HHsearch results for GI: 254780853 and protein with PDBid: 1h2a_S

>1h2a_S Hydrogenase; SO ligand, hydrogen metabolism, Mg center, MIR, MAD, oxidoreductase; 1.80A {Desulfovibrio vulgaris str} SCOP: e.19.1.1
Probab=99.68  E-value=1.1e-17  Score=123.11  Aligned_cols=133  Identities=20%  Similarity=0.302  Sum_probs=96.6

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCCCCCHHHCC-EEECCCC--------------------CCCCEEEEECC
Q ss_conf             99998456128834775235465213566336667867648-4870682--------------------20607997141
Q gi|254780853|r   43 VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG-FAPRASP--------------------RQSDVMIVAGT  101 (185)
Q Consensus        43 ~d~l~nW~R~~Slwp~~fg~aCC~iE~~a~~~p~yD~eRfG-~~~~~sP--------------------RqADvliVtG~  101 (185)
                      .+.+.+..|-+-+|.-.-+.+.|.+.++.+..|..|--.+. +.++-.|                    .+.||++|.|.
T Consensus        48 a~a~~~~~kp~ViWl~~~~C~GCs~SlL~~~~p~l~~lll~~I~l~yhptlma~~G~~a~~~l~~~~~~~~~~ilvVEGs  127 (317)
T 1h2a_S           48 ARALMGPRRPSVVYLHNAECTGCSESVLRAFEPYIDTLILDTLSLDYHETIMAAAGDAAEAALEQAVNSPHGFIAVVEGG  127 (317)
T ss_dssp             ---CCCSSSCEEEEEECBCCSHHHHHHTTCTTTTHHHHHHTTCEEEECTTTCSCCHHHHHHHHHHHHSCTTCCEEEEESB
T ss_pred             HHHHHCCCCCCEEEEECCCCCCHHHHHHCCCCCCHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             99985599983799758978875999976699989999857804985253013325789999999862667869999503


Q ss_pred             CCHHHH---------HHHHHHHHHCCCCCEEEEECCCCCCCCCCCC--CCCEECCCCCCC----CCEEECCCCCCCHHHH
Q ss_conf             345569---------9999999846866619985355668863478--872207722232----2306748876898999
Q gi|254780853|r  102 LTNKMA---------SALRRVYDQMPEPRYVISMGSCANGGGYYHY--SYSVVRGCDRIV----PVDIYVPGCPPTAEAL  166 (185)
Q Consensus       102 vT~km~---------~~l~~~yeqmpePK~ViA~G~Ca~sGG~f~~--sY~v~~g~d~~i----PVDvyVPGCPPrPeai  166 (185)
                      |..+.-         +.+..+.+..+..|+|||+|+||+.||+..-  ++.-..|+++++    .+|++||||||+|+.|
T Consensus       128 Ip~~~~g~y~~ig~~~~~e~~~~l~~kAk~VIAvGtCA~~GGIpaa~pnptga~gv~~~l~~~~~~vinIPGCPp~pd~i  207 (317)
T 1h2a_S          128 IPTAANGIYGKVANHTMLDICSRILPKAQAVIAYGTCATFGGVQAAKPNPTGAKGVNDALKHLGVKAINIAGCPPNPYNL  207 (317)
T ss_dssp             EECGGGGTTBEETTEEHHHHHHHHGGGCSEEEEESHHHHHCCGGGSTTCTTCEECHHHHHGGGTCCCBCCCCSSCCHHHH
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHCCEEEEEECHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCHHHH
T ss_conf             45788831466779229999999985297799975043238853457999875243111111598338827999898999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999999
Q gi|254780853|r  167 IYGILLLQK  175 (185)
Q Consensus       167 l~gl~~L~~  175 (185)
                      +..|..+..
T Consensus       208 ~~tl~~~l~  216 (317)
T 1h2a_S          208 VGTIVYYLK  216 (317)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHH
T ss_conf             999999983