RPSBLAST alignment for GI: 254780852 and conserved domain: MTH00069

>gnl|CDD|177141 MTH00069, ND3, NADH dehydrogenase subunit 3; Provisional. Length = 114
 Score =  104 bits (261), Expect = 6e-24
 Identities = 51/112 (45%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++ + I++ + ++L+   F +   +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 2   IMLMLLISTILSLILITISFWLPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 61

Query: 71  VIFDLEIAFLF--PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L   PWA      T   F S ++ + +LT+G IYEW +G LEW
Sbjct: 62  LLFDLEIALLLPTPWASQLNTPTNTLFWSTLILI-LLTLGLIYEWIQGGLEW 112