunit 3 [Rynchops niger]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ A+ I+L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSLALSIILTTLNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV   Q            + +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQL-QSPTTTLTWTSTIIILLTLGLVYEWMQGGLEW 114


>gi|23428710|gb|AAM00167.1| NADH dehydrogenase subunit 3 [Dendrexetastes rufigula]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +   +  F    + + +LT+G IYEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLY-TFTWASIIITLLTLGLIYEWTQGGLEW 114


>gi|300508209|dbj|BAJ10944.1| NADH dehydrogenase subunit 3 [Rana holsti]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 5/111 (4%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F+ IAS +  +L    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   MFLFIASLLSAILATISFWIPLISPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA+  F  I  + + S+++ L  LT+GFIYEW +G LEW
Sbjct: 63  FDLEIALLLPAPWAIQLFNPILTIIWSSILIVL--LTLGFIYEWLQGGLEW 111


>gi|113955198|ref|YP_729478.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9311]
 gi|113882549|gb|ABI47507.1| NADH dehydrogenase I chain 3 (or A) [Synechococcus sp. CC9311]
          Length = 142

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 25  VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRY 84

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 85  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEWS 142


>gi|260842013|gb|ACX51067.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+      +T++ + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLVTFM-WASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|256576324|gb|ACU87941.1| NADH dehydrogenase subunit 3 [Rhipidura javanica]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM + S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMILLSMTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +   T L +  +++FL  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQNPTTTLMWAWILIFL--LTLGLVYEWTQGGLEW 114


>gi|312233274|ref|YP_004021492.1| NADH dehydrogenase subunit 3 [Occidozyga martensii]
 gi|268370768|gb|ACZ02644.1| NADH dehydrogenase subunit 3 [Occidozyga martensii]
          Length = 114

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF    S +V +L++  F +   SPD EKLS YECGF+P   AR+ + +RF LV++LF
Sbjct: 2   MLVFFFTTSLLVAILILLSFWMPLISPDTEKLSPYECGFEPLGSARLPYSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVY----FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        +TW  F      L +LTVGFIYEW +G LEW
Sbjct: 62  LLFDLEIALLLPTPWAIQLDCPLTTLTWALF-----ILVLLTVGFIYEWLQGGLEW 112


>gi|49658432|dbj|BAD27144.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILIVVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFMWTTSVLALLTLGLIYEWLQGGLEW 114


>gi|260841957|gb|ACX51039.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       + F    V + +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPN-PLMTFMWASVIVILLTLGFIYEWLQGGLEW 111


>gi|309380460|gb|ADO66077.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician West']
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 11/114 (9%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   LFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 63  FDLEIALLLPTPWAIQLPHPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|13561084|emb|CAC36247.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561086|emb|CAC36248.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561088|emb|CAC36249.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|309380544|gb|ADO66119.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380548|gb|ADO66121.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
 gi|309380552|gb|ADO66123.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
 gi|309380554|gb|ADO66124.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
 gi|309380556|gb|ADO66125.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
 gi|309380562|gb|ADO66128.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|152148526|gb|ABS29750.1| NADH dehydrogenase subunit 3 [Rana nigrovittata]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 74/112 (66%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F ++A+ I +VL +  F +   SPD EK S YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSMATTISVVLALVSFWLPLTSPDTEKTSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+         F + ++ + +LT+GF+YEW +G LEW
Sbjct: 61  LLFDLEIALLLPSPWAIQLPDPILTIFWASIIII-LLTLGFLYEWLQGGLEW 111


>gi|108561807|ref|YP_626680.1| NADH dehydrogenase subunit 3 [Hynobius chinensis]
 gi|284794694|ref|YP_003412051.1| NADH dehydrogenase subunit 3 [Hynobius guabangshanensis]
 gi|84371653|gb|ABC56093.1| NADH dehydrogenase subunit 3 [Hynobius chinensis]
 gi|284098149|gb|ADB78079.1| NADH dehydrogenase subunit 3 [Hynobius guabangshanensis]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I++ + +VL+   F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMIMVMISTILSLVLITVSFWLPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA       +    S M+ + +L+ G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLLSPEYTLLWSTMILI-LLSTGLIYEWIQGGLEW 114


>gi|320107660|ref|YP_004183250.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Terriglobus
           saanensis SP1PR4]
 gi|319926181|gb|ADV83256.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Terriglobus
           saanensis SP1PR4]
          Length = 135

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 74/122 (60%), Gaps = 6/122 (4%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+++ + +A  +    +   F++     +  KL  YECG DP  DAR +F +RF 
Sbjct: 7   LWNYLPLVMQVLVAIGLASAFVAISFVIGKHKRNKTKLGAYECGMDPVGDARGRFSVRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQI------TWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           +V++LF++FD+E  F+ PWAV F+++       + GF  M+V+LG + VG  Y WKKG L
Sbjct: 67  MVAMLFILFDVEAVFMLPWAVIFRRLPAITGQRFFGFWEMVVYLGFVGVGLFYVWKKGIL 126

Query: 119 EW 120
           +W
Sbjct: 127 DW 128


>gi|280978315|ref|YP_003345249.1| NADH dehydrogenase subunit 3 [Nemichthys scolopaceus]
 gi|271280497|dbj|BAI53322.1| NADH dehydrogenase subunit 3 [Nemichthys scolopaceus]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           +PI+  + I S I  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++
Sbjct: 2   SPIMSALVITSLISCVLITVSFWLPQMTPDSEKLSPYECGFDPLGSARLPFSMRFFLVAI 61

Query: 69  LFVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LF++FDLEIA L   PW     ++  + F +M + + +LT+G +YEW +G LEW
Sbjct: 62  LFLLFDLEIALLLPLPWGSQLPEMMIVLFWTMSIIV-VLTLGLVYEWVQGGLEW 114


>gi|13561096|emb|CAC36250.1| NADH dehydrogenase subunit 3 [Rana cf. ridibunda]
          Length = 113

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMIIVW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|72383496|ref|YP_292851.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL2A]
 gi|124025087|ref|YP_001014203.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL1A]
 gi|123621503|sp|Q46M04|NU3C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|223635398|sp|A2C0C8|NU3C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|72003346|gb|AAZ59148.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL2A]
 gi|123960155|gb|ABM74938.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. NATL1A]
          Length = 120

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 73/117 (62%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I+ A+ I+ + +  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LQGYEYFLGFLLISGAVPILALTTNKLIAPKSKAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALVFITILVVALAYAWRKGALEWS 120


>gi|25005992|dbj|BAC23612.1| NADH dehydrogenase subunit 3 [Synbranchus marmoratus]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           ++ FM+IA  + ++L +  F +    PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   MMTFMSIALVLSLILSVIAFWLPLTKPDHEKLSPYECGFDPLGTARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW           F +  V L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGSQLTNPLLTLFWASTVLL-LLTIGLIYEWLQGGLEW 114


>gi|332887120|dbj|BAK23219.1| NADH dehydrogenase subunit 3 [Barilius bendelisis]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (62%), Gaps = 10/115 (8%)

Query: 15  MAIASAIVIVLMISPFIVAF-------KSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           M + +A++I+ M+ P I+A         +PD EKLS YECGFDP   AR+ F +RF LV+
Sbjct: 1   MNLITAMIIIAMVLPIILAMVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVA 60

Query: 68  VLFVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FDLEIA L   PW +  +      F +  V + +LT+G IYEW +G LEW
Sbjct: 61  ILFLLFDLEIALLLPLPWGIQLQDPAGTLFWATAVLI-LLTLGLIYEWTQGGLEW 114


>gi|213135977|gb|ACJ43538.1| NADH dehydrogenase subunit 3 [Chioglossa lusitanica]
          Length = 115

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I+  +  VL+I  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITLMLLISMILSAVLIIISFWLPLNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L + + ++FL  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLLPLNTLFWSTFILFL--LTLGLIYEWLQGGLEW 113


>gi|223635449|sp|Q0IDJ4|NU3C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
          Length = 135

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 18  VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 78  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEWS 135


>gi|49237501|gb|AAT58012.1| NADH dehydrogenase subunit 3 [Nectarinia preussi]
          Length = 111

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + + L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   ITLSLTLSVALTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  T  L   S ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQSPTITLALASSLIFL--LTLGLIYEWIQGGLEW 109


>gi|308745742|ref|YP_003933861.1| NADH dehydrogenase subunit 3 [Ambystoma barbouri]
 gi|261888535|gb|ACY06211.1| NADH dehydrogenase subunit 3 [Ambystoma barbouri]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++ M I SA++ VL+I   F +   +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 4   LVILMFILSAMLSVLLILIGFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAIL 63

Query: 70  FVIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     + L + +++  L +LTVG IYEW +G L+W
Sbjct: 64  FLLFDLEIALLLPTPWALQLTPESTLLWATLI--LTLLTVGLIYEWIQGGLDW 114


>gi|299830463|ref|YP_003734834.1| NADH dehydrogenase subunit 3 [Pythium ultimum]
 gi|269810840|gb|ACZ43869.1| NADH dehydrogenase subunit 3 [Pythium ultimum]
 gi|269812153|gb|ACZ44451.1| NADH dehydrogenase subunit 3 [Pythium ultimum]
          Length = 118

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%)

Query: 29  PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFK 88
            FI+  +  D EKL+ YECGF+P+DDAR  FD++F LV++LF+IFDLE  F+FPW +   
Sbjct: 26  SFILIKQKDDLEKLTAYECGFNPYDDARKVFDVKFYLVAILFIIFDLEAVFVFPWVLTLD 85

Query: 89  QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
               LGF +M+ FL  L +GF+Y W   ALEW
Sbjct: 86  SNFSLGFWTMIEFLVELIIGFVYIWCSDALEW 117


>gi|153799790|gb|ABS50626.1| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|153799792|gb|ABS50627.1| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
          Length = 90

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 23  IVLMISPFIVAFKSPD-PEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF 81
           ++L+  PF  A  S   PEKLS YECGFDP  DAR +FDIRF LVS+LF+I DLE+ F F
Sbjct: 2   LILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRFYLVSILFLIPDLEVTFFF 61

Query: 82  PWAVYFKQITWLGFGSMMVFLGILTVGFI 110
           PWAV   +I   GF SMM FL ILT+GF+
Sbjct: 62  PWAVPPNKIDLFGFWSMMAFLFILTIGFL 90


>gi|29570691|ref|NP_818859.1| NADH dehydrogenase subunit 3 [Pseudobagrus tokiensis]
 gi|29501074|dbj|BAC67436.1| NADH dehydrogenase subunit 3 [Pseudobagrus tokiensis]
          Length = 116

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ MAI++A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMIMMAISTALSTILALVSFWLPQMTPDTEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       ++    +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLPDPSYTLLWAATVLI-LLTLGLIYEWVQGGLEW 114


>gi|255506446|ref|YP_003097197.1| NADH dehydrogenase subunit 3 [Xenocypris davidi]
 gi|254547194|gb|ACT66668.1| NADH dehydrogenase subunit 3 [Xenocypris davidi]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F + MV + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATMVLI-LLTLGLIYEWTQGGLEW 114


>gi|309380558|gb|ADO66126.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Euphrates']
          Length = 113

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMAIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|152148799|gb|ABS29932.1| NADH dehydrogenase subunit 3 [Rana chalconota]
          Length = 113

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 75/111 (67%), Gaps = 5/111 (4%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F  + + I ++L++  F +   +P+ EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   LFFLMTTLISMILILVSFWLPLMTPNTEKLSPYECGFDPLASARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA+      T L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 63  FDLEIALLLPTPWAIQLLSPTTALMWASIIIIL--LTLGFIYEWLQGALEW 111


>gi|89213008|gb|ABD63974.1| NADH dehydrogenase subunit 3 [Pycnonotus atriceps]
 gi|264669393|gb|ACY72157.1| NADH dehydrogenase subunit 3 [Pycnonotus atriceps]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+   L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLALSTALTALNFWLAQANPDMEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV  +  T   F +  + + +LT G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLQTPTTTLFWA-SILISLLTAGLVYEWTQGGLEW 114


>gi|322422614|ref|YP_004222183.1| NADH dehydrogenase subunit 3 [Pollachius virens]
 gi|94481770|gb|ABF21477.1| NADH dehydrogenase subunit 3 [Pollachius virens]
 gi|317423486|emb|CBY85636.1| NADH dehydrogenase 3 [Pollachius virens]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILIVVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       + L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPS-LTFAWATSVLALLTLGLIYEWLQGGLEW 114


>gi|27228486|ref|NP_758800.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|124486577|ref|YP_001031192.1| NADH dehydrogenase subunit 3 [Theragra finnmarchica]
 gi|26453406|dbj|BAC43776.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658418|dbj|BAD27131.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658446|dbj|BAD27157.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658460|dbj|BAD27170.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658474|dbj|BAD27183.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658488|dbj|BAD27196.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658502|dbj|BAD27209.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658516|dbj|BAD27222.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|49658530|dbj|BAD27235.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|94481784|gb|ABF21490.1| NADH dehydrogenase subunit 3 [Theragra chalcogramma]
 gi|124377087|emb|CAM31989.1| NADH dehydrogenase 3 [Theragra finnmarchica]
 gi|124377101|emb|CAM32002.1| NADH dehydrogenase 3 [Theragra finnmarchica]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILIVVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFMWATSVLALLTLGLIYEWLQGGLEW 114


>gi|284794723|ref|YP_003412077.1| NADH dehydrogenase subunit 3 [Raiamas senegalensis]
 gi|284507277|dbj|BAI67703.1| NADH dehydrogenase subunit-3 [Raiamas senegalensis]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  ++I++A+ I+L +  F +    PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ILTMISISTALSIILAMVAFWLPQMYPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW     + T   F +  V + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLHEPTGTLFWATAVLI-LLTLGLMYEWMQGGLEW 114


>gi|269794073|ref|YP_003313528.1| NADH dehydrogenase subunit A [Sanguibacter keddieii DSM 10542]
 gi|269096258|gb|ACZ20694.1| NADH dehydrogenase subunit A [Sanguibacter keddieii DSM 10542]
          Length = 120

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 72/118 (61%), Gaps = 2/118 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV--KFDIRF 63
             Y P+LV M IA  + +  + +  ++  K  +  KL  YECG +P   A    +F +++
Sbjct: 3   NPYVPLLVLMGIAMVLALGGVAASAVIGPKRYNRAKLDAYECGIEPTPQAAGGGRFPVKY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++ F+IFD+E+ FL+PWAV F  +   G  +M+ FL ++TV F+YEW++G  EWD
Sbjct: 63  YLVAMTFIIFDIEVVFLYPWAVDFSTLAMFGLVAMLSFLALITVPFVYEWRRGGFEWD 120


>gi|193882362|gb|ACF25858.1| NADH dehydrogenase subunit 3 [Illadopsis puveli]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           I++FM I S  + ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   IIMFMFILSLTLSVILTALNFWLAGTNPDLEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +  T L      + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLQNPT-LTLMWASILISLLTLGLMYEWMQGGLEW 114


>gi|148922622|ref|YP_001293795.1| NADH dehydrogenase subunit 3 [Sardinella maderensis]
 gi|148762668|dbj|BAF64108.1| NADH dehydrogenase subunit 3 [Sardinella maderensis]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IAS + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTIASLLSIILVIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWA-VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       +T + + + ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLNPLTTVSWATAILVL--LTLGLVYEWTQGGLEW 114


>gi|260841959|gb|ACX51040.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + IVL    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIVLAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+      +T++ + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFI-WASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|152148688|gb|ABS29858.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148691|gb|ABS29860.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148694|gb|ABS29862.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148697|gb|ABS29864.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148700|gb|ABS29866.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148703|gb|ABS29868.1| NADH dehydrogenase subunit 3 [Rana eschatia]
          Length = 113

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSVTILISLLLAMISFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWASVIIIL--LTLGFIYEWLQGALEW 111


>gi|152148601|gb|ABS29800.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148604|gb|ABS29802.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148607|gb|ABS29804.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148610|gb|ABS29806.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148613|gb|ABS29808.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148616|gb|ABS29810.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148619|gb|ABS29812.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148622|gb|ABS29814.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148625|gb|ABS29816.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148628|gb|ABS29818.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148631|gb|ABS29820.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148634|gb|ABS29822.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148637|gb|ABS29824.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148640|gb|ABS29826.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148643|gb|ABS29828.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148646|gb|ABS29830.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148649|gb|ABS29832.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148652|gb|ABS29834.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148655|gb|ABS29836.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148658|gb|ABS29838.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148661|gb|ABS29840.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148664|gb|ABS29842.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148667|gb|ABS29844.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148718|gb|ABS29878.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148721|gb|ABS29880.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148724|gb|ABS29882.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148733|gb|ABS29888.1| NADH dehydrogenase subunit 3 [Rana eschatia]
 gi|152148739|gb|ABS29892.1| NADH dehydrogenase subunit 3 [Rana eschatia]
          Length = 113

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTILISLLLAVISFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALTWASVIIIL--LTLGFIYEWLQGALEW 111


>gi|126657570|ref|ZP_01728726.1| NADH dehydrogenase subunit A [Cyanothece sp. CCY0110]
 gi|172036679|ref|YP_001803180.1| NADH dehydrogenase subunit A [Cyanothece sp. ATCC 51142]
 gi|223635350|sp|B1WZG2|NU3C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|126621274|gb|EAZ91987.1| NADH dehydrogenase subunit A [Cyanothece sp. CCY0110]
 gi|171698133|gb|ACB51114.1| NADH dehydrogenase subunit 3 [Cyanothece sp. ATCC 51142]
          Length = 120

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S I I+ + +  I+      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFSRLGLLAFVEALIFIAILVVALVYAWRKGALEWS 120


>gi|148922818|ref|YP_001293847.1| NADH dehydrogenase subunit 3 [Pellonula leonensis]
 gi|148762724|dbj|BAF64160.1| NADH dehydrogenase subunit 3 [Pellonula leonensis]
          Length = 116

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IAS + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTIASLLSIILVIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYF-KQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       +T + + + ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLINPLTTVSWATAILVL--LTLGLVYEWTQGGLEW 114


>gi|58578627|ref|YP_203347.1| NADH dehydrogenase subunit 3 [Mortierella verticillata]
 gi|57545560|gb|AAW51684.1| NADH dehydrogenase subunit 3 [Mortierella verticillata]
          Length = 199

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 68/109 (62%)

Query: 12  LVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFV 71
           L +  +   IVI L++     A   P+ EKL+T+ECGF P + AR KF I F LV +LF+
Sbjct: 5   LFYFILVPVIVIALLVLNLFFAQSKPNEEKLTTFECGFSPVEQARQKFSIHFYLVGILFL 64

Query: 72  IFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +FDLE+  LFP AV    I   GF  ++ FL +LT+GF+YE+  GAL +
Sbjct: 65  VFDLEVLLLFPAAVSMYSIGQSGFWILVFFLVVLTIGFVYEYASGALNY 113


>gi|55583420|ref|YP_138325.1| NADH dehydrogenase subunit 3 [Paramesotriton hongkongensis]
 gi|46981671|gb|AAT07919.1| NADH dehydrogenase subunit 3 [Paramesotriton hongkongensis]
          Length = 115

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + +++A+   L++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMLMLILSTALSTALIMVSFWLPLNNPDTEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L F S ++ L  LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMHPMNTL-FWSTIILL-TLTAGLMYEWAQGGLEW 113


>gi|256427293|ref|YP_003127057.1| NADH dehydrogenase subunit 3 [Threskiornis aethiopicus]
 gi|255709632|gb|ACU30721.1| NADH dehydrogenase subunit 3 [Threskiornis aethiopicus]
          Length = 116

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ A+ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF  V++LF++FD
Sbjct: 8   LTLSFALTIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFSVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+  +   T L + S+++ L  LT G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLQSPTTTLTWTSVIIIL--LTRGLIYEWTQGGLEW 114


>gi|197935804|ref|YP_002213573.1| NADH dehydrogenase subunit 3 [Procypris rabaudi]
 gi|154818379|gb|ABS87667.1| NADH dehydrogenase subunit 3 [Procypris rabaudi]
          Length = 116

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITTALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|50254302|gb|AAT72260.1| NADH dehydrogenase subunit 3 [Gavia immer]
          Length = 116

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  
Sbjct: 23  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +   T L + S M+ L  LT+G IYEW +G LEW
Sbjct: 83  QSPTTTLTWASTMILL--LTLGLIYEWMQGGLEW 114


>gi|14573568|gb|AAK68120.1|AF385299_1 NADH dehydrogenase subunit 3 [Corallium kishinouyei]
          Length = 78

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 59/77 (76%)

Query: 45  YECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGI 104
           YECGFDPFD+    F +RF L+ +LF+IFDLEI+FLFPWAV +K I   G+  +M+FL I
Sbjct: 1   YECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYKGIPLFGYWVVMLFLFI 60

Query: 105 LTVGFIYEWKKGALEWD 121
           LT+G IYEW +G LEW+
Sbjct: 61  LTLGLIYEWIEGGLEWE 77


>gi|148922804|ref|YP_001293834.1| NADH dehydrogenase subunit 3 [Odaxothrissa vittata]
 gi|148762710|dbj|BAF64147.1| NADH dehydrogenase subunit 3 [Odaxothrissa vittata]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IAS + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTIASLLSIILVIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYF-KQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       +T + + + ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLINPLTTVSWATAILVL--LTLGLVYEWTQGGLEW 114


>gi|13561090|emb|CAC36259.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|260841951|gb|ACX51036.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841953|gb|ACX51037.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841955|gb|ACX51038.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841967|gb|ACX51044.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841973|gb|ACX51047.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841985|gb|ACX51053.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841987|gb|ACX51054.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841989|gb|ACX51055.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841993|gb|ACX51057.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841997|gb|ACX51059.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380474|gb|ADO66084.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
 gi|309380478|gb|ADO66086.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
 gi|309380480|gb|ADO66087.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
 gi|309380484|gb|ADO66089.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
          Length = 113

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +    + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFMWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|14331076|emb|CAC41090.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|309380452|gb|ADO66073.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician West']
 gi|309380454|gb|ADO66074.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician West']
 gi|309380456|gb|ADO66075.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician West']
 gi|309380458|gb|ADO66076.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician West']
          Length = 113

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 11/114 (9%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   LFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 63  FDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|260841963|gb|ACX51042.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380490|gb|ADO66092.1| NADH dehydrogenase subunit 3 [Rana cf. cerigensis MB-2010]
 gi|309380496|gb|ADO66095.1| NADH dehydrogenase subunit 3 [Rana cf. cerigensis MB-2010]
          Length = 113

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLIIPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|225697466|ref|YP_002734984.1| NADH dehydrogenase subunit 3 [Arborophila rufipectus]
 gi|204305241|gb|ACH99463.1| NADH dehydrogenase subunit 3 [Arborophila rufipectus]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 70/116 (60%), Gaps = 12/116 (10%)

Query: 12  LVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM + S  +   L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLLMSFMLSTTLTIMNFWLAQMTPDMEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV  +     +TW+        + +LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLQSPMTTLTWVT-----TLIALLTLGLTYEWTQGGLEW 114


>gi|81230425|ref|YP_398792.1| NADH dehydrogenase subunit 3 [Nisaetus nipalensis]
 gi|77999957|dbj|BAE46852.1| NADH dehydrogenase subunit 3 [Spizaetus nipalensis]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (69%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+    
Sbjct: 25  LAQTSPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQLHH 84

Query: 90  -ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            IT L + S+++   +LT+G +YEW +G LEW
Sbjct: 85  PITTLAWASIII--SLLTLGLVYEWLQGGLEW 114


>gi|110348291|gb|ABG72838.1| NADH dehydrogenase subunit 3 [Ficedula westermanni]
 gi|110348331|gb|ABG72858.1| NADH dehydrogenase subunit 3 [Ficedula rufigula]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMIALSLGLSIALTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L +  +++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPMTTLTWTYVLIFL--LTLGLVYEWIQGGLEW 114


>gi|309380482|gb|ADO66088.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
          Length = 113

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       + F    + + +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPN-PLMTFMWTSIIVILLTLGFIYEWLQGGLEW 111


>gi|94490701|ref|YP_588077.1|ND3_19394 NADH dehydrogenase subunit 3 [Cnemotriccus fuscatus]
 gi|48727625|gb|AAT46113.1| NADH dehydrogenase subunit 3 [Cnemotriccus fuscatus]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ ++L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFILSSSLSMILTMLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L   S ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTLTSSILIL--LTLGLVYEWIQGGLEW 114


>gi|297563967|ref|YP_003682940.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|296848416|gb|ADH70434.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 121

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 73/116 (62%), Gaps = 2/116 (1%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--ARVKFDIRFCL 65
           Y PI V   I +A V+V M++  ++  K  +  K+  YECG +P        +F +++ +
Sbjct: 6   YTPIFVLGGIGAAFVVVSMVAGAVLGPKRYNRAKMQAYECGIEPTPQPAGGGRFTVKYYM 65

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +++F++FD+EI FL PWAV+F  + W G  ++++FL  +++ + YEW++G LEWD
Sbjct: 66  TAMMFIVFDIEIIFLIPWAVHFDALGWFGLVAIVLFLVNVSIAYAYEWRRGGLEWD 121


>gi|5835814|ref|NP_008620.1|ND3_15065 NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|226453378|ref|YP_002791101.1| NADH dehydrogenase subunit 3 [Gadus ogac]
 gi|128709|sp|P15957|NU3M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|14010|emb|CAA35657.1| unnamed protein product [Gadus morhua]
 gi|3805897|emb|CAA68113.1| NADH dehydrogenase 3 [Gadus morhua]
 gi|94481672|gb|ABF21387.1| NADH dehydrogenase subunit 3 [Gadus macrocephalus]
 gi|94481686|gb|ABF21400.1| NADH dehydrogenase subunit 3 [Gadus macrocephalus]
 gi|94481694|gb|ABF21407.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|94481703|gb|ABF21415.1| NADH dehydrogenase subunit 3 [Gadus ogac]
 gi|94481717|gb|ABF21428.1| NADH dehydrogenase subunit 3 [Gadus ogac]
 gi|124377059|emb|CAM31963.1| NADH dehydrogenase 3 [Gadus morhua]
 gi|194303659|gb|ACF41201.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303673|gb|ACF41214.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303687|gb|ACF41227.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303701|gb|ACF41240.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303715|gb|ACF41253.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303729|gb|ACF41266.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303743|gb|ACF41279.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303757|gb|ACF41292.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303771|gb|ACF41305.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303785|gb|ACF41318.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303799|gb|ACF41331.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303827|gb|ACF41357.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303841|gb|ACF41370.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303855|gb|ACF41383.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303869|gb|ACF41396.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303883|gb|ACF41409.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303897|gb|ACF41422.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303911|gb|ACF41435.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303925|gb|ACF41448.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303939|gb|ACF41461.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303953|gb|ACF41474.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303967|gb|ACF41487.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303981|gb|ACF41500.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194303995|gb|ACF41513.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304009|gb|ACF41526.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304023|gb|ACF41539.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304037|gb|ACF41552.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304051|gb|ACF41565.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304065|gb|ACF41578.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304079|gb|ACF41591.1| NADH dehydrogenase subunit 3 [Gadus morhua]
 gi|194304093|gb|ACF41604.1| NADH dehydrogenase subunit 3 [Gadus morhua]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFMWATSVLALLTLGLIYEWLQGGLEW 114


>gi|269926649|ref|YP_003323272.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790309|gb|ACZ42450.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 118

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 73/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y PI V   + +A  I  +   + ++ K P+P K  TYE G  P   A+ ++DIR+
Sbjct: 1   MLTDYVPIGVLFLLVAAFAIAALALSYALSPKRPNPVKAETYESGIKPTGTAQHRYDIRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             V++LFV+FD+E  FL+PWAV + +I   G   M++F+ +L + + Y W+KGALEW 
Sbjct: 61  YTVAMLFVLFDIEAIFLYPWAVVYDRIGLYGLVEMLLFIVLLIIAYAYAWRKGALEWS 118


>gi|56692492|ref|YP_163953.1| NADH dehydrogenase subunit 3 [Anguilla megastoma]
 gi|56565436|dbj|BAD78108.1| NADH dehydrogenase subunits 3 [Anguilla megastoma]
          Length = 116

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I +A+  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILIITTALSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T   F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTHAFFWAMSIII-LLTLGLVYEWIQGGLEW 114


>gi|322436003|ref|YP_004218215.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX9]
 gi|321163730|gb|ADW69435.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX9]
          Length = 135

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 72/122 (59%), Gaps = 6/122 (4%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+++ + +A A+   ++ + F V        K  TYECG DP  D+R +F +RF 
Sbjct: 7   LWQYLPLVLQIVVAIALAGGMVGASFFVGKHKNSRTKAGTYECGMDPVGDSRGRFSVRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQI------TWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           +V++LF++FD+E  F+ PWAV F+++       + GF  M+V+L  + VG  Y WKKG L
Sbjct: 67  MVAMLFILFDVEAVFMLPWAVIFRKLPGLGYSKYFGFNEMLVYLAFVGVGLFYVWKKGIL 126

Query: 119 EW 120
            W
Sbjct: 127 NW 128


>gi|292492189|ref|YP_003527628.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
 gi|291580784|gb|ADE15241.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
          Length = 134

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 71/116 (61%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T + P +++  I  A+V  ++   +I+  +  +      +E G  P D AR++F  +F L
Sbjct: 7   TEFWPFVLYAGIVLALVAGILGLSYILGQRHGEKATGEPFESGIVPVDFARLRFSAKFYL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V+VLFVIFD+E  F+F WAV F++  W+G+G  + F+ IL V  IYEW+ GAL+W 
Sbjct: 67  VAVLFVIFDMEAVFIFAWAVAFRETGWIGYGGALTFIAILVVALIYEWRVGALDWQ 122


>gi|109727633|gb|ABG46115.1| NADH dehydrogenase subunit 3 [Rana sp. FRIM 1736]
 gi|109727636|gb|ABG46117.1| NADH dehydrogenase subunit 3 [Rana sp. FRIM 1418]
 gi|109727639|gb|ABG46119.1| NADH dehydrogenase subunit 3 [Rana sp. FRIM 1401]
 gi|109727642|gb|ABG46121.1| NADH dehydrogenase subunit 3 [Rana sp. FRIM 826]
          Length = 113

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 5/100 (5%)

Query: 24  VLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF-- 81
           VL +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF++FDLEIA L   
Sbjct: 14  VLALVSFWLPLMSPNTEKLSPYECGFDPLASARLPYSMRFFLVAILFLLFDLEIALLLPT 73

Query: 82  PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           PWA+     +  L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 74  PWAIQLLNPVVALSWASIIIIL--LTLGFIYEWSQGALEW 111


>gi|322830726|ref|YP_004222796.1| NADH dehydrogenase subunit 3 [Merluccius merluccius]
 gi|317423528|emb|CBY85675.1| NADH dehydrogenase 3 [Merluccius merluccius]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ +VL++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLVLILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPT-LTFLWATSVLALLTLGLIYEWLQGGLEW 114


>gi|242616515|ref|YP_003002014.1| NADH dehydrogenase subunit 3 [Pavo muticus]
 gi|166066509|gb|ABY80765.1| NADH dehydrogenase subunit 3 [Pavo muticus]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 6/113 (5%)

Query: 12  LVFM-AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM +++  +   L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLSLSLTLSTALALMNFWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  +T L + + ++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPMTTLTWATTIITL--LTLGLIYEWAQGGLEW 114


>gi|108796790|ref|YP_636386.1| NADH dehydrogenase subunit 3 [Staurastrum punctulatum]
 gi|122211807|sp|Q32RZ0|NU3C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|61393558|gb|AAX45699.1| subunit 3 of NADH-plastoquinone oxidoreductase [Staurastrum
           punctulatum]
          Length = 121

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAI-VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +L  Y     F+ IA  I V+ + +S  +    S +PEK +TYE G +P  ++ ++F IR
Sbjct: 3   ILPKYESFWAFLLIACLIPVLAISVSNLVAPSTSKNPEKSTTYESGIEPMGESWIQFQIR 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + +++FVIFD+E  FL+PWA+ F  +  + F  ++VF+ IL +G IY W+KGALEW 
Sbjct: 63  YYMFALVFVIFDVETVFLYPWAMSFDDLGIIAFAEVLVFVIILIIGLIYAWRKGALEWS 121


>gi|68989197|ref|YP_254695.1| NADH dehydrogenase subunit 3 [Rhacophorus schlegelii]
 gi|67077840|dbj|BAD99485.1| NADH dehydrogenase subunit 3 [Rhacophorus schlegelii]
          Length = 114

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF  +A  + ++L +  F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 2   MLVFTLMALTLSVILALISFWLPTILPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       +   +MMV L +LT+GFIYEW +  LEW
Sbjct: 62  LLFDLEIALLLPMPWAIQLTTPPSVMMWAMMVLL-LLTMGFIYEWDQAGLEW 112


>gi|56692548|ref|YP_163888.1| NADH dehydrogenase subunit 3 [Anguilla malgumora]
 gi|56565366|dbj|BAD78043.1| NADH dehydrogenase subunits 3 [Anguilla malgumora]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  +AI + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILAITTTLSFVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T   F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTNAFFWAMSIII-LLTLGLVYEWIQGGLEW 114


>gi|309380520|gb|ADO66107.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380526|gb|ADO66110.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
 gi|309380528|gb|ADO66111.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae MB-2010]
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFFIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|51572516|gb|AAU07758.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
 gi|51572542|gb|AAU07771.1| NADH dehydrogenase subunit 3 [Hypsipetes madagascariensis]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM  AS  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVTFMFAASLXLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLDTPTTTLAWASALIL--ILTLGLVYEWAQGGLEW 114


>gi|309380470|gb|ADO66082.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cilician East']
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +    + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTTIWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|325460982|gb|ADZ14603.1| NADH dehydrogenase subunit 3 [Limnonectes dabanus]
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +I + I+I+L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLIFASITAFIIIILATVSFWLPLIKPDMEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +T + + S+++FL  LT GF YEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAMQLSNPMTTILWASLVLFL--LTAGFAYEWFQGGLEW 111


>gi|119360617|ref|YP_913400.1| NADH dehydrogenase subunit 3 [Zacco sieboldii]
 gi|119225087|dbj|BAF41461.1| NADH dehydrogenase subunit 3 [Zacco sieboldii]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I    AI  A+ +VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIFAITMALSLVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW    +  T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLQNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|53686440|ref|YP_097213.1| NADH dehydrogenase subunit 3 [Gyrinophilus porphyriticus]
 gi|51980003|gb|AAU20663.1| NADH dehydrogenase subunit 3 [Gyrinophilus porphyriticus]
          Length = 115

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 68/112 (60%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL+ M I   +  +L++  F +   SPD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILLMMLITVTLSTILIMVGFWLPINSPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA          + + ++ L  LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWAAQTTPTNMFLWSTTILIL--LTAGLVYEWMQGGLEW 113


>gi|86606637|ref|YP_475400.1| NADH dehydrogenase subunit A [Synechococcus sp. JA-3-3Ab]
 gi|123505802|sp|Q2JT70|NU3C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|86555179|gb|ABD00137.1| NADH-ubiquinone/plastoquinone oxidoreductase, subunit 3
           [Synechococcus sp. JA-3-3Ab]
          Length = 120

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +LVF+ + + + ++ + +  ++A K     + STYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLVFLIVCALLPVLALGASALLAPKRRGSLRRSTYESGMEPFGQAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL VG +Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFVEALIFIAILVVGLVYAWRKGALEWS 120


>gi|256985413|ref|YP_003162843.1| NADH dehydrogenase subunit 3 [Sinocyclocheilus grahami]
 gi|238683591|gb|ACR54077.1| NADH dehydrogenase subunit 3 [Sinocyclocheilus grahami]
          Length = 116

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ +VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITTALSLVLAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTETLFWATTVLI-LLTLGLVYEWTQGGLEW 114


>gi|13561102|emb|CAC36252.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561104|emb|CAC36253.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561106|emb|CAC36254.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561108|emb|CAC36255.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|13561110|emb|CAC36256.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|309380448|gb|ADO66071.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cyprus']
 gi|309380450|gb|ADO66072.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Cyprus']
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F  IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFFIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMAIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|148922538|ref|YP_001293665.1| NADH dehydrogenase subunit 3 [Clupea harengus]
 gi|148922566|ref|YP_001293678.1| NADH dehydrogenase subunit 3 [Clupea pallasii]
 gi|148762528|dbj|BAF63978.1| NADH dehydrogenase subunit 3 [Clupea harengus]
 gi|148762542|dbj|BAF63991.1| NADH dehydrogenase subunit 3 [Clupea pallasii]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V +AI   + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMVVLAITLILSIILVIVSFWLPQMTPDAEKLSPYECGFDPRGSARMPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         + W G       L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAYQLDNPVMTVVWAG-----AVLALLTLGLVYEWLQGGLEW 114


>gi|61968725|gb|AAX57212.1| NADH dehydrogenase subunit 3 [Enicurus ruficapilla]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMLTLSLILSIALTILNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLVWTSTLILL--LTAGLVYEWLQGGLEW 114


>gi|164512195|emb|CAO78422.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       +      + + +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPN-PLMTIIWASIIIILLTLGFIYEWLQGGLEW 111


>gi|126216102|gb|ABN81107.1| NADH dehydrogenase subunit 3 [Turdus pallidus]
          Length = 111

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   LTLSLALTIFLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S ++   ILT+G +YEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQHPTTTLIWASALIL--ILTLGLMYEWAQGGLEW 109


>gi|62901740|gb|AAY18821.1| NADH dehydrogenase subunit 3 [Ceyx cyanopectus nigrirostris]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLTLSLIISTILTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +   T L +  M++   +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLYSPTTTLTWTFMII--SLLTLGLIYEWLQGGLEW 114


>gi|121534362|ref|ZP_01666186.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Thermosinus
           carboxydivorans Nor1]
 gi|121307132|gb|EAX48050.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Thermosinus
           carboxydivorans Nor1]
          Length = 118

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 69/118 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y  I + M +A     + +    ++  K P  EKLSTYECG D      ++F   +
Sbjct: 1   MLTDYGRIGLLMVVALIFPFIPLFVSSLLQTKKPTTEKLSTYECGLDTIGRTWIQFKSSY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L +++FV+FD+E  FL+PWAV ++Q+    F  M +F+ IL +G  Y WKKGALEW 
Sbjct: 61  FLYALVFVVFDIETVFLYPWAVKYQQLGTYAFVEMFIFIAILVIGLWYAWKKGALEWK 118


>gi|309380604|gb|ADO66149.1| NADH dehydrogenase subunit 3 [Rana perezi]
 gi|309380606|gb|ADO66150.1| NADH dehydrogenase subunit 3 [Rana perezi]
 gi|309380608|gb|ADO66151.1| NADH dehydrogenase subunit 3 [Rana perezi]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF +IA  + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLVFFSIACLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  + + S+++ L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPILTIIWASVIIIL--LTIGFIYEWLQGGLEW 111


>gi|309380598|gb|ADO66146.1| NADH dehydrogenase subunit 3 [Rana epeirotica]
 gi|309380600|gb|ADO66147.1| NADH dehydrogenase subunit 3 [Rana epeirotica]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 76/116 (65%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IA+ + ++L +  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMYFSIAALLSVILAVVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|289641427|ref|ZP_06473591.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia
           symbiont of Datisca glomerata]
 gi|289508763|gb|EFD29698.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia
           symbiont of Datisca glomerata]
          Length = 120

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--ARVKFDI 61
           +L++Y PILV + IASA  I  +I+  +V  K  +  KL  YECG +P  +     +F +
Sbjct: 1   MLSNYVPILVLLVIASAFAIGSVITGALVGPKRYNRAKLDAYECGIEPPREPVGPHRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +F L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  KFYLTAMLFIVFDIEIIFLYPWAVAFGALGTFGLVEMVLFIATVFVAYAYVWRRGGLEWD 120


>gi|29126605|ref|NP_803508.1| NADH dehydrogenase subunit 3 [Monoblepharella sp. JEL15]
 gi|29029503|gb|AAO64953.1| NADH dehydrogenase subunit 3 [Monoblepharella sp. JEL15]
          Length = 109

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 70/99 (70%)

Query: 21  IVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL 80
           +V +L++  F ++  S   EK+S YECGFDP+ DAR+KFDI + LV++LF+IFDLEI FL
Sbjct: 10  LVSLLLVMSFYLSITSRTLEKVSVYECGFDPYSDARLKFDIIYYLVAILFLIFDLEIVFL 69

Query: 81  FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           FP++     +++  F   ++F  +LT+G++YE   G+L+
Sbjct: 70  FPFSALLFDLSYSAFWVYLIFFVVLTIGYLYELNSGSLD 108


>gi|226227068|ref|YP_002761174.1| NADH-quinone oxidoreductase chain A [Gemmatimonas aurantiaca T-27]
 gi|226090259|dbj|BAH38704.1| NADH-quinone oxidoreductase chain A [Gemmatimonas aurantiaca T-27]
          Length = 134

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (58%), Gaps = 17/116 (14%)

Query: 22  VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF 81
           V++L IS   +    P P K   YE G  P  DAR +F ++F LV++LF++FD+E  F+ 
Sbjct: 20  VLILGISHMTIK-AQPTPVKSIPYESGITPLGDARERFSVKFYLVAMLFIVFDIETVFMI 78

Query: 82  PWAVYFK----------------QITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           PW VY++                Q+++ G G M+VF+ IL VGF+Y WKKGAL WD
Sbjct: 79  PWGVYYRQLSCAVPMVNGVCPAGQLSFFGLGEMLVFVAILVVGFVYVWKKGALTWD 134


>gi|154759341|ref|YP_001425518.1| NADH dehydrogenase subunit 3 [Paleosuchus palpebrosus]
 gi|154425219|emb|CAM35792.1| NADH dehydrogenase subunit 3 [Paleosuchus palpebrosus]
          Length = 115

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+  ++AS    +L+IS   +A  SPDPEKLS YECGFDP   AR+   IRF ++++LF
Sbjct: 3   LLIMFSMASITATILIISNLTMAEASPDPEKLSPYECGFDPLGSARLPLSIRFFMIAILF 62

Query: 71  VIFDLEIAFLFP--WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P  W+ +    T      + +FL +L +G +YEW  G LEW
Sbjct: 63  LLFDLEIAILLPLTWSTHTFHPTKTITCIIAIFL-LLFIGLMYEWLHGGLEW 113


>gi|25057302|ref|NP_739627.1| NADH dehydrogenase subunit 3 [Aphredoderus sayanus]
 gi|25005489|dbj|BAC23158.1| NADH dehydrogenase subunit 3 [Aphredoderus sayanus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 66/112 (58%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I S +  +L    F +    PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ILTILIITSTLSAILATISFWLPLMKPDYEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      T     +  V L +LT G IYEWK+G LEW
Sbjct: 64  LLFDLEIALLLPIPWANQLTSPTHTLMWATAVLL-LLTAGLIYEWKQGGLEW 114


>gi|109727551|gb|ABG46062.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007b]
 gi|109727554|gb|ABG46064.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007b]
 gi|109727566|gb|ABG46072.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007b]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F ++   I ++L +  F +   SP+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MMLFSSMTMFISLILTLISFWLPLISPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S ++ L  LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLLNPIMALSWASTIIIL--LTLGFIYEWLQGALEW 111


>gi|14331072|emb|CAC41088.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|260841969|gb|ACX51045.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841979|gb|ACX51050.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841995|gb|ACX51058.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + I+L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSIILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+      +T++ + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFI-WASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|309380614|gb|ADO66154.1| NADH dehydrogenase subunit 3 [Rana saharica]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF   AS + I+L +  F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLVFFFTASLLSILLAVVSFWLPLTAPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G L+W
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLVSIIW---ASVIVIL--LTIGFIYEWLQGGLDW 111


>gi|260842007|gb|ACX51064.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +    + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFMWASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|5835786|ref|NP_008595.1|ND3_15063 NADH dehydrogenase subunit 3 [Carassius auratus]
 gi|6647610|sp|O78686|NU3M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|3288694|dbj|BAA31245.1| NADH dehydrogenase subunit 3 [Carassius auratus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|94481757|gb|ABF21465.1| NADH dehydrogenase subunit 3 [Microgadus proximus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILIVVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPA-LTFAWATSVLALLTLGLIYEWLQGGLEW 114


>gi|45511380|gb|AAS67230.1| NADH dehydrogenase subunit 3 [Mionectes oleagineus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASA-IVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I SA + I L      V   +PD EKLS YECGFDP   AR+ F IRF L+++L
Sbjct: 3   MVIFMFILSASLSIFLTTLNLWVTQSTPDSEKLSPYECGFDPLGSARLPFSIRFFLIAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +  +T L + S ++   +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPLTTLTWTSTIIL--VLTLGLIYEWTQGGLEW 114


>gi|293652697|gb|ADE61202.1| NADH dehydrogenase subunit 3 [Neolestes torquatus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLTLSIALTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV  +     +TW         + +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLQNPTDTLTW-----AFALITLLTLGLVYEWTQGGLEW 114


>gi|6714878|gb|AAF26191.1| NADH dehydrogenase subunit III [Pteroptochos megapodius]
 gi|6714879|gb|AAF26192.1| NADH dehydrogenase subunit III [Pteroptochos megapodius]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I+ ++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTISISLSIILTTLNFWLAQMNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW    S+++   ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLMTLTW--ATSIII---ILTLGLVYEWLQGGLEW 114


>gi|16357073|ref|NP_443405.1|ND3_15821 NADH dehydrogenase subunit 3 [Zenopsis nebulosus]
 gi|16267204|dbj|BAB70333.1| NADH dehydrogenase subunit 3 [Zenopsis nebulosus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I++ I +VL +  F V   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   MMISALISLVLAVVSFWVPQLTPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFILFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW       T L F      L +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWGDQLTSPT-LTFIWATTVLALLTLGLVYEWLQGGLEW 114


>gi|14581586|gb|AAK50200.1| NADH dehydrogenase subunit 3 [Vireo solitarius solitarius]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++  + I+L    F ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMITLSLTLSIILTALNFWLSQMNPDAEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +   T L + S+++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQDPTTTLMWASIIIVL--LTLGLVYEWAQGGLEW 114


>gi|295065627|ref|YP_003587428.1| NADH dehydrogenase subunit 3 [Apalone ferox]
 gi|226838412|gb|ACO83389.1| NADH dehydrogenase subunit 3 [Apalone ferox]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 72/115 (62%), Gaps = 13/115 (11%)

Query: 16  AIASAIVIVLMISPFIVAFKS------PDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            ++S I + L+IS  ++   S      P+ EKLS YECGFDP    R+ F IRF LV++L
Sbjct: 3   TVSSLITLALIISTALILVNSQLSTMKPNNEKLSPYECGFDPLKTMRLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVF--LGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+   Q+T      M+ F  L +LT+GFIYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAI---QLTTPTNTLMLTFAILLLLTLGFIYEWTQGGLEW 114


>gi|88910849|gb|ABD58731.1| NADH dehydrogenase subunit 3 [Attagis gayi]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 70/112 (62%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ A+ ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTLSLALSMILTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA+        +TW       + + +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAIQLPSPTSTLTWTS-----IIITLLTMGLVYEWMQGGLEW 114


>gi|23428660|gb|AAM00142.1| NADH dehydrogenase subunit 3 [Xiphorhynchus picus altirostris]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 12/114 (10%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +     +TW    S ++ L  LT+G +YEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLFTLTW---TSTIIIL--LTLGLVYEWTQGGLEW 114


>gi|25057702|ref|NP_739939.1| NADH dehydrogenase subunit 3 [Parazen pacificus]
 gi|25005909|dbj|BAC23535.1| NADH dehydrogenase subunit 3 [Parazen pacificus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I++ I +VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   MIISALISLVLSIISFWLPLLNPDSEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW       T + F   ++ L +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWGDQLHNPT-MTFLWALIVLMLLTLGLVYEWLQGGLEW 114


>gi|332886910|dbj|BAK23024.1| NADH dehydrogenase subunit 3 [Tanichthys albonubes]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIIVITMALSMILAVVSFWLPQINPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F + MV + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATMVLI-LLTLGLIYEWTQGGLEW 114


>gi|326535889|ref|YP_004300336.1| NADH dehydrogenase subunit 3 [Emberiza chrysophrys]
 gi|325305639|gb|ADZ10804.1| NADH dehydrogenase subunit 3 [Emberiza chrysophrys]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  SPD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   
Sbjct: 23  FWLAQMSPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +   T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 83  QSPTTTLTWASTLIFL--LTLGLVYEWIQGGLEW 114


>gi|161561746|ref|YP_001586142.1| NADH dehydrogenase subunit 3 [Rhynochetos jubatus]
 gi|143024739|gb|ABO93090.1| NADH dehydrogenase subunit 3 [Rhynochetos jubatus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (64%), Gaps = 5/108 (4%)

Query: 16  AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDL 75
           A+++ +  +L+   F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FDL
Sbjct: 9   ALSTTLAALLITLNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDL 68

Query: 76  EIAFL--FPWAVYFKQITW-LGFGSMMVFLGILTVGFIYEWKKGALEW 120
           EIA L   PWA      T+ L +   ++ L  LT+G  YEW +G LEW
Sbjct: 69  EIALLLPLPWATQLHSPTYTLTWAYAIIIL--LTLGLAYEWLQGGLEW 114


>gi|309380492|gb|ADO66093.1| NADH dehydrogenase subunit 3 [Rana cf. cerigensis MB-2010]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLIIPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        + W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTVIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|296940259|ref|YP_003667941.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|146142365|gb|ABQ01628.1| NADH dehydrogenase subunit 3 [Carassius auratus]
 gi|269849168|gb|ACZ49736.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|326320984|gb|ADZ53485.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|326320998|gb|ADZ53498.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITTALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|23428678|gb|AAM00151.1| NADH dehydrogenase subunit 3 [Xiphorhynchus picus bahiae]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 12/114 (10%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +     +TW    S ++ L  LT+G +YEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLFTLTW---TSTIIIL--LTLGLVYEWTQGGLEW 114


>gi|87045771|gb|ABD17720.1| NADH dehydrogenase subunit 3 [Porites astreoides]
          Length = 78

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/78 (58%), Positives = 57/78 (73%)

Query: 44  TYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLG 103
            Y CGF+PF      F +RF LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG
Sbjct: 1   AYXCGFEPFGIPGRPFSVRFFLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLG 60

Query: 104 ILTVGFIYEWKKGALEWD 121
           +LT+G +YEW KG LEW+
Sbjct: 61  VLTLGLLYEWIKGGLEWE 78


>gi|212006972|gb|ACJ22199.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007020|gb|ACJ22223.1| NADH dehydrogenase subunit 3 [Passerina amoena]
          Length = 115

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWAV  
Sbjct: 22  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAVQL 81

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  IT L + S  V + +LT+G +YEW +G LEW
Sbjct: 82  QSPITTLTWAS--VLISLLTLGLVYEWIQGGLEW 113


>gi|61968727|gb|AAX57213.1| NADH dehydrogenase subunit 3 [Enicurus maculatus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ + L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLTLSLILSVTLTILNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTMGLVYEWLQGGLEW 114


>gi|148922748|ref|YP_001293691.1| NADH dehydrogenase subunit 3 [Coilia nasus]
 gi|148762556|dbj|BAF64004.1| NADH dehydrogenase subunit 3 [Coilia nasus]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I++ + +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTVLMISTTLSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW    ++       +++V +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLQEPKTTLIWAILV-IGLLTLGLIYEWLQGGLEW 114


>gi|52551356|ref|YP_089610.1|ND3_17939 NADH dehydrogenase subunit 3 [Scolecomorphus vittatus]
 gi|42406142|gb|AAS13738.1| NADH dehydrogenase subunit 3 [Scolecomorphus vittatus]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (63%), Gaps = 7/110 (6%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I   I IVL++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 5   MLIPLTIAIVLLLITFWLPSLTPDSEKLSPYECGFDPMGTARLPFSMRFFLVAILFLLFD 64

Query: 75  LEIAFLF--PWAVYFKQITWLGFGSMMVF--LGILTVGFIYEWKKGALEW 120
           LEIA L   PWA    Q+T      ++ F  L  LT+GFIYEW +G LEW
Sbjct: 65  LEIALLLPSPWA---NQLTTPMLTMLLAFTILIFLTIGFIYEWLQGGLEW 111


>gi|308745756|ref|YP_003934026.1| NADH dehydrogenase subunit 3 [Ambystoma texanum]
 gi|261888563|gb|ACY06237.1| NADH dehydrogenase subunit 3 [Ambystoma texanum]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++ M I SA++ +L+I   F +   +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 4   LVILMFILSAMLSMLLILISFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAIL 63

Query: 70  FVIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     + L + +++  L +LT+G IYEW +G L+W
Sbjct: 64  FLLFDLEIALLLPTPWALQLNPSSTLLWATLI--LTLLTMGLIYEWIQGGLDW 114


>gi|159902861|ref|YP_001550205.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9211]
 gi|223635378|sp|A9BDU1|NU3C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|159888037|gb|ABX08251.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9211]
          Length = 120

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I++A+ ++ +++  +++ KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LQGYDAFLGFLLISAAVPVLALVTNKLLSPKSQTGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALIFIAILIVALAYAWRKGALEWS 120


>gi|110348303|gb|ABG72844.1| NADH dehydrogenase subunit 3 [Ficedula hyperythra]
 gi|110348309|gb|ABG72847.1| NADH dehydrogenase subunit 3 [Ficedula hyperythra]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMIALSLGLSIALTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L + S ++   +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPMTTLIWTSTLI--SLLTLGLVYEWIQGGLEW 114


>gi|45511400|gb|AAS67240.1| NADH dehydrogenase subunit 3 [Rupicola rupicola]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 71/107 (66%), Gaps = 5/107 (4%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           +++++ I+L      +A  +PD EK+S YECGFDP   AR+ F IRF LV++LF++FDLE
Sbjct: 10  LSTSMSIILTSLNXWIAQTNPDSEKMSPYECGFDPLGTARLPFSIRFFLVAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PWA   +  +T L + S ++FL  LT+G  YEW +G LEW
Sbjct: 70  IALLLPLPWATQLQSPLTTLTWTSAIIFL--LTLGLAYEWTQGGLEW 114


>gi|61968775|gb|AAX57237.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM + S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVMFMLMLSLILSITLTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTMGLIYEWLQGGLEW 114


>gi|289183323|ref|YP_003457298.1| NADH dehydrogenase subunit 3 [Coelophrys brevicaudata]
 gi|288908807|dbj|BAI77060.1| NADH dehydrogenase subunit 3 [Coelophrys brevicaudata]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L  + +A  +  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   MLATITLAVTLSTVLALVSFFLPQMTPDHEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T L F    V L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLNSPT-LTFMWATVVLALLTLGLIYEWLQGGLEW 114


>gi|193882376|gb|ACF25865.1| NADH dehydrogenase subunit 3 [Illadopsis rufescens]
 gi|193882378|gb|ACF25866.1| NADH dehydrogenase subunit 3 [Illadopsis rufescens]
          Length = 116

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+    ++  + ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMFTLSLTLSVILTALNFWLAGINPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV  +   T L + S+++   +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLQNPTTTLMWASILI--SLLTLGLIYEWLQGGLEW 114


>gi|1396039|dbj|BAA07793.1| ndhC [Anthoceros formosae]
          Length = 125

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L++ Y    +F+ IAS I  +      ++A  S  PEK ++YECG +P  DA ++F IR+
Sbjct: 3   LVSKYNYFWIFLLIASLIPTIAFSISRVIAPISKGPEKFTSYECGIEPMGDAWIQFXIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E   L+PWA+ FKQ+       + +F+ IL +G IY W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVSLYPWAMSFKQLGIPASIEVSIFVSILIIGLIYAWRKGALEWS 120


>gi|33864159|ref|NP_895719.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9313]
 gi|81711998|sp|Q7TUM3|NU3C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33635743|emb|CAE22068.1| putative NADH Dehydrogenase subunit [Prochlorococcus marinus str.
           MIT 9313]
          Length = 120

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I++A+ I+ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLISAAVPILALVTNKLLAPRSRTGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 120


>gi|126216064|gb|ABN81088.1| NADH dehydrogenase subunit 3 [Turdus lawrencii]
          Length = 111

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 3   IALSLALSIALTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +   T L + S +V L  LT+G  YEW +G LEW
Sbjct: 63  LEIALLLPLPWATQLQYPTTTLIWASALVIL--LTLGLAYEWTQGGLEW 109


>gi|327199775|gb|AEA36038.1| NADH dehydrogenase subunit 3 [Calyptorhynchus latirostris]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + +A A+  VL++  F ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMLTLALALNTVLIMLNFWLSQTTPDLEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   K  T     +  + L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLKYPTTTLTWAFTIIL-LLTMGLIYEWVQGGLEW 114


>gi|299758253|dbj|BAJ09916.1| NADH dehydrogenase subunit 3 [Stolephorus waitei]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA+ + +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTVLAIATLLSLVLMAVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYF----KQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW          + W     ++  +G+LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLTDPKTTLIW-----IIAVVGLLTLGLIYEWLQGGLEW 114


>gi|31282827|gb|AAP15261.1| NADH dehydrogenase subunit 3 [Malurus leucopterus edouardi]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++VFM   S  + I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MVVFMLTLSLTLSIILTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDL+IA L   PWA+  +  T L        + ILT+G +YEW +G LEW
Sbjct: 63  FLLFDLKIALLLPLPWAIQLQSPT-LTLAWTSALITILTLGLVYEWIQGGLEW 114


>gi|254424329|ref|ZP_05038047.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Synechococcus sp. PCC 7335]
 gi|196191818|gb|EDX86782.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Synechococcus sp. PCC 7335]
          Length = 120

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ I+S + +V + +  ++   S  P   +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYFLGFLIISSLVPVVALGASKLLRPASAGPASRTTYESGCEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F  +  L F   ++F+ IL VG +Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHTLGLLAFVEALIFIAILVVGLVYAWRKGALEWS 120


>gi|156523588|gb|ABU68888.1| NADH dehydrogenase subunit 3 [Alcedo cristata]
 gi|156523590|gb|ABU68889.1| NADH dehydrogenase subunit 3 [Alcedo cristata]
 gi|156523606|gb|ABU68897.1| NADH dehydrogenase subunit 3 [Alcedo cristata thomensis]
 gi|156523608|gb|ABU68898.1| NADH dehydrogenase subunit 3 [Alcedo cristata thomensis]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLTLSLIISTILTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T          + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHSPT-TTLSWTFTIITLLTLGLIYEWLQGGLEW 114


>gi|119360743|ref|YP_913725.1| NADH dehydrogenase subunit 3 [Misgurnus nikolskyi]
 gi|119225451|dbj|BAF41799.1| NADH dehydrogenase subunit 3 [Misgurnus nikolskyi]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V +AI + + +VL I  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IIVILAITTTLSLVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWA-VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW    F     L + S ++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLFNPAGTLLWASAVLIL--LTLGLIYEWVQGGLEW 114


>gi|14573572|gb|AAK68123.1|AF385300_1 NADH dehydrogenase subunit 3 [Corallium regale]
 gi|14573584|gb|AAK68132.1|AF385303_1 NADH dehydrogenase subunit 3 [Corallium sp. USNM 94461]
          Length = 78

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (76%)

Query: 45  YECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGI 104
           YECGFDPFD+    F +RF L+ +LF+IFDLEI+FLFPWAV +K +   G+  +M+FL I
Sbjct: 1   YECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYKGLPLFGYWVVMLFLFI 60

Query: 105 LTVGFIYEWKKGALEWD 121
           LT+G IYEW +G LEW+
Sbjct: 61  LTLGLIYEWIEGGLEWE 77


>gi|61968765|gb|AAX57232.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968767|gb|AAX57233.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968769|gb|AAX57234.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM + S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLMLSLILSITLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTMGLIYEWLQGGLEW 114


>gi|237880826|ref|YP_002907472.1| NADH dehydrogenase subunit 3 [Notopterus notopterus]
 gi|237648845|dbj|BAH58942.1| NADH dehydrogenase subunit 3 [Notopterus notopterus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + IA+ +  VL I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   LIIATTLSCVLAIIAFWIPQMSPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW       T L F    V L +LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWGDQLTTPT-LTFIWATVILTLLTLGLVYEWLQGGLEW 114


>gi|58430921|dbj|BAD89259.1| NADH dehydrogenase subunit 3 [Porichthys myriaster]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P++V + I++  +I++M+S F +   SP+ EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 4   PLIVTLTISALSLIMIMVS-FWLPMISPNNEKLSPYECGFDPLGSARLPFSLRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW+ +        + S ++   ILTVG  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWSSHLCSPMVTTWASSILL--ILTVGLAYEWSQGGLEW 113


>gi|162374612|ref|YP_001604418.1| NADH dehydrogenase subunit 3 [Bufo melanostictus]
 gi|46981601|gb|AAT07854.1| NADH dehydrogenase subunit 3 [Bufo melanostictus]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F+ +   IV+VL    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF++
Sbjct: 3   LFVLLTMTIVLVLATVSFWLPTISPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLL 62

Query: 73  FDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA      T   F S ++ + +LT+GF+YEW +G LEW
Sbjct: 63  FDLEIALLLPTPWAAQLPYPTLSIFWSSIILI-LLTLGFVYEWLQGGLEW 111


>gi|21950296|gb|AAM23030.1| NADH dehydrogenase subunit III [Glyphorynchus spirurus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 69/112 (61%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + +++++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF L+++LF++FD
Sbjct: 8   LILSTSLSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW    +     +TW         L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWVTQLQSPLSTLTWTS-----TILVLLTLGLIYEWTQGGLEW 114


>gi|309380610|gb|ADO66152.1| NADH dehydrogenase subunit 3 [Rana saharica]
 gi|309380612|gb|ADO66153.1| NADH dehydrogenase subunit 3 [Rana saharica]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L F ++AS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLTFFSVASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G L+W
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMSIIW---ASVIVIL--LTIGFIYEWLQGGLDW 111


>gi|308097257|gb|ADO14173.1| NADH dehydrogenase subunit 3 [Oriolus cruentus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM I S  + + L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MILFMIITSLTLSLALTMLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+  +   T L + S+++ L  LT+G I+EW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAMQLQTPTTTLMWSSVLIVL--LTLGLIHEWTQGGLEW 114


>gi|212007098|gb|ACJ22262.1| NADH dehydrogenase subunit 3 [Passerina amoena]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWAV  
Sbjct: 22  FWLAQTTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAVQL 81

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  IT L + S  V + +LT+G +YEW +G LEW
Sbjct: 82  QSPITTLTWTS--VLISLLTLGLVYEWIQGGLEW 113


>gi|161868012|ref|YP_001600225.1| NADH dehydrogenase subunit 3 [Arctogadus glacialis]
 gi|94481644|gb|ABF21361.1| NADH dehydrogenase subunit 3 [Arctogadus glacialis]
 gi|161725005|emb|CAP46978.1| NADH dehydrogenase 3 [Arctogadus glacialis]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPA-LTFAWATSVLALLTLGLIYEWLQGGLEW 114


>gi|145219900|ref|YP_001130609.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Prosthecochloris vibrioformis DSM 265]
 gi|223635474|sp|A4SF48|NUOA_PROVI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145206064|gb|ABP37107.1| NADH dehydrogenase subunit A [Chlorobium phaeovibrioides DSM 265]
          Length = 143

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF  +    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSEFGNVFVFFLLGVVFVAGGYLTARMLRPSRPNPVKTSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  F+Q+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDW 120


>gi|327199761|gb|AEA36025.1| NADH dehydrogenase subunit 3 [Calyptorhynchus baudinii]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + +A A+  VL++  F ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMLTLALALNTVLIMLNFWLSQTTPDLEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   K  T     +  + L +LT G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLKYPTTTLTWAFTIIL-LLTTGLIYEWVQGGLEW 114


>gi|23428692|gb|AAM00158.1| NADH dehydrogenase subunit 3 [Xiphorhynchus picus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 12/114 (10%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +     +TW    S ++ L  LT+G +YEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLFTLTW---TSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|63278313|ref|YP_220633.2| NADH dehydrogenase subunit 3 [Porichthys myriaster]
          Length = 114

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P++V + I++  +I++M+S F +   SP+ EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PLIVTLTISALSLIMIMVS-FWLPMISPNNEKLSPYECGFDPLGSARLPFSLRFFLVAIL 61

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW+ +        + S ++   ILTVG  YEW +G LEW
Sbjct: 62  FLLFDLEIALLLPLPWSSHLCSPMVTTWASSILL--ILTVGLAYEWSQGGLEW 112


>gi|62161359|ref|YP_214791.1| NADH dehydrogenase subunit 3 [Ambystoma andersoni]
 gi|49066286|gb|AAT49230.1| NADH dehydrogenase subunit 3 [Ambystoma andersoni]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 69/105 (65%), Gaps = 4/105 (3%)

Query: 18  ASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEI 77
           +S + ++L+I  F +   +PD EKLS YECGFDP   AR+ F I+  LV++LF++FDLEI
Sbjct: 11  SSMLSLILIIIGFWIPMSNPDTEKLSPYECGFDPLGSARLPFSIQIFLVAILFLLFDLEI 70

Query: 78  AFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           A L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 71  ALLLPTPWALQLNPTNTLTWATLI--LALLTVGLIYEWIQGGLDW 113


>gi|260150643|ref|YP_003208135.1| NADH dehydrogenase subunit 3 [Quasipaa spinosa]
 gi|212656679|gb|ACJ36244.1| NADH dehydrogenase subunit 3 [Quasipaa spinosa]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +LVF+ +   +V++L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLVFILMTITLVLILAAVSFWLPLIKPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+         F + ++ L +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPSPWAMQLPNPIMTIFWASVILL-LLTIGFIYEWLQGGLEW 111


>gi|61968721|gb|AAX57210.1| NADH dehydrogenase subunit 3 [Enicurus scouleri]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITLSLTLSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S ++ L  LTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTVGLVYEWIQGGLEW 114


>gi|62901804|gb|AAY18853.1| NADH dehydrogenase subunit 3 [Alcedo atthis]
 gi|156523586|gb|ABU68887.1| NADH dehydrogenase subunit 3 [Alcedo atthis]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+   L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLSLSLIISATLTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T +     +  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHSPT-VTLAWTLTIISLLTLGLVYEWLQGGLEW 114


>gi|157381728|gb|ABV46685.1| NADH dehydrogenase subunit 3 [Heniochus acuminatus]
 gi|157381855|gb|ABV46748.1| NADH dehydrogenase subunit 3 [Heniochus diphreutes]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 75/114 (65%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IA+A+ ++L+I  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMTIIMIAAALSLILIIVSFWLPLMNPDHEKLSPYECGFDPLGTARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW        +T+L   +++V   +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLSSPLLTFLWASAVLV---LLTLGLIYEWLQGGLEW 114


>gi|296099606|gb|ADG95212.1| NADH dehydrogenase subunit 3 [Polypterus delhezi]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 71/112 (63%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I+S I  +L I  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ILTMILISSLISTILAIIAFWLPQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW+ +   +  L +  +++ L  LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWSTHLDPMLMLTWAFVIIML--LTFGLVYEWLQGGLEW 113


>gi|280978413|ref|YP_003345340.1| NADH dehydrogenase subunit 3 [Serrivomer beanii]
 gi|271280553|dbj|BAI53361.1| NADH dehydrogenase subunit 3 [Serrivomer beanii]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T   F ++ + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGNQLPDTTHTLFWALAIII-LLTLGLVYEWTQGGLEW 114


>gi|156186574|gb|ABU55517.1| NADH dehydrogenase subunit 3 [Philydor pyrrhodes]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 12/114 (10%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S  + IVL +  F ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMTLSIVLTMLNFWLSQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVY----FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA      F  +TW    S ++ L  LT G +YEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQFPFSTLTW---TSTIILL--LTAGLVYEWTQGGLEW 114


>gi|124024215|ref|YP_001018522.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9303]
 gi|223635377|sp|A2CCP7|NU3C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123964501|gb|ABM79257.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9303]
          Length = 134

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ +++A+ I+ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 18  LPGYDAFLGFLLVSAAVPILALVTNKLLAPRSRTGERELTYESGMEPIGGAWIQFNIRYY 77

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW 
Sbjct: 78  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEWS 134


>gi|53686300|ref|YP_097070.1| NADH dehydrogenase subunit 3 [Ambystoma laterale]
 gi|51979835|gb|AAU20507.1| NADH dehydrogenase subunit 3 [Ambystoma laterale]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 5/112 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL+F   A+   ++++I  F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 6   ILMFTLSATLSTLLILIG-FWMPMSNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 64

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       L + +++  L +LTVG IYEW +G L+W
Sbjct: 65  LLFDLEIALLLPTPWALQLNPAGTLTWATLI--LTLLTVGLIYEWIQGGLDW 114


>gi|83031253|gb|ABB96805.1| NADH dehydrogenase subunit 3 [Myiotriccus ornatus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   + 
Sbjct: 25  IAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQLQS 84

Query: 90  -ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +T L + S M+ L  LT+G +YEW +G LEW
Sbjct: 85  PLTTLTWASTMLIL--LTLGLVYEWMQGGLEW 114


>gi|51235012|ref|YP_063502.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
 gi|52221018|ref|YP_087038.1| NADH dehydrogenase subunit 3 [Carassius carassius]
 gi|55338286|ref|YP_133900.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio x
           Carassius cuvieri]
 gi|56912175|ref|YP_173343.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|254033653|ref|YP_003058372.1| NADH dehydrogenase subunit 3 [natural gynogenetic Carassius auratus
           red var.]
 gi|261866631|ref|YP_003264285.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala tetraploid hybrid]
 gi|261866645|ref|YP_003264298.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala triploid hybrid]
 gi|50657569|gb|AAT79573.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
 gi|51339769|gb|AAU00636.1| NADH dehydrogenase subunit 3 [Carassius carassius]
 gi|54288027|gb|AAV31462.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio x
           Carassius cuvieri]
 gi|56798136|dbj|BAD82936.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|251765224|gb|ACT15379.1| NADH dehydrogenase subunit 3 [natural gynogenetic Carassius auratus
           red var.]
 gi|260595467|gb|ACX46723.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala tetraploid hybrid]
 gi|260595481|gb|ACX46736.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala triploid hybrid]
 gi|262211490|gb|ACY35578.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|262211504|gb|ACY35591.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|262211518|gb|ACY35604.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|268373358|gb|ACZ03931.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|270301399|gb|ACZ69579.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|109727578|gb|ABG46080.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727581|gb|ABG46082.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727587|gb|ABG46086.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727590|gb|ABG46088.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727595|gb|ABG46091.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727598|gb|ABG46093.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727609|gb|ABG46100.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
 gi|109727657|gb|ABG46131.1| NADH dehydrogenase subunit 3 [Rana sp. BLS-2007a]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF--PWAVYF 87
           F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF++FDLEIA L   PWA+  
Sbjct: 20  FWLPLMTPDTEKLSPYECGFDPLASARLPYSMRFFLVAILFLLFDLEIALLLPTPWAIQL 79

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
              IT L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 80  SNPITALTWASVIIIL--LTLGFIYEWLQGALEW 111


>gi|332887064|dbj|BAK23167.1| NADH dehydrogenase subunit 3 [Leptocypris sp. CBM ZF 11419]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IA+A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FDLE
Sbjct: 10  IATALSVILATVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLHNPTGTLFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|89213018|gb|ABD63979.1| NADH dehydrogenase subunit 3 [Pycnonotus eutilotis]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM + S  + + L    F ++  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMIVLSLTLSVALTALNFWLSQMNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWAV  +  T +      + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAVQLQTPT-ITLAWTSILISLLTMGLVYEWAQGGLEW 114


>gi|56692376|ref|YP_163966.1| NADH dehydrogenase subunit 3 [Anguilla mossambica]
 gi|56565450|dbj|BAD78121.1| NADH dehydrogenase subunits 3 [Anguilla mossambica]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILVITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T+  F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDTTYAFFWAMSIII-LLTLGLVYEWIQGGLEW 114


>gi|148922580|ref|YP_001293652.1| NADH dehydrogenase subunit 3 [Alosa pseudoharengus]
 gi|148762514|dbj|BAF63965.1| NADH dehydrogenase subunit 3 [Alosa pseudoharengus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI S + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILAITSVLSIILIIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWA-VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       +T + + + ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLDPLTTVSWATAILVL--LTLGLVYEWMQGGLEW 114


>gi|61968723|gb|AAX57211.1| NADH dehydrogenase subunit 3 [Enicurus schistaceus]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           ++ FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MITFMITLSLILSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LTVG +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTVGLVYEWIQGGLEW 114


>gi|23428698|gb|AAM00161.1| NADH dehydrogenase subunit 3 [Xiphorhynchus flavigaster]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LVLSMSLSIILTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G  YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLSTLTWTSTIIIL--LTLGLTYEWTQGGLEW 114


>gi|61968729|gb|AAX57214.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968731|gb|AAX57215.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968733|gb|AAX57216.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968735|gb|AAX57217.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968737|gb|AAX57218.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968739|gb|AAX57219.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968741|gb|AAX57220.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLTLSLILSITLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWASTLILL--LTMGLIYEWLQGGLEW 114


>gi|299758225|dbj|BAJ09896.1| NADH dehydrogenase subunit 3 [Setipinna melanochir]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I++ + +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTVLVISTTLSLVLMTVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T     + +V +G+LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLSDPTNTLIWATIV-IGLLTLGLVYEWLQGGLEW 114


>gi|213136103|gb|ACJ43655.1| NADH dehydrogenase subunit 3 [Euproctus platycephalus]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 70/112 (62%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ +   + + + L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMLMLITTTTLSLALITIGFWLPLNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L   ++++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMSPMNTLFLSTIILVL--LTIGLMYEWTQGGLEW 113


>gi|309380602|gb|ADO66148.1| NADH dehydrogenase subunit 3 [Rana epeirotica]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IA+ + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMYFSIAALLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTIIW---ASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|61968779|gb|AAX57239.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLTLSLILSITLTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTMGLIYEWLQGGLEW 114


>gi|14331070|emb|CAC41087.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae]
 gi|260841949|gb|ACX51035.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841971|gb|ACX51046.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841981|gb|ACX51051.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841983|gb|ACX51052.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842001|gb|ACX51061.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842009|gb|ACX51065.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260842015|gb|ACX51068.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380488|gb|ADO66091.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+      +T++ + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFI-WASIIVIL--LTLGFIYEWLQGGLEW 111


>gi|327199747|gb|AEA36012.1| NADH dehydrogenase subunit 3 [Calyptorhynchus lathami]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + +A A+  VL++  F ++  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMLTMALALNTVLIMLNFWLSQTTPDLEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   K  T     +  + L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLKYPTTTLTWAFTIIL-LLTMGLIYEWVQGGLEW 114


>gi|157144293|ref|YP_001456714.1| NADH dehydrogenase subunit 3 [Pocillopora damicornis]
 gi|157149648|ref|YP_001456728.1| NADH dehydrogenase subunit 3 [Pocillopora eydouxi]
 gi|164565472|ref|YP_001649189.1| NADH dehydrogenase subunit 3 [Seriatopora hystrix]
 gi|197253937|ref|YP_002149711.1| NADH dehydrogenase subunit 3 [Stylophora pistillata]
 gi|139471341|gb|ABO77158.1| NADH dehydrogenase subunit 3 [Pocillopora damicornis]
 gi|139471356|gb|ABO77172.1| NADH dehydrogenase subunit 3 [Pocillopora eydouxi]
 gi|148669058|gb|ABR01616.1| NADH dehydrogenase subunit 3 [Seriatopora hystrix]
 gi|169809266|gb|ACA84102.1| NADH dehydrogenase subunit 3 [Stylophora pistillata]
          Length = 114

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQ 89
           F++  K PD EK+S YECGF PF+     F IRF L+ +LF+IFDLEI+F FPW V +  
Sbjct: 23  FLIGEKIPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYNS 82

Query: 90  ITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
               GF +M+ F  +L +G IYEW  G LEW+
Sbjct: 83  TAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114


>gi|260841961|gb|ACX51041.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
          Length = 113

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       + F    + + +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPN-PLMTFIWASIIIILLTLGFIYEWLQGGLEW 111


>gi|264669391|gb|ACY72156.1| NADH dehydrogenase subunit 3 [Pycnonotus atriceps]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ A+   L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   IALSLALSTALTALNFWLAQANPNMEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV  +  T   F +  + + +LT G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWAVQLQTPTTTLFWA-SILISLLTAGLVYEWTQGGLEW 114


>gi|87045783|gb|ABD17726.1| NADH dehydrogenase subunit 3 [Porites compressa]
          Length = 77

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query: 45  YECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGI 104
           Y CGF+PF      F +RF LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG+
Sbjct: 1   YXCGFEPFGIPGRPFSVRFFLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLGV 60

Query: 105 LTVGFIYEWKKGALEWD 121
           LT+G +YEW KG LEW+
Sbjct: 61  LTLGLLYEWIKGGLEWE 77


>gi|325126698|ref|YP_004285847.1| NADH dehydrogenase subunit 3 [Labeo bata]
 gi|325053250|dbj|BAJ83452.1| NADH dehydrogenase subunit 3 [Labeo bata]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILVITVALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|157736125|ref|YP_001491481.1| NADH dehydrogenase subunit 3 [Heniochus diphreutes]
 gi|157679338|dbj|BAF80396.1| NADH dehydrogenase subunit 3 [Heniochus diphreutes]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 75/114 (65%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IA+A+ ++L+I  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMTIIMIAAALSLILIIVSFWLPLMNPDHEKLSPYECGFDPLGTARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW        +T+L   +++V   +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLSSPLLTFLWASAVLV---LLTLGLIYEWLQGGLEW 114


>gi|280978371|ref|YP_003345301.1| NADH dehydrogenase subunit 3 [Avocettina infans]
 gi|271280516|dbj|BAI53335.1| NADH dehydrogenase subunit 3 [Avocettina infans]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILTIVTILSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T + F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLSDTTLMFFWAMSIIV-LLTLGLVYEWMQGGLEW 114


>gi|58045571|ref|YP_192908.1| NADH dehydrogenase subunit 3 [Alytes obstetricans pertinax]
 gi|46242507|gb|AAS83362.1| NADH dehydrogenase subunit 3 [Alytes obstetricans pertinax]
          Length = 114

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 68/109 (62%), Gaps = 11/109 (10%)

Query: 18  ASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEI 77
           A+ I  +L I  F +   +PD EK+S YECGFDP   AR+ F +RF L+++LF++FDLEI
Sbjct: 9   ATTISAILAIITFWLPQTNPDTEKVSPYECGFDPLGSARLPFSMRFFLIAILFLLFDLEI 68

Query: 78  AFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           A L   PWAV  +      TW      ++ L +LT+G +YEW +G LEW
Sbjct: 69  ALLLPAPWAVQLEYPTVTTTW-----ALIILSLLTLGLVYEWTQGGLEW 112


>gi|309380578|gb|ADO66136.1| NADH dehydrogenase subunit 3 [Rana cf. bedriagae 'Central Asia 1']
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 75/116 (64%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGTARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+        I W    S+++ L  LT+GFIY+W +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPDPLMTIVW---ASIIIIL--LTLGFIYQWLQGGLEW 111


>gi|109727544|gb|ABG46057.1| NADH dehydrogenase subunit 3 [Rana cubitalis]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F ++ + I +VL I  F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSMTTLISLVLAIVSFWLPLISPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  + + S ++ L  LT+GF+YEW +G LEW
Sbjct: 61  LLFDLEIALLLPAPWAIQLPDPILMIIWASAIIIL--LTLGFMYEWLQGGLEW 111


>gi|226463862|ref|YP_002791140.1| NADH dehydrogenase subunit 3 [Batrachuperus yenyuanensis]
 gi|84371639|gb|ABC56080.1| NADH dehydrogenase subunit 3 [Batrachuperus yenyuanensis]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I++ + + L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMIMVMISTTLSLALITVSFWLPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA       +    S+M+ + +L++G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLFNPEYTLMWSVMILI-LLSIGLVYEWIQGGLEW 114


>gi|213136341|gb|ACJ43876.1| NADH dehydrogenase subunit 3 [Taricha rivularis]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 70/112 (62%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I +A+   L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITLMLIITTALSTALITVGFWLPQNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        + + ++++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMAPTNTMLWSTIILLL--LTMGLIYEWAQGGLEW 113


>gi|53686356|ref|YP_097252.1| NADH dehydrogenase subunit 3 [Phaeognathus hubrichti]
 gi|51980045|gb|AAU20702.1| NADH dehydrogenase subunit 3 [Phaeognathus hubrichti]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (59%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  M + S I  +L+   F +    PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILTMMIMTSIISTILIFIGFWLPVNMPDTEKLSPYECGFDPVGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L + + ++ L  LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWATQMMPTNMLIWSTTILLL--LTAGLVYEWMQGGLEW 113


>gi|109727592|gb|ABG46089.1| NADH dehydrogenase subunit 3 [Rana raniceps]
 gi|109727603|gb|ABG46096.1| NADH dehydrogenase subunit 3 [Rana raniceps]
 gi|109727617|gb|ABG46105.1| NADH dehydrogenase subunit 3 [Rana raniceps]
 gi|109727620|gb|ABG46107.1| NADH dehydrogenase subunit 3 [Rana raniceps]
 gi|109727622|gb|ABG46108.1| NADH dehydrogenase subunit 3 [Rana raniceps]
 gi|109727624|gb|ABG46109.1| NADH dehydrogenase subunit 3 [Rana raniceps]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +++F+ +   I ++L +  F +   +P+ EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MILFLLMTIFISMILTLVSFWLPLMTPNTEKLSPYECGFDPLASARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     I  L + S  V L +LT+GFIYEW +GALEW
Sbjct: 61  LLFDLEIALLLPSPWAIQLSNPIMTLMWAS--VILILLTLGFIYEWVQGALEW 111


>gi|51979793|gb|AAU20468.1| NADH dehydrogenase subunit 3 [Hydromantes italicus]
          Length = 114

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  +A   AI +VL+   F +    P+ EKLS YECGFDPF  AR+ F IRF LV++LF
Sbjct: 3   ILSMLATTLAISMVLITLGFWIPMSLPNTEKLSPYECGFDPFGSARLPFSIRFFLVAILF 62

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L + ++++ L  LT G  YEW +G LEW
Sbjct: 63  LLFDLEIALLLPTPWATQMFPTNMLIWSTIILLL--LTSGLAYEWAQGGLEW 112


>gi|23428708|gb|AAM00166.1| NADH dehydrogenase subunit 3 [Xiphorhynchus picus picus]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 12/114 (10%)

Query: 14  FMAIAS-AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           FM I S ++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 6   FMLILSMSLSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 65

Query: 73  FDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA   +     +TW    S ++ L  LT+G +YEW +G LEW
Sbjct: 66  FDLEIALLLPLPWATQLQSPLFTLTW---TSTIIIL--LTLGLVYEWTQGGLEW 114


>gi|293652717|gb|ADE61212.1| NADH dehydrogenase subunit 3 [Locustella fluviatilis]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I+L    + +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LTMSLTLSIILTALNYWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LE+A L   PWAV  +  +  L + S+++ L  LT G +YEW +G LEW
Sbjct: 68  LEVALLLPLPWAVQLQTPMMTLTWASILILL--LTAGLVYEWTQGGLEW 114


>gi|156523592|gb|ABU68890.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster]
 gi|156523594|gb|ABU68891.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster]
 gi|156523596|gb|ABU68892.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster]
 gi|156523598|gb|ABU68893.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLSLSLIISTILTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T          + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHSPT-TTLSWTFTIIALLTLGLIYEWLQGGLEW 114


>gi|108796688|ref|YP_636544.1| NADH dehydrogenase subunit 3 [Zygnema circumcarinatum]
 gi|122211718|sp|Q32RI2|NU3C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|61393672|gb|AAX45814.1| subunit 3 of NADH-plastoquinone oxidoreductase [Zygnema
           circumcarinatum]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y     F+ IAS + ++ + +  +VA  S   EK ++YE G +P  ++ ++F IR+ 
Sbjct: 4   LAGYESFWAFLLIASLVPVLAVGTSSLVAPSSKAAEKRTSYESGIEPMGESWIQFQIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FV+FD+E  FL+PWA+ F+Q+  L F   +VF+ +L +G +Y W+KGALEW 
Sbjct: 64  MFALVFVVFDVETVFLYPWAMSFQQLGVLAFIEALVFVLVLIIGLVYAWRKGALEWS 120


>gi|68164808|ref|YP_247604.1| NADH dehydrogenase subunit 3 [Cucumis sativus]
 gi|75317260|sp|Q4VZH0|NU3C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|67511403|emb|CAJ00763.1| NADH dehydrogenase subunit C [Cucumis sativus]
 gi|74027106|gb|AAZ94656.1| NADH dehydrogenase subunit 3 [Cucumis sativus]
 gi|115432809|gb|ABI97422.1| NADH-plastoquinone oxidoreductase subunit 3 [Cucumis sativus]
 gi|115498308|gb|ABI98750.1| NADH-plastoquinone oxidoreductase subunit 3 [Cucumis sativus]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    VF+ I+S I I+  +   ++A  S +PEKLS+YE G +P  DA V+F IR+
Sbjct: 3   LLYEYDIFWVFLIISSVIPILAFLISGVLAPLSKEPEKLSSYESGIEPMGDAWVQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS 120


>gi|312131894|ref|YP_003999234.1| NADH dehydrogenase subunit a [Leadbetterella byssophila DSM 17132]
 gi|311908440|gb|ADQ18881.1| NADH dehydrogenase subunit A [Leadbetterella byssophila DSM 17132]
          Length = 124

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 73/116 (62%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y P+L+ + +A   V++ +I+   +  K    +K   +ECG +   DAR+  ++R+ L
Sbjct: 7   QDYLPLLIQLVLALGFVVMTLIATHYLGPKLRSKKKDLPFECGVESVGDARMPLNVRYFL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++LFV+FD+E+ F++PWAV FK + WLGF  M++F+  L  GF Y  KKG L+W+
Sbjct: 67  TAILFVLFDVEVIFMYPWAVNFKGLGWLGFYEMLLFVAFLMAGFYYVIKKGVLDWE 122


>gi|218245901|ref|YP_002371272.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 8801]
 gi|257058949|ref|YP_003136837.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 8802]
 gi|218166379|gb|ACK65116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 8801]
 gi|256589115|gb|ACV00002.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 8802]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S + I+ + +  ++      PE+++TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLACSLVPILALTASKLLRPSGGGPERVTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGLLAFVEALIFIAILVIALVYAWRKGALEWS 120


>gi|326909338|ref|YP_004327609.1| NADH dehydrogenase subunit 3 [Rana ishikawae]
 gi|300508172|dbj|BAJ10920.1| NADH dehydrogenase subunit 3 [Rana ishikawae]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 75/114 (65%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +I  A+ I+L    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLMFFSITFAVSIILTFICFWLPLMSPDTEKLSPYECGFDPHGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ--ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       T++   ++++   +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWALQLPNPATTFIWASTLLI---LLTLGFIYEWLQGGLEW 111


>gi|256396792|ref|YP_003118356.1| NADH dehydrogenase subunit A [Catenulispora acidiphila DSM 44928]
 gi|256363018|gb|ACU76515.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Catenulispora
           acidiphila DSM 44928]
          Length = 119

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--ARVKFDIR 62
           + SYAPILV   +A+   +  ++S  +   K  +  KL  YECG +P        +F ++
Sbjct: 1   MNSYAPILVLGGLAAGFAVFSVVSGMLTGPKRYNRAKLEAYECGIEPTPQPVGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV F  + W G   M+ F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVRFDSLGWFGLVEMVFFILTVFVAYAYVWRRGGLEWD 119


>gi|226365380|ref|YP_002783163.1| NADH dehydrogenase subunit A [Rhodococcus opacus B4]
 gi|226243870|dbj|BAH54218.1| NADH-quinone oxidoreductase chain A [Rhodococcus opacus B4]
          Length = 119

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--ARVKFDIR 62
           +  Y PILV  AIA A  +  +I   IV  +  +  KL  YECG +P        +  ++
Sbjct: 1   MNVYVPILVLGAIAVAFAVFSVIVARIVGPRRYNRAKLDAYECGIEPTSSPLGAGRIPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV+F  + + G G+M +F+  ++V + YEW++G L WD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVHFDALGFFGLGAMALFIFNVSVAYAYEWRRGGLSWD 119


>gi|193082366|gb|ACF09228.1| NADH dehydrogenase subunit 3 [Otus insularis]
 gi|193082368|gb|ACF09229.1| NADH dehydrogenase subunit 3 [Otus insularis]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I++A+  +L+   F +A    D EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ISLMLLISTALSTILIALNFWLAQTHTDQEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW       + + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTSTLTWTA-----IMITLLTLGLIYEWIQGGLEW 114


>gi|89212950|gb|ABD63945.1| NADH dehydrogenase subunit 3 [Bleda eximia]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (69%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   + 
Sbjct: 25  LAQANPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQLQT 84

Query: 90  ITW-LGFGSMMVFLGILTVGFIYEWKKGALEW 120
             + L + S+++ L  LT+G +YEW +G LEW
Sbjct: 85  PAYTLIWSSVLILL--LTIGLVYEWMQGGLEW 114


>gi|61968777|gb|AAX57238.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLTLSLILSITLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLVWTSTLILL--LTMGLIYEWLQGGLEW 114


>gi|212007362|gb|ACJ22394.1| NADH dehydrogenase subunit 3 [Passerina cyanea]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWAV  
Sbjct: 22  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAVQL 81

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  IT L + S  V + +LT+G +YEW +G LEW
Sbjct: 82  QSPITTLTWTS--VLISLLTLGLVYEWIQGGLEW 113


>gi|212006948|gb|ACJ22187.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006952|gb|ACJ22189.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006954|gb|ACJ22190.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006956|gb|ACJ22191.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006958|gb|ACJ22192.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006960|gb|ACJ22193.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006962|gb|ACJ22194.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006964|gb|ACJ22195.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006966|gb|ACJ22196.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006968|gb|ACJ22197.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006970|gb|ACJ22198.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006974|gb|ACJ22200.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006976|gb|ACJ22201.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006978|gb|ACJ22202.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006980|gb|ACJ22203.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006982|gb|ACJ22204.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006984|gb|ACJ22205.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006986|gb|ACJ22206.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006988|gb|ACJ22207.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006992|gb|ACJ22209.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006994|gb|ACJ22210.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212006998|gb|ACJ22212.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007002|gb|ACJ22214.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007004|gb|ACJ22215.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007006|gb|ACJ22216.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007010|gb|ACJ22218.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007012|gb|ACJ22219.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007014|gb|ACJ22220.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007016|gb|ACJ22221.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007018|gb|ACJ22222.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007022|gb|ACJ22224.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007024|gb|ACJ22225.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007026|gb|ACJ22226.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007030|gb|ACJ22228.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007032|gb|ACJ22229.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007034|gb|ACJ22230.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007036|gb|ACJ22231.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007038|gb|ACJ22232.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007042|gb|ACJ22234.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007044|gb|ACJ22235.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007046|gb|ACJ22236.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007048|gb|ACJ22237.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007050|gb|ACJ22238.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007052|gb|ACJ22239.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007054|gb|ACJ22240.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007056|gb|ACJ22241.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007058|gb|ACJ22242.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007062|gb|ACJ22244.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007064|gb|ACJ22245.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007066|gb|ACJ22246.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007068|gb|ACJ22247.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007070|gb|ACJ22248.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007072|gb|ACJ22249.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007074|gb|ACJ22250.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007076|gb|ACJ22251.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007078|gb|ACJ22252.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007080|gb|ACJ22253.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007082|gb|ACJ22254.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007084|gb|ACJ22255.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007086|gb|ACJ22256.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007088|gb|ACJ22257.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007090|gb|ACJ22258.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007092|gb|ACJ22259.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007094|gb|ACJ22260.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007096|gb|ACJ22261.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007100|gb|ACJ22263.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007102|gb|ACJ22264.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007106|gb|ACJ22266.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007108|gb|ACJ22267.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007110|gb|ACJ22268.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007112|gb|ACJ22269.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007114|gb|ACJ22270.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007118|gb|ACJ22272.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007120|gb|ACJ22273.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007122|gb|ACJ22274.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007126|gb|ACJ22276.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007128|gb|ACJ22277.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007132|gb|ACJ22279.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007134|gb|ACJ22280.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007136|gb|ACJ22281.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007138|gb|ACJ22282.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007140|gb|ACJ22283.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007142|gb|ACJ22284.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007144|gb|ACJ22285.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007146|gb|ACJ22286.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007148|gb|ACJ22287.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007150|gb|ACJ22288.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007152|gb|ACJ22289.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007154|gb|ACJ22290.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007156|gb|ACJ22291.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007158|gb|ACJ22292.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007160|gb|ACJ22293.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007162|gb|ACJ22294.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007164|gb|ACJ22295.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007166|gb|ACJ22296.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007168|gb|ACJ22297.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007170|gb|ACJ22298.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007172|gb|ACJ22299.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007174|gb|ACJ22300.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007178|gb|ACJ22302.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007180|gb|ACJ22303.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007182|gb|ACJ22304.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007184|gb|ACJ22305.1| NADH dehydrogenase subunit 3 [Passerina amoena]
 gi|212007186|gb|ACJ22306.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007190|gb|ACJ22308.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007192|gb|ACJ22309.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007194|gb|ACJ22310.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007198|gb|ACJ22312.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007202|gb|ACJ22314.1| NADH dehydrogenase subunit 3 [Passerina amoena x cyanea]
 gi|212007210|gb|ACJ22318.1| NADH dehydrogenase subunit 3 [Passerina cyanea]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWAV  
Sbjct: 22  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAVQL 81

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  IT L + S  V + +LT+G +YEW +G LEW
Sbjct: 82  QSPITTLTWTS--VLISLLTLGLVYEWIQGGLEW 113


>gi|148922706|ref|YP_001293730.1| NADH dehydrogenase subunit 3 [Ethmalosa fimbriata]
 gi|148762598|dbj|BAF64043.1| NADH dehydrogenase subunit 3 [Ethmalosa fimbriata]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IAS + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTIASLLSIILVIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW          ++W         L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLNPLVTVSW-----ATAILVLLTLGLVYEWTQGGLEW 114


>gi|5835548|ref|NP_007569.1|ND3_13922 NADH dehydrogenase subunit 3 [Alligator mississippiensis]
 gi|6647608|sp|O47874|NU3M_ALLMI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|3219522|gb|AAD09987.1| NADH dehydrogenase subunit III [Alligator mississippiensis]
 gi|3367629|emb|CAA73568.1| NADH dehydrogenase subunit 3 [Alligator mississippiensis]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 72/114 (63%), Gaps = 11/114 (9%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           + + ++S  V +++    + A  SPDPEKLS YECGFDP   AR+   IRF +V +LF++
Sbjct: 5   IMLTMSSITVSIVVALNLLTAKTSPDPEKLSPYECGFDPLGSARLPLSIRFFMVGILFLL 64

Query: 73  FDLEIAFLFP--WAVY----FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L P  WA++     K ITW    ++++FL  L +G  YEW +G LEW
Sbjct: 65  FDLEIAILLPLTWAIHTLNPLKTITW----AIIIFL-FLFIGLAYEWLQGGLEW 113


>gi|13561094|emb|CAC36260.1| NADH dehydrogenase subunit 3 [Rana bedriagae]
 gi|260841965|gb|ACX51043.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|260841999|gb|ACX51060.1| NADH dehydrogenase subunit 3 [Rana ridibundus]
 gi|309380486|gb|ADO66090.1| NADH dehydrogenase subunit 3 [Rana cf. caralitanus MB-2010]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L++ +IAS + ++L    F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLYFSIASLLSVILAAVSFWLPLITPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +    + S++V L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPNPLMTFIWASIIVIL--LTLGFIYEWIQGGLEW 111


>gi|23428722|gb|AAM00173.1| NADH dehydrogenase subunit 3 [Xiphorhynchus guttatus guttatus]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 7   LVLSMSLSIILTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 66

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 67  LEIALLLPLPWATQLQSPLSTLIWTSTIIIL--LTLGLVYEWAQGGLEW 113


>gi|18251400|gb|AAL65995.1|AF447676_1 NADH dehydrogenase subunit 3 [Cnemotriccus fuscatus fuscatior]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL    ++S++ ++L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMFILSSSLSMILTVLNLWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +  +T L     ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTLAFSILIL--LTLGLVYEWTQGGLEW 114


>gi|254432341|ref|ZP_05046044.1| NADH dehydrogenase i domain protein [Cyanobium sp. PCC 7001]
 gi|197626794|gb|EDY39353.1| NADH dehydrogenase i domain protein [Cyanobium sp. PCC 7001]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ I++A+ ++ +++  +++  S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLISAAVPVLALVANKLLSPDSRQGERELTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW 
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEWS 120


>gi|193082402|gb|ACF09246.1| NADH dehydrogenase subunit 3 [Otus scops]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I+ A+  +L++  F +A    D EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ISLMLLISLALSTILIMLNFGLAQIRTDQEKLSPYECGFDPLGSARLPFSVRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S+M+ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPATTLTWTSVMITL--LTLGLIYEWTQGGLEW 114


>gi|89212946|gb|ABD63943.1| NADH dehydrogenase subunit 3 [Thescelocichla leucopleura]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITLSLTLSIALTALNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + S+++    LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQTPATTLTWASILIL--ALTLGLVYEWMQGGLEW 114


>gi|308097263|gb|ADO14176.1| NADH dehydrogenase subunit 3 [Oriolus traillii]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++SA+ ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMIVMSSALSLILTALNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAV-YFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWAV      T L + S ++ L  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLQTPTTTLTWASTLIVL--LTLGLVYEWAQGGLEW 114


>gi|284928646|ref|YP_003421168.1| NADH dehydrogenase subunit A [cyanobacterium UCYN-A]
 gi|284809105|gb|ADB94810.1| NADH dehydrogenase subunit A [cyanobacterium UCYN-A]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+   + I ++ + +  I+   +  PE L+TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLIACNLIPVLALTASKILRPSNGGPETLTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F  +  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNSLGLLAFVEALIFIAILVIALVYAWRKGALEWS 120


>gi|23428680|gb|AAM00152.1| NADH dehydrogenase subunit 3 [Xiphorhynchus guttatus polystictus]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 73/109 (66%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++ ++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 8   LVLSMSLSIILTMLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWA   +  ++ L + S ++ L  LT+G +YEW +G LEW
Sbjct: 68  LEIALLLPLPWATQLQSPLSTLIWTSTIIIL--LTLGLVYEWAQGGLEW 114


>gi|49237499|gb|AAT58011.1| NADH dehydrogenase subunit 3 [Nectarinia minulla]
          Length = 111

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++  + I L +  F +A  +PD EKLS YECGFDP   AR+ F IRF +V++LF++FD
Sbjct: 3   ITLSLTLSIALTLLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFMVAILFLLFD 62

Query: 75  LEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PWAV  +   T L     ++FL  LT+G IYEW +G LEW
Sbjct: 63  LEIALLLPLPWAVQLQSPATTLALAFSLIFL--LTLGLIYEWIQGGLEW 109


>gi|134303094|ref|YP_001122779.1| NADH dehydrogenase subunit 3 [Bombina variegata]
 gi|61724662|gb|AAX53882.1| NADH dehydrogenase subunit 3 [Bombina variegata]
          Length = 114

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + +  ASA+  +L +  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 2   IYIILLTASAVATLLALISFWLPQISPDTEKLSPYECGFDPLGSARLPFSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +      F S ++ L + T+G IYEW +G LEW
Sbjct: 62  LLFDLEIALLLPAPWAIQLETPMLTIFWSFLI-LTLRTLGLIYEWLQGGLEW 112


>gi|332886882|dbj|BAK22998.1| NADH dehydrogenase subunit 3 [Aspidoparia morar]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IA+A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FDLE
Sbjct: 10  IATALSVILAVVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW  +        F    V + +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGNHLHNPAGTLFWVTAVLV-LLTLGLIYEWAQGGLEW 114


>gi|156523600|gb|ABU68894.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster nais]
 gi|156523602|gb|ABU68895.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster nais]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S ++  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLTLSLVISTILTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T          + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHSPT-TTLSWTFTIITLLTLGLIYEWLQGGLEW 114


>gi|89255444|ref|YP_514705.1| NADH dehydrogenase subunit 3 [Mantella madagascariensis]
 gi|87299390|dbj|BAE79521.1| NADH dehydrogenase subunit 3 [Mantella madagascariensis]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           ++++IA+A+ ++L    F +   +PD EKLS YECGFDP   AR+ + +RF L+++LF++
Sbjct: 3   LYLSIATALSVILATISFWLPLITPDLEKLSPYECGFDPLGSARLPYSMRFFLIAILFLL 62

Query: 73  FDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA      T   F   ++ L +LT GFIYEW +  LEW
Sbjct: 63  FDLEIALLLPAPWATQLSSPTTTIFWLSLIIL-LLTAGFIYEWLQAGLEW 111


>gi|89212986|gb|ABD63963.1| NADH dehydrogenase subunit 3 [Iole olivacea]
 gi|264669407|gb|ACY72164.1| NADH dehydrogenase subunit 3 [Iole olivacea]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 69/108 (63%), Gaps = 5/108 (4%)

Query: 16  AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDL 75
           +++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDL
Sbjct: 9   SLSLTLSIALTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDL 68

Query: 76  EIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           EIA L   PWA+      T L + S ++   ILT+G +YEW +G LEW
Sbjct: 69  EIALLLPLPWAMQLDNPTTTLTWASTLII--ILTLGLVYEWTQGGLEW 114


>gi|256985330|ref|YP_003162766.1| NADH dehydrogenase subunit 3 [Psetta maxima]
 gi|166065509|gb|ABY79842.1| NADH dehydrogenase subunit 3 [Scophthalmus maximus]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+   AIA  +  +L I  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMAIAAIALTLSTILAIVSFWLPQMSPDYEKLSPYECGFDPVGSARLPFSMRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW V  +  +T L + S ++FL  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGVQLYSPLTTLIWASSVLFL--LTLGLVYEWVQGGLEW 114


>gi|148922692|ref|YP_001293639.1| NADH dehydrogenase subunit 3 [Alosa alosa]
 gi|312233343|ref|YP_004021556.1| NADH dehydrogenase subunit 3 [Alosa sapidissima]
 gi|148762500|dbj|BAF63952.1| NADH dehydrogenase subunit 3 [Alosa alosa]
 gi|309321591|gb|ADO65546.1| NADH dehydrogenase subunit 3 [Alosa sapidissima]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI S + I+L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILAITSVLSIILIIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW          ++W         L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLNPLVTVSW-----ATAILVLLTLGLVYEWMQGGLEW 114


>gi|238550600|gb|ACR44450.1| NADH dehydrogenase subunit 3 [Pucrasia macrolopha]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 71/116 (61%), Gaps = 12/116 (10%)

Query: 12  LVFM-AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM +++  +   L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLSLSFTLSTALTILNFWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +     +TW         + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQSPIMTLTW-----TTAIITLLTLGLIYEWMQGGLEW 114


>gi|212007040|gb|ACJ22233.1| NADH dehydrogenase subunit 3 [Passerina amoena]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWAV  
Sbjct: 22  FWLAQMAPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAVQL 81

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  IT L + S  V + +LT+G +YEW +G LEW
Sbjct: 82  QSPITTLTWTS--VLISLLTLGLVYEWIQGGLEW 113


>gi|166363917|ref|YP_001656190.1| NADH dehydrogenase subunit A [Microcystis aeruginosa NIES-843]
 gi|223635360|sp|B0JSV4|NU3C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|159026402|emb|CAO88931.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gi|166086290|dbj|BAG00998.1| NADH dehydrogenase subunit 3 [Microcystis aeruginosa NIES-843]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+   S + I+ + +  ++      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLKGYEYFLGFLLACSLVPILSLTASKVLRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEWS 120


>gi|74310496|ref|YP_313662.1| NADH dehydrogenase subunit 3 [Melanogrammus aeglefinus]
 gi|66864733|gb|AAY57443.1| NADH dehydrogenase subunit 3 [Melanogrammus aeglefinus]
 gi|94481730|gb|ABF21440.1| NADH dehydrogenase subunit 3 [Melanogrammus aeglefinus]
 gi|124377073|emb|CAM31976.1| NADH dehydrogenase 3 [Melanogrammus aeglefinus]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IASA+ ++L++  F +   SPD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  IASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       + L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPS-LTFMWATSVLALLTLGLIYEWLQGGLEW 114


>gi|323481951|ref|YP_004237290.1| NADH dehydrogenase subunit 3 [Carassius auratus ssp. 'Pingxiang']
 gi|322506165|gb|ADX01621.1| NADH dehydrogenase subunit 3 [Carassius auratus ssp. 'Pingxiang']
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW  G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLI-LLTLGLIYEWTHGGLEW 114


>gi|227494503|ref|ZP_03924819.1| NADH dehydrogenase (quinone) [Actinomyces coleocanis DSM 15436]
 gi|226832237|gb|EEH64620.1| NADH dehydrogenase (quinone) [Actinomyces coleocanis DSM 15436]
          Length = 120

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (61%), Gaps = 2/118 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD-DARV-KFDIRF 63
             Y P+L+    A  + +  + +  I+     +  K S YECG DP   DA + +F +++
Sbjct: 3   NPYFPLLIMAGTALLVALGGLAASAILGPTKKNTVKYSNYECGVDPIHADAEMGRFPVKY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++ F++FD+E+ FL+PWAV F Q+   G  +M+ F+ ++TV FIYEW++G LEWD
Sbjct: 63  YLVAMAFIVFDIEVVFLYPWAVAFDQLGLFGLTAMLTFITLVTVPFIYEWRRGGLEWD 120


>gi|109727651|gb|ABG46127.1| NADH dehydrogenase subunit 3 [Rana chalconota]
          Length = 113

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 71/103 (68%), Gaps = 5/103 (4%)

Query: 21  IVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL 80
           I ++L++  F +   +P+ EKLS YECGFDP   AR+ + +RF LV++LF++FDLEIA L
Sbjct: 11  ISMILILVSFWLPLMTPNTEKLSPYECGFDPLASARLPYSMRFFLVAILFLLFDLEIALL 70

Query: 81  F--PWAVY-FKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
              PWA+      T L + S+++ L  LT+GFIYEW +GALEW
Sbjct: 71  LPTPWAIQLLSPTTALMWASIIIIL--LTLGFIYEWLQGALEW 111


>gi|313679547|ref|YP_004057286.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Oceanithermus
           profundus DSM 14977]
 gi|313152262|gb|ADR36113.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Oceanithermus
           profundus DSM 14977]
          Length = 125

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +++L      I+ F+   + + + + I+  +V  +   P KL  YE G  P  D  ++F+
Sbjct: 4   LTELQAGITAIVFFLVGLAIVFVTIGIARLLVGVRPKPPGKLDAYESGEIPIGDVNLRFN 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + + ++LF++FD+E A LFPWAV + ++ WLGF   +VF+GIL +G +Y W++G L+W
Sbjct: 64  VNYYIFALLFLLFDVEAALLFPWAVAYDKLGWLGFFEAVVFIGILAMGLVYAWRRGVLKW 123


>gi|107991025|ref|YP_626576.1| NADH dehydrogenase subunit 3 [Hynobius leechii]
 gi|84371541|gb|ABC55989.1| NADH dehydrogenase subunit 3 [Hynobius leechii]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I++ + +VL+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   IMIMVMISTILSLVLITLSFWLPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA       +    S M+ + +L+ G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQLLLPEYTLLWSTMILI-LLSTGLIYEWIQGGLEW 114


>gi|61968743|gb|AAX57221.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968745|gb|AAX57222.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968747|gb|AAX57223.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968749|gb|AAX57224.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968751|gb|AAX57225.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968753|gb|AAX57226.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968755|gb|AAX57227.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968757|gb|AAX57228.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968759|gb|AAX57229.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968761|gb|AAX57230.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968763|gb|AAX57231.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968771|gb|AAX57235.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
 gi|61968773|gb|AAX57236.1| NADH dehydrogenase subunit 3 [Enicurus leschenaulti]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 6/114 (5%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +++FM   S I+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MIMFMLTLSLILSITLTALNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA   +   T L + S ++ L  LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPTTTLIWTSTLILL--LTMGLIYEWLQGGLEW 114


>gi|53686497|ref|YP_097175.1| NADH dehydrogenase subunit 3 [Aneides hardii]
 gi|51979948|gb|AAU20612.1| NADH dehydrogenase subunit 3 [Aneides hardii]
          Length = 114

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL+ + I   I   L+   F +   +PD EK+S YECGFDP   AR+ F IRF L+++LF
Sbjct: 3   ILLMLIITMIISATLITIGFWLPINTPDTEKVSPYECGFDPLGSARLPFSIRFFLIAILF 62

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L + + ++ L  LTVG +YEW +G LEW
Sbjct: 63  LLFDLEIALLLPTPWAAQMMPLNMLVWSTTILLL--LTVGLVYEWMQGGLEW 112


>gi|189095606|ref|YP_001936244.1| NADH dehydrogenase subunit 3 [Syrmaticus soemmerringi ijimae]
 gi|171702156|dbj|BAG16190.1| NADH dehydrogenase subunit 3 [Syrmaticus soemmerringi ijimae]
          Length = 116

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P+   ++++  +   L I  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   PLTFMLSLSFTLSTTLTILNFWLAQTNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+   Q            + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQL-QSPITTLTWTTTIIALLTLGLIYEWTQGGLEW 114


>gi|280978399|ref|YP_003345327.1| NADH dehydrogenase subunit 3 [Labichthys carinatus]
 gi|271280535|dbj|BAI53348.1| NADH dehydrogenase subunit 3 [Labichthys carinatus]
          Length = 116

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILTIVTILSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T + F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLSDATLMFFWAMSIIV-LLTLGLVYEWMQGGLEW 114


>gi|193082430|gb|ACF09260.1| NADH dehydrogenase subunit 3 [Glaucidium gnoma]
          Length = 116

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F VA  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   
Sbjct: 23  FWVAKTNPDQEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +   T L + S M+ L  LT+G IYEW +G LEW
Sbjct: 83  QSPTTTLTWTSAMITL--LTLGLIYEWLQGGLEW 114


>gi|126215481|ref|YP_001054822.1| NADH dehydrogenase subunit 3 [Odax cyanomelas]
 gi|125625491|dbj|BAF46851.1| NADH dehydrogenase subunit 3 [Odax cyanomelas]
          Length = 115

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + IA+ +  VL+I  F +   +PD EKLS YECGFDP   AR+ F ++F L+++LF++FD
Sbjct: 7   LTIAAVLATVLVILSFWLPQMNPDHEKLSPYECGFDPLGSARLPFSLQFFLIAILFLLFD 66

Query: 75  LEIAFLFPWAVYFKQIT--WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L P   +  Q+T   L F      L +LT+G IYEW +G LEW
Sbjct: 67  LEIALLLPLP-WGDQLTSPLLTFTCASTVLALLTIGLIYEWTQGGLEW 113


>gi|119360547|ref|YP_913452.1| NADH dehydrogenase subunit 3 [Labeo senegalensis]
 gi|119225143|dbj|BAF41513.1| NADH dehydrogenase subunit 3 [Labeo senegalensis]
          Length = 116

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITVALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|332886770|dbj|BAK22894.1| NADH dehydrogenase subunit 3 [Salmostoma bacaila]
          Length = 116

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL   AIA  + I+L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ILATTAIAMILSIILAIVAFWLPQINPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW  +    T   F    V + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNHLPNPTGTLFWVTAVLI-LLTLGLVYEWIQGGLEW 114


>gi|13936187|ref|NP_114048.1|ND3_15649 NADH dehydrogenase subunit 3 [Lyciasalamandra atifi]
 gi|13873060|gb|AAK43353.1|AF154053_8 NADH dehydrogenase subunit 3 [Lyciasalamandra atifi]
          Length = 115

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I++A+  +L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITLMLIISAALSTILITIGFWLPLNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA     +  L + ++++ L  LTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMLPMFTLLWSTIILLL--LTVGLMYEWVQGGLEW 113


>gi|14573576|gb|AAK68126.1|AF385301_1 NADH dehydrogenase subunit 3 [Corallium regale]
          Length = 78

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (76%)

Query: 45  YECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGI 104
           YECGFDPFD+    F +RF L+ +LF+IFDLEI+FLFPWAV ++ +   G+  +M+FL I
Sbjct: 1   YECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYRGLPLFGYWVVMLFLFI 60

Query: 105 LTVGFIYEWKKGALEWD 121
           LT+G IYEW +G LEW+
Sbjct: 61  LTLGLIYEWIEGGLEWE 77


>gi|193082404|gb|ACF09247.1| NADH dehydrogenase subunit 3 [Otus sunia]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I++A+  +L++  F +A    D EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ISLMLLISTALSTILIVLNFWLAQIHTDQEKLSPYECGFDPLGSARLPFSVRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +     +TW       + + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPTSTLTWTA-----IMITLLTLGLIYEWIQGGLEW 114


>gi|258593446|emb|CBE69785.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (70%)

Query: 36  SPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGF 95
           +P+PEK +TYECG DP   + ++  +R+ L ++++VIF +E  +L PWAV F+++    F
Sbjct: 34  NPEPEKYTTYECGEDPVGASWIRVHVRYYLYALVYVIFAVETIYLLPWAVVFRKLGMFAF 93

Query: 96  GSMMVFLGILTVGFIYEWKKGALEW 120
             MM+F+ IL VGF Y W+KGALEW
Sbjct: 94  VEMMLFIAILLVGFAYAWRKGALEW 118


>gi|240266606|ref|YP_002970987.1| NADH dehydrogenase subunit 3 [Polychrus marmoratus]
 gi|239735252|dbj|BAH70467.1| NADH dehydrogenase subunit 3 [Polychrus marmoratus]
          Length = 115

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 9/113 (7%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           + + I   I ++L++  F +   +PD EKLS YECGFDP  +AR+ F +RF L+++LF++
Sbjct: 5   MMLLITFTISLLLILISFWLPQLTPDTEKLSPYECGFDPLGNARLPFSLRFFLIAILFLL 64

Query: 73  FDLEIAFL--FPWAVYFKQITWLGFGSMMV---FLGILTVGFIYEWKKGALEW 120
           FDLEIA L   PWA      T     SM +    L +LT+G IYEW++G LEW
Sbjct: 65  FDLEIALLLPLPWATNLNNPT----PSMTLAFSILALLTLGLIYEWQQGGLEW 113


>gi|300869241|ref|ZP_07113835.1| NAD(P)H-quinone oxidoreductase subunit 3 [Oscillatoria sp. PCC
           6506]
 gi|300332786|emb|CBN59033.1| NAD(P)H-quinone oxidoreductase subunit 3 [Oscillatoria sp. PCC
           6506]
          Length = 120

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+ Y   L F+ I+S I ++ + +  ++  KS   ++ +TYE G +P   A ++F+IR+ 
Sbjct: 4   LSGYEYFLGFLIISSLIPVLALTASKLLRPKSRPYDRRTTYESGVEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW 
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFSQLGLLAFIEALIFIAILVIALVYAWRKGALEWS 120


>gi|119360729|ref|YP_913712.1| NADH dehydrogenase subunit 3 [Leptobotia mantschurica]
 gi|119225437|dbj|BAF41786.1| NADH dehydrogenase subunit 3 [Leptobotia mantschurica]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IITILVITTALSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|325461096|gb|ADZ14679.1| NADH dehydrogenase subunit 3 [Limnonectes hascheanus]
 gi|325461099|gb|ADZ14681.1| NADH dehydrogenase subunit 3 [Limnonectes hascheanus]
 gi|325461102|gb|ADZ14683.1| NADH dehydrogenase subunit 3 [Limnonectes hascheanus]
 gi|325461105|gb|ADZ14685.1| NADH dehydrogenase subunit 3 [Limnonectes hascheanus]
          Length = 113

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 74/116 (63%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F+++   I+++L    F +   SPD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLIFISMTIFIILILATISFWLPLISPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         I W    S+++ L  LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWATQLSNPLLTILW---ASLILIL--LTIGFIYEWFQGGLEW 111


>gi|289183197|ref|YP_003457181.1| NADH dehydrogenase subunit 3 [Balanoglossus clavigerus]
 gi|288995540|emb|CBH40142.1| NADH dehydrogenase subunit 3 [Balanoglossus clavigerus]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (63%), Gaps = 1/110 (0%)

Query: 12  LVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFV 71
           L+++ IA A+  +L I    +  ++ D EKLS YECGFDP   AR+ F +RF LV++LF+
Sbjct: 5   LIYLTIAVALSFILSIVGHRLPTRNMDQEKLSPYECGFDPQASARLPFSLRFFLVAILFL 64

Query: 72  IFDLEIAFLFPW-AVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +FDLEIA L P+ A    +   L F    + L ILTVG IYEW +G LEW
Sbjct: 65  LFDLEIALLLPFPAALSARDPQLSFTLAFLILLILTVGLIYEWMEGGLEW 114


>gi|113171348|gb|ABI30720.1| NADH dehydrogenase subunit 3 [Stachyris ruficeps]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (64%), Gaps = 5/113 (4%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++ A+ ++L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITMSLALSVILTALNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA   +   T L + + ++   +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQNPETTLIWATSLI--SLLTLGLVYEWTQGGLEW 114


>gi|189095550|ref|YP_001936257.1| NADH dehydrogenase subunit 3 [Carassius cuvieri]
 gi|261866673|ref|YP_003264324.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
 gi|13516945|dbj|BAB40355.1| NADH dehydrogenase subunit 3 [Carassius cuvieri]
 gi|260595495|gb|ACX46749.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
 gi|311087979|gb|ADP68057.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLDNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|288903278|ref|YP_003433923.1| NADH dehydrogenase subunit 3 [Epinephelus bruneus]
 gi|219562601|gb|ACL27751.1| NADH dehydrogenase subunit 3 [Epinephelus bruneus]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           ++IA A+ I L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   ISIALALSIALAILSFWLPLMNPDHEKLSPYECGFDPLGTARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW       T L F    + L +LT+G IYEW +G L+W
Sbjct: 68  LEIALLLPLPWGDQLTTPT-LTFLWASIVLALLTLGLIYEWLQGGLDW 114


>gi|148922636|ref|YP_001293873.1| NADH dehydrogenase subunit 3 [Sprattus sprattus]
 gi|148762752|dbj|BAF64186.1| NADH dehydrogenase subunit 3 [Sprattus sprattus]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI   + ++L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTVLAITLTLSLILVIVSFWLPQMTPDAEKLSPYECGFDPRGSARMPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         + W G       L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAYQLDNPVMTVVWAG-----AVLALLTLGLVYEWLQGGLEW 114


>gi|322422711|ref|YP_004222423.1| NADH dehydrogenase subunit 3 [Micromesistius poutassou]
 gi|317423514|emb|CBY85662.1| NADH dehydrogenase 3 [Micromesistius poutassou]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           I+SA+ +VL++  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF++FDLE
Sbjct: 10  ISSALSLVLILVSFWLPQLNPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW       + L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSNPS-LTFAWATSVLALLTLGLIYEWLQGGLEW 114


>gi|298246350|ref|ZP_06970156.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ktedonobacter
           racemifer DSM 44963]
 gi|297553831|gb|EFH87696.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ktedonobacter
           racemifer DSM 44963]
          Length = 117

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + S  PI + + +A    I++M+   ++  + P PEKL+ YECG    +  + +F +++ 
Sbjct: 1   MGSALPIFILVTLAVLFGILVMVVTNVLGPRKPSPEKLAPYECGIQEIEPPKKRFPVKYL 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L  +LF++FD+EI   +P AV   Q+   G   ++VFL IL VG++Y W+KGA  W+
Sbjct: 61  LTGMLFIVFDIEIVSFYPLAVLLHQLQLFGLIELLVFLAILMVGYVYVWRKGAFSWE 117


>gi|307154795|ref|YP_003890179.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7822]
 gi|306985023|gb|ADN16904.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7822]
          Length = 120

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+   S + I+ + +  ++      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLLTCSLVPILALTASKLLRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW 
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGVLAFIEALIFIAILVVALVYAWRKGALEWS 120


>gi|62901794|gb|AAY18848.1| NADH dehydrogenase subunit 3 [Alcedo vintsioides]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLTLSFIISTILTLLNFWLAQTKPDSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T          + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLHSPT-TTLSWTFTIITLLTLGLIYEWLQGGLEW 114


>gi|62901798|gb|AAY18850.1| NADH dehydrogenase subunit 3 [Alcedo leucogaster]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 68/113 (60%), Gaps = 4/113 (3%)

Query: 11  ILVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           +L FM   S I+  +L +  F +A   PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   MLTFMLSLSLIISTILTLLNFWLAQTKPDSEKLSPYECGFDPLSSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PWA+     T          + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLYSPT-TTLSWTFTIIALLTLGLIYEWLQGGLEW 114


>gi|301323043|gb|ADK70293.1| NADH dehydrogenase subunit 3 [Myrmeciza castanea]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA   
Sbjct: 23  FWMAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWATQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  +T L + S+++FL  LT+G +YEW +G LEW
Sbjct: 83  QSPLTTLTWSSIIIFL--LTLGLVYEWIQGGLEW 114


>gi|325126712|ref|YP_004285860.1| NADH dehydrogenase subunit 3 [Paralaubuca typus]
 gi|325053264|dbj|BAJ83465.1| NADH dehydrogenase subunit 3 [Paralaubuca typus]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITLALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTATFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|108795465|gb|ABG21126.1| NADH dehydrogenase subunit 3 [Spilornis cheela hoya]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (70%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  + 
Sbjct: 25  LAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAMQLQS 84

Query: 90  -ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             T L + S++++L  LT+G IYEW +G LEW
Sbjct: 85  PTTTLTWASIIIYL--LTLGLIYEWLQGGLEW 114


>gi|317097051|ref|YP_004123114.1| NADH dehydrogenase subunit 3 [Cottus poecilopus]
 gi|166066447|gb|ABY80713.1| NADH dehydrogenase subunit 3 [Cottus poecilopus]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 11/112 (9%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +AI + + IVL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   LAITALLSIVLALVSFWLPQMTPDHEKLSPYECGFDPVGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFLFPWAVYFKQITWLGFGSMMVFLG------ILTVGFIYEWKKGALEW 120
           LEIA L P   +  Q+T      +M FLG      +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLP-WGDQLT----TPLMTFLGATAVLMLLTLGMIYEWLQGGLEW 114


>gi|313679585|ref|YP_004057324.1| NADH dehydrogenase subunit a [Oceanithermus profundus DSM 14977]
 gi|313152300|gb|ADR36151.1| NADH dehydrogenase subunit A [Oceanithermus profundus DSM 14977]
          Length = 119

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T Y  IL+++ IA+ I +V++    ++  K P P KL  YE G DP  +   +  + F +
Sbjct: 5   TEYINILIYLGIAAGIGVVMLAMGAMLGPKKPSPTKLMPYESGNDPAGEVH-RLPVHFYV 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LF+IFD+E+AFL+P+AV   ++   GF ++  F  I+  GF+YEWKKG ++WD
Sbjct: 64  VAMLFIIFDVEVAFLWPYAVNAGKLGIAGFWAVTTFTLIVLAGFVYEWKKGVMKWD 119


>gi|157381847|gb|ABV46744.1| NADH dehydrogenase subunit 3 [Heniochus chrysostomus]
          Length = 115

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IA+ + ++L+I  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMTIITIATVLSLILIIVSFWLPLMNPDHEKLSPYECGFDPLGTARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLPS-PLLTFLWTSAVLALLTLGLIYEWLQGGLEW 114


>gi|227822753|ref|YP_002826725.1| NADH-quinone oxidoreductase chain A1 [Sinorhizobium fredii NGR234]
 gi|227341754|gb|ACP25972.1| NADH-quinone oxidoreductase chain A1 [Sinorhizobium fredii NGR234]
          Length = 121

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 76/119 (63%), Gaps = 7/119 (5%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAF---KSPDPEKLSTYECGFDPFDDARV-KFDIR 62
            + P+LV +A    IV+V+  + F+ +     +P PEK   YECG DP  +A   +F ++
Sbjct: 5   EFLPVLVMIA---GIVLVVGATLFVSSLLRPSNPYPEKNMPYECGMDPAGEAAGGRFRVQ 61

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F ++++L V+FD+E  FLFPWAV  K+I  +GF  M VF+ +L VGF Y W KGALEW+
Sbjct: 62  FYILAILLVVFDVETMFLFPWAVVLKEIGLIGFVEMFVFIVLLLVGFAYAWLKGALEWE 120


>gi|317097210|ref|YP_004123344.1| NADH dehydrogenase subunit 3 [Silurus meridionalis]
 gi|302201461|gb|ADL09028.1| NADH dehydrogenase subunit 3 [Silurus meridionalis]
          Length = 116

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  M I +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   IMTIMLITTALSTILALVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T+    +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLPDPTYTLLYAAAVLI-LLTLGLIYEWMQGGLEW 114


>gi|56692320|ref|YP_163823.1| NADH dehydrogenase subunit 3 [Anguilla anguilla]
 gi|56692334|ref|YP_164031.1| NADH dehydrogenase subunit 3 [Anguilla rostrata]
 gi|56565296|dbj|BAD77978.1| NADH dehydrogenase subunits 3 [Anguilla anguilla]
 gi|56565520|dbj|BAD78186.1| NADH dehydrogenase subunits 3 [Anguilla rostrata]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISVLIITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L   PW       T   F +M + + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTNAFFWAMSIII-LLTLGLVYEWMQGGLEW 114


>gi|299823726|ref|YP_003734657.1| NADH dehydrogenase subunit 3 [Pellona flavipinnis]
 gi|299758133|dbj|BAJ09977.1| NADH dehydrogenase subunit 3 [Pellona flavipinnis]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 68/116 (58%), Gaps = 11/116 (9%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   M I + +  +L++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IATIMTITTVLSGILIMVSFWLPQMNPDTEKLSPYECGFDPMGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ----ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA         ITW         L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAHQLPNPLMTITW-----ATTILALLTLGLIYEWLQGGLEW 114


>gi|62901816|gb|AAY18859.1| NADH dehydrogenase subunit 3 [Phoeniculus purpureus]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 11/94 (11%)

Query: 33  AFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ- 89
           A  +PD EKLS YECGFDP   AR+ F IRF +V++LF++FDLEIA L   PWA   +  
Sbjct: 26  AQATPDSEKLSPYECGFDPLGSARLPFSIRFFMVAILFLLFDLEIALLLPLPWATQLQSP 85

Query: 90  ---ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
              +TW         L +LT+GFIYEW +G LEW
Sbjct: 86  TITMTWTA-----TILVLLTLGFIYEWNQGGLEW 114


>gi|166093146|gb|ABY82575.1| NADH dehydrogenase subunit 3 [Tyto alba]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 5/92 (5%)

Query: 32  VAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYFKQ 89
           +A  +PDPEKLS YECGFDP   AR+ F IRF LV+++F++FDLEIA L   PW+   + 
Sbjct: 25  LAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAIMFLLFDLEIALLLPLPWSTQLQS 84

Query: 90  -ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             T L   S ++ +  LT+G +YEW +G LEW
Sbjct: 85  PTTTLALTSAIILM--LTLGLVYEWTQGGLEW 114


>gi|119360701|ref|YP_913660.1| NADH dehydrogenase subunit 3 [Homaloptera leonardi]
 gi|119225367|dbj|BAF41721.1| NADH dehydrogenase subunit 3 [Homaloptera leonardi]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 73/114 (64%), Gaps = 7/114 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AI +A+ ++L  + F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITTILAITTALSVLLATASFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFL--FPWA--VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW   +Y    T++   ++   L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLYSPVETFIWAATV---LALLTLGLIYEWTQGGLEW 114


>gi|284794681|ref|YP_003412038.1| NADH dehydrogenase subunit 3 [Gila conspersa]
 gi|284507235|dbj|BAI67664.1| NADH dehydrogenase subunit-3 [Gila conspersa]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + +  AI +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTIIFAITAALSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|25057663|ref|NP_739913.1| NADH dehydrogenase subunit 3 [Ostichthys japonicus]
 gi|25005881|dbj|BAC23509.1| NADH dehydrogenase subunit 3 [Ostichthys japonicus]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I +A+ I+L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   MIITAALSIILAIVSFWLPQMNPDYEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW         L F   +  L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWGDQLSS-PLLTFTWAITILVLLTLGLIYEWTQGGLEW 114


>gi|148922664|ref|YP_001293743.1| NADH dehydrogenase subunit 3 [Etrumeus teres]
 gi|148762612|dbj|BAF64056.1| NADH dehydrogenase subunit 3 [Etrumeus teres]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I SA+ ++L++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IFTILVITSALSVILVLVSFWLPQMTPDAEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA        L     +V L +LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWANQLPT-PLLTNTLAIVVLVLLTAGLVYEWLQGGLEW 114


>gi|219847966|ref|YP_002462399.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aggregans DSM 9485]
 gi|219542225|gb|ACL23963.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aggregans DSM 9485]
          Length = 118

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+   IA  I   ++    ++  +   P KL+ YE G +P   A  +  ++F
Sbjct: 1   MLESYIPVLILFLIAVFIAAFVITLSALLGPRRSTPRKLAPYESGMNPIGQAIRRIPVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E+ F +P+A+ F+Q+   G   M VF  +L VGF+YEWKKGAL W+
Sbjct: 61  YVVAMLFIVFDIEVVFFYPFALVFRQLGPAGLVVMGVFFLVLIVGFVYEWKKGALRWE 118


>gi|238550517|gb|ACR44373.1| NADH dehydrogenase subunit 3 [Bambusicola fytchii]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (63%), Gaps = 6/113 (5%)

Query: 12  LVFM-AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM +++  +   L +  F +A  +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   LTFMLSLSFTLSTALTLVNFWLAQTTPDTEKLSPYECGFDPLGSARLPFSVRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+      T L + + ++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLTSPTTTLTWAATIITL--LTLGLIYEWTQGGLEW 114


>gi|208433795|ref|YP_002265530.1| NADH dehydrogenase subunit 3 [Aluterus scriptus]
 gi|207367025|dbj|BAG72002.1| NADH dehydrogenase subunit 3 [Aluterus scriptus]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 3/106 (2%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           IA A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF++FDLE
Sbjct: 10  IAIALSMILTVVSFWLPLMTPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLE 69

Query: 77  IAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IA L   PW         L F      L +LT+G IYEW +G LEW
Sbjct: 70  IALLLPLPWGDQLSS-PLLTFSWASAVLALLTIGLIYEWLQGGLEW 114


>gi|158188297|gb|AAT72259.1| NADH dehydrogenase subunit 3 [Gavia arctica]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 5/94 (5%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  
Sbjct: 23  FWLAQMTPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQL 82

Query: 88  KQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +   T L + S+M+ L  L +G IYEW +G LEW
Sbjct: 83  QSPTTTLTWASIMILL--LPLGLIYEWMQGGLEW 114


>gi|120586760|ref|YP_961337.1| NADH dehydrogenase subunit 3 [Opsariichthys bidens]
 gi|86450356|gb|ABC96653.1| NADH dehydrogenase subunit 3 [Opsariichthys bidens]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+    IA A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIFTIAVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|89213006|gb|ABD63973.1| NADH dehydrogenase subunit 3 [Criniger phaeocephalus]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L  M ++  +   L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   VLFMMILSLTLSAALTTLNFWLAQANPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+  +  T     +  + L ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQTPTATMIWASSLIL-ILTLGLVYEWAQGGLEW 114


>gi|15987282|ref|NP_387492.1|ND3_15796 NADH dehydrogenase subunit 3 [Buteo buteo]
 gi|15963584|gb|AAL11088.1|AF380305_8 NADH dehydrogenase subunit 3 [Buteo buteo]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 70/105 (66%), Gaps = 8/105 (7%)

Query: 19  SAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIA 78
           SAI+I L +    +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA
Sbjct: 15  SAILITLNL---WLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIA 71

Query: 79  FL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L   PWA   +   T L + S+++   +LT+G IYEW +G LEW
Sbjct: 72  LLLPLPWATQLQSPTTTLIWASIII--SLLTLGLIYEWLQGGLEW 114


>gi|280978301|ref|YP_003345236.1| NADH dehydrogenase subunit 3 [Tragopan caboti]
 gi|269975400|gb|ACZ55622.1| NADH dehydrogenase subunit 3 [Tragopan caboti]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 3/93 (3%)

Query: 30  FIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFL--FPWAVYF 87
           F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FDLEIA L   PWA+  
Sbjct: 23  FWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQL 82

Query: 88  KQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  T +        + +LT+G IYEW +G LEW
Sbjct: 83  QSPT-MTLTWATTIIALLTLGLIYEWLQGGLEW 114


>gi|25057736|ref|NP_739965.1| NADH dehydrogenase subunit 3 [Allocyttus niger]
 gi|25005937|dbj|BAC23561.1| NADH dehydrogenase subunit 3 [Allocyttus niger]
          Length = 116

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           M I++ I +VL    F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF++FD
Sbjct: 8   MLISALISLVLATISFWLPQLSPDSEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFD 67

Query: 75  LEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L   PW       T L F      L +LT+G IYEW +G LEW
Sbjct: 68  LEIALLLPLPWGDQLNNPT-LTFIWATAVLTLLTLGLIYEWLQGGLEW 114


>gi|221633753|ref|YP_002522979.1| NADH ubiquinone oxidoreductase subunit A [Thermomicrobium roseum
           DSM 5159]
 gi|221156542|gb|ACM05669.1| nadh ubiquinone oxidoreductase chain a [Thermomicrobium roseum DSM
           5159]
          Length = 119

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  YA I + +  ++ +  VL++    V  + P+P KL  YE G       R +F  RF 
Sbjct: 3   LIDYAVIGLLIITSTVMGTVLILLGHFVRPRKPNPAKLQPYESGVPDVSPPRGRFTPRFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LFV+FD+E  FL+PWAV F  +   G+    +F+GIL +G +YEW+KGALEW
Sbjct: 63  LVALLFVVFDVEAIFLYPWAVAFDALALYGYVQAALFVGILLLGLLYEWRKGALEW 118


>gi|193082370|gb|ACF09230.1| NADH dehydrogenase subunit 3 [Megascops hoyi]
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 16  AIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDL 75
            ++ A+ I L    F +A  S D EKLS YECGFDP   AR+ F IRF LV++LF++FDL
Sbjct: 9   TVSLALSITLTTLNFWLAQMSSDQEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDL 68

Query: 76  EIAFL--FPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           EIA L   PWAV  K   T L +   M+ L  LT+G IYEW +G LEW
Sbjct: 69  EIALLLPLPWAVQLKSPTTTLIWTFTMIIL--LTLGLIYEWMQGGLEW 114


>gi|119360318|ref|YP_913777.1| NADH dehydrogenase subunit 3 [Xenocypris argentea]
 gi|119360533|ref|YP_913790.1| NADH dehydrogenase subunit 3 [Chanodichthys mongolicus]
 gi|162382075|ref|YP_001604431.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys molitrix]
 gi|164414458|ref|YP_001648364.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys nobilis]
 gi|198400369|ref|YP_002221309.1| NADH dehydrogenase subunit 3 [Distoechodon tumirostris]
 gi|280978259|ref|YP_003345197.1| NADH dehydrogenase subunit 3 [Culter alburnus]
 gi|63081773|gb|AAY30639.1| NADH dehydrogenase subunit 3 [Distoechodon tumirostris]
 gi|119225535|dbj|BAF41877.1| NADH dehydrogenase subunit 3 [Xenocypris argentea]
 gi|119225549|dbj|BAF41890.1| NADH dehydrogenase subunit 3 [Culter mongolicus]
 gi|161824400|gb|ABX79774.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys molitrix]
 gi|163658607|gb|ABY28398.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys nobilis]
 gi|269996116|gb|ACZ57380.1| NADH dehydrogenase subunit 3 [Culter alburnus]
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLI-LLTLGLIYEWTQGGLEW 114


>gi|38018040|ref|NP_937928.1| NADH dehydrogenase subunit 3 [Hiodon alosoides]
 gi|25006514|dbj|BAC24004.1| NADH dehydrogenase subunit 3 [Hiodon alosoides]
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V + IA+ + +VL    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMVILTIATILCLVLATVAFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PW       T   F +  V + +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLSDPTETFFWATAVLI-LLTLGLVYEWIQGGLEW 114


>gi|309380494|gb|ADO66094.1| NADH dehydrogenase subunit 3 [Rana cf. cerigensis MB-2010]
          Length = 113

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 71/112 (63%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L+F +IAS + I+L    F +    PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLLFFSIASLLSIILAAVSFWLPLIIPDTEKLSPYECGFDPLGSARLPYSMRFFLVAILF 60

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+       +      + + +LT+GFIYEW +G LEW
Sbjct: 61  LLFDLEIALLLPTPWAIQLPN-PLMTIIWASIIIILLTLGFIYEWLQGGLEW 111


>gi|239997517|gb|ACS37034.1| NADH dehydrogenase subunit 3 [Caecilia volcani]
          Length = 114

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (62%), Gaps = 7/115 (6%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ ++  + I  +L++  F +   SP+ EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 2   IIITLSTTTVITFILLMLSFWLPPASPNMEKLSPYECGFDPLGSARLPFSMRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMM--VFLGILTVGFIYEWKKGALEWD 121
           ++FDLEIA L   PWA    Q+T      +M  + L +LT G IYEW +G LEW 
Sbjct: 62  LLFDLEIALLLPTPWA---SQLTTPPMSLLMATIILTLLTAGLIYEWIQGGLEWT 113


>gi|219524154|ref|YP_002456302.1| NADH dehydrogenase subunit 3 [Francolinus pintadeanus]
 gi|157678152|gb|ABV60471.1| NADH dehydrogenase subunit 3 [Francolinus pintadeanus]
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 72/113 (63%), Gaps = 6/113 (5%)

Query: 12  LVFMAIASAIV-IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           L FM   S I+ + L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   LTFMLSLSFILSVALTTMNFWLAQMTPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFL--FPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA+     +T L + + ++ L  LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLTYPMTTLTWATTIITL--LTLGLIYEWTQGGLEW 114


>gi|78186618|ref|YP_374661.1| NADH dehydrogenase I, subunit 3 [Chlorobium luteolum DSM 273]
 gi|123583246|sp|Q3B4W3|NUOA_PELLD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|78166520|gb|ABB23618.1| NADH dehydrogenase subunit A [Chlorobium luteolum DSM 273]
          Length = 143

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 72/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V    ++  ++    P+P K STYECG +    + VKF+
Sbjct: 1   MDQTLSDFGNVFVFLLLGVVFVAGGYLTARMLRPSRPNPVKNSTYECGEEAVGSSWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  F+Q+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALIEALVFAGILILGLVYAWVKGDLDW 120


>gi|56692362|ref|YP_163901.1| NADH dehydrogenase subunit 3 [Anguilla celebesensis]
 gi|56565380|dbj|BAD78056.1| NADH dehydrogenase subunits 3 [Anguilla celebesensis]
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIA