RPSBLAST alignment for GI: 254780852 and conserved domain: MTH00042

>gnl|CDD|177117 MTH00042, ND3, NADH dehydrogenase subunit 3; Validated. Length = 116
 Score = 93.9 bits (234), Expect = 1e-20
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            ++ F+ I   +  +L+++   +  +SPD EK S YECGFDP + AR+ F  RF LV++L
Sbjct: 3   NLIFFLLIILILTSLLLLAGHFLPSRSPDLEKSSPYECGFDPLNSARLPFSFRFFLVAIL 62

Query: 70  FVIFDLEIAFLFP--WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA LFP   A      + L   S ++FL ILT+G +YEW  G LEW
Sbjct: 63  FLLFDLEIALLFPLPPATLITNPSTLLPIS-LIFLIILTIGLVYEWVNGGLEW 114