BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780853|ref|YP_003065266.1| NADH dehydrogenase subunit B
[Candidatus Liberibacter asiaticus str. psy62]
         (185 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780853|ref|YP_003065266.1| NADH dehydrogenase subunit B [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040530|gb|ACT57326.1| NADH dehydrogenase subunit B [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 185

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/185 (100%), Positives = 185/185 (100%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
           MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF
Sbjct: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60

Query: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP
Sbjct: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV
Sbjct: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180

Query: 181 GNVKC 185
           GNVKC
Sbjct: 181 GNVKC 185


>gi|315122725|ref|YP_004063214.1| NADH dehydrogenase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496127|gb|ADR52726.1| NADH dehydrogenase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 185

 Score =  336 bits (862), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 158/184 (85%), Positives = 168/184 (91%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
           MGLT  ++KI+   SS SLEK   DF    +E+ +KGFLV  +DQLVTWARTGSLMWMTF
Sbjct: 1   MGLTKFDRKIVVDHSSFSLEKAGMDFPSTDTELMNKGFLVAPIDQLVTWARTGSLMWMTF 60

Query: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP
Sbjct: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPTAEALIYGILLLQKKIRR+
Sbjct: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGILLLQKKIRRI 180

Query: 181 GNVK 184
           GN+K
Sbjct: 181 GNIK 184


>gi|300023456|ref|YP_003756067.1| NADH-quinone oxidoreductase subunit beta [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525277|gb|ADJ23746.1| NADH-quinone oxidoreductase, B subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 198

 Score =  308 bits (788), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (90%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           +SG ++  +   D  F+ IS+E+  KGFLVT+VD L+ WARTGSLMWMTFGLACCAVEMM
Sbjct: 24  VSGAATSIIRPDDQFFTGISNELADKGFLVTTVDDLINWARTGSLMWMTFGLACCAVEMM 83

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
           QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 84  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 143

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           NGGGYYHYSY+VVRGCDR+VPVD+YVPGCPPTAEAL+YGILLLQ+KIRR G ++
Sbjct: 144 NGGGYYHYSYAVVRGCDRVVPVDVYVPGCPPTAEALVYGILLLQRKIRRTGTIE 197


>gi|327188488|gb|EGE55702.1| NADH dehydrogenase subunit B [Rhizobium etli CNPAF512]
          Length = 201

 Score =  306 bits (784), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (84%), Gaps = 9/193 (4%)

Query: 1   MGLTTV-NQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWAR 51
           MG+T V NQ +++ Q    ++          DA F  I++E+  KGFLVTS D+L+ WAR
Sbjct: 8   MGVTPVSNQPLVAQQPKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWAR 67

Query: 52  TGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           TGSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 68  TGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALR 127

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VP+DIYVPGCPPTAEAL+YG+L
Sbjct: 128 KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVL 187

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 188 LLQKKIRRTGTIE 200


>gi|86357237|ref|YP_469129.1| NADH dehydrogenase subunit B [Rhizobium etli CFN 42]
 gi|218673424|ref|ZP_03523093.1| NADH dehydrogenase subunit B [Rhizobium etli GR56]
 gi|123512314|sp|Q2K9T4|NUOB1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|86281339|gb|ABC90402.1| NADH-ubiquinone oxidoreductase chain B protein [Rhizobium etli CFN
           42]
          Length = 194

 Score =  306 bits (783), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (84%), Gaps = 9/193 (4%)

Query: 1   MGLTTV-NQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWAR 51
           MG+T V NQ +++ Q    ++          DA F  I++E+  KGFLVTS D+L+ WAR
Sbjct: 1   MGVTPVSNQPLVAQQPKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWAR 60

Query: 52  TGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           TGSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 61  TGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALR 120

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VP+DIYVPGCPPTAEAL+YG+L
Sbjct: 121 KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVL 180

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 181 LLQKKIRRTGTIE 193


>gi|153009751|ref|YP_001370966.1| NADH dehydrogenase subunit B [Ochrobactrum anthropi ATCC 49188]
 gi|218527999|sp|A6X1N3|NUOB_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|151561639|gb|ABS15137.1| NADH-quinone oxidoreductase, B subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 193

 Score =  306 bits (783), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/192 (75%), Positives = 162/192 (84%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLTT N  +++ Q    L+          DA F+ ++SE++ KGF+VTS D L+TWART
Sbjct: 1   MGLTTANTTLVAPQPKGILDPRTGKPVGSDDAFFNDLNSELSDKGFIVTSADALITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGIL+
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILM 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|150396112|ref|YP_001326579.1| NADH dehydrogenase subunit B [Sinorhizobium medicae WSM419]
 gi|238065217|sp|A6U7W4|NUOB_SINMW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|150027627|gb|ABR59744.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium medicae
           WSM419]
          Length = 192

 Score =  306 bits (783), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 151/162 (93%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA F  I++E+  KGFLVTS D+L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 30  DAFFGEINNELADKGFLVTSTDELITWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERF 89

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 90  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 149

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 150 VRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 191


>gi|190891286|ref|YP_001977828.1| NADH-ubiquinone oxidoreductase, chain B [Rhizobium etli CIAT 652]
 gi|238065013|sp|B3PVZ8|NUOB1_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|190696565|gb|ACE90650.1| NADH-ubiquinone oxidoreductase protein, chain B [Rhizobium etli
           CIAT 652]
          Length = 194

 Score =  305 bits (781), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 144/193 (74%), Positives = 162/193 (83%), Gaps = 9/193 (4%)

Query: 1   MGLTTVNQK---------IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWAR 51
           MG+T V+ +         II   +   +   DA F  I++E+  KGFLVTS D+L+ WAR
Sbjct: 1   MGVTPVSNEPLVAQQPKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWAR 60

Query: 52  TGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           TGSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 61  TGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALR 120

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VP+DIYVPGCPPTAEAL+YG+L
Sbjct: 121 KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVL 180

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 181 LLQKKIRRTGTIE 193


>gi|209548863|ref|YP_002280780.1| NADH dehydrogenase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238065201|sp|B5ZYL3|NUOB_RHILW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|209534619|gb|ACI54554.1| NADH-quinone oxidoreductase, B subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 194

 Score =  305 bits (781), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/177 (79%), Positives = 156/177 (88%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   DA F  I++E+  KGFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 17  KGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAV 76

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 77  EMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 136

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 137 SCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 193


>gi|118590038|ref|ZP_01547442.1| NADH dehydrogenase subunit B [Stappia aggregata IAM 12614]
 gi|118437535|gb|EAV44172.1| NADH dehydrogenase subunit B [Stappia aggregata IAM 12614]
          Length = 192

 Score =  305 bits (780), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/191 (75%), Positives = 159/191 (83%), Gaps = 7/191 (3%)

Query: 1   MGLTTVN-------QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTG 53
           MGLTT         Q II   +   +   DA F  +++E+  KGFLVTS D L+ WARTG
Sbjct: 1   MGLTTTEPLVAPQPQGIIDPNTGKPVGADDAFFLEVNNELADKGFLVTSTDNLIQWARTG 60

Query: 54  SLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRV 113
           SLMWMTFGLACCAVEMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+V
Sbjct: 61  SLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKV 120

Query: 114 YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLL 173
           YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+L+L
Sbjct: 121 YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLML 180

Query: 174 QKKIRRVGNVK 184
           QKKIRR G ++
Sbjct: 181 QKKIRRTGTIE 191


>gi|239831687|ref|ZP_04680016.1| NADH-quinone oxidoreductase, B subunit [Ochrobactrum intermedium
           LMG 3301]
 gi|239823954|gb|EEQ95522.1| NADH-quinone oxidoreductase, B subunit [Ochrobactrum intermedium
           LMG 3301]
          Length = 193

 Score =  305 bits (780), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 162/192 (84%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT+ N  +++ Q    L+          DA F+ ++SE++ KGF+VTS D L+TWART
Sbjct: 1   MGLTSANTTLVAPQPKGILDPRTGKPVGSDDAFFNDLNSELSDKGFIVTSADALITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGIL+
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILM 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|227821618|ref|YP_002825588.1| NADH dehydrogenase subunit B [Sinorhizobium fredii NGR234]
 gi|227340617|gb|ACP24835.1| NADH dehydrogenase I chain B [Sinorhizobium fredii NGR234]
          Length = 192

 Score =  304 bits (779), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/177 (79%), Positives = 155/177 (87%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   DA F  I++E+  KGFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 15  KGIIDPATGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAV 74

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 75  EMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 134

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 135 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 191


>gi|15965018|ref|NP_385371.1| NADH dehydrogenase subunit B [Sinorhizobium meliloti 1021]
 gi|307301090|ref|ZP_07580859.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           BL225C]
 gi|307317824|ref|ZP_07597262.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           AK83]
 gi|7387950|sp|O68853|NUOB1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|5650735|emb|CAB51621.1| nuoB1 [Sinorhizobium meliloti]
 gi|15074197|emb|CAC45844.1| NADH-ubiqionone oxidoreductase subunit K transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306896586|gb|EFN27334.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           AK83]
 gi|306904045|gb|EFN34631.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           BL225C]
          Length = 192

 Score =  304 bits (778), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 139/162 (85%), Positives = 150/162 (92%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA F  I++E+  KGFLVTS D+L+ WARTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 30  DAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERF 89

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 90  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 149

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 150 VRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 191


>gi|217979050|ref|YP_002363197.1| NADH-quinone oxidoreductase, B subunit [Methylocella silvestris
           BL2]
 gi|238065173|sp|B8EIL8|NUOB_METSB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|217504426|gb|ACK51835.1| NADH-quinone oxidoreductase, B subunit [Methylocella silvestris
           BL2]
          Length = 187

 Score =  304 bits (778), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 2/186 (1%)

Query: 1   MGLTTVNQK--IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWM 58
           MGLT   Q+  +I+  +   L   D  F  I+ ++  KGFLVTS D+L+ WARTGSLMWM
Sbjct: 1   MGLTPAPQEGLVINPATDRPLAANDPYFLSINDKLADKGFLVTSTDELINWARTGSLMWM 60

Query: 59  TFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMP 118
           TFGLACCAVEMMQASMPRYD+ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMP
Sbjct: 61  TFGLACCAVEMMQASMPRYDVERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMP 120

Query: 119 EPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           EPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP+AEAL+YGILLLQ+KIR
Sbjct: 121 EPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGILLLQRKIR 180

Query: 179 RVGNVK 184
           R G ++
Sbjct: 181 RTGTIE 186


>gi|222085576|ref|YP_002544106.1| NADH-ubiquinone oxidoreductase chain B protein [Agrobacterium
           radiobacter K84]
 gi|238065070|sp|B9JD43|NUOB_AGRRK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|221723024|gb|ACM26180.1| NADH-ubiquinone oxidoreductase chain B protein [Agrobacterium
           radiobacter K84]
          Length = 193

 Score =  303 bits (777), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 160/192 (83%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWART 52
           MG+   N  +++ Q    ++          D  F  I++E+  KGFLVTS D+L+ WART
Sbjct: 1   MGVAQSNTTLVAPQPKGIIDPATGKPVGSNDPFFGEINNELADKGFLVTSTDELINWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMQVSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP+DIY+PGCPPTAEAL+YG+LL
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYIPGCPPTAEALLYGVLL 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|116251467|ref|YP_767305.1| NADH dehydrogenase subunit B [Rhizobium leguminosarum bv. viciae
           3841]
 gi|238065200|sp|Q1MIL4|NUOB_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|115256115|emb|CAK07196.1| putative NADH-quinone oxidoreductase subunit B [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 194

 Score =  303 bits (776), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 155/177 (87%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  I++E+  KGFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 17  KGIIDPSTGKPIGSNDPFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAV 76

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 77  EMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 136

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 137 SCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 193


>gi|218457950|ref|ZP_03498041.1| NADH dehydrogenase subunit B [Rhizobium etli Kim 5]
          Length = 185

 Score =  303 bits (776), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 155/175 (88%)

Query: 7   NQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCA 66
           ++ II   +   +   DA F  I++E+  KGFLVTS D+L+ WARTGSLMWMTFGLACCA
Sbjct: 11  SKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCA 70

Query: 67  VEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISM 126
           VEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISM
Sbjct: 71  VEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISM 130

Query: 127 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           GSCANGGGYYHYSYSVVRGCDR+VP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G
Sbjct: 131 GSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTG 185


>gi|260545498|ref|ZP_05821239.1| NADH-quinone oxidoreductase subunit C/D [Brucella abortus NCTC
           8038]
 gi|297248157|ref|ZP_06931875.1| NADH dehydrogenase I subunit B [Brucella abortus bv. 5 str. B3196]
 gi|260096905|gb|EEW80780.1| NADH-quinone oxidoreductase subunit C/D [Brucella abortus NCTC
           8038]
 gi|297175326|gb|EFH34673.1| NADH dehydrogenase I subunit B [Brucella abortus bv. 5 str. B3196]
          Length = 200

 Score =  303 bits (776), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT  N  +++ Q    L+          DA F+ ++ E++ KGF+VTS D L+TWART
Sbjct: 8   MGLTGTNTTLVAPQPKGILDPRTGKTVGSDDAFFNDLNGELSDKGFIVTSADALITWART 67

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 68  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 127

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGILL
Sbjct: 128 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILL 187

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 188 LQKKIRRTGTIE 199


>gi|241204087|ref|YP_002975183.1| NADH dehydrogenase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857977|gb|ACS55644.1| NADH-quinone oxidoreductase, B subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 194

 Score =  303 bits (775), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 144/193 (74%), Positives = 162/193 (83%), Gaps = 9/193 (4%)

Query: 1   MGLTTV-NQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWAR 51
           MG+  V NQ +++ Q    ++          D  F  I++E+  KGFLVTS D+L+ WAR
Sbjct: 1   MGVAPVSNQPLVAQQPKGIIDPSTGKPVGSNDPFFGEINNELADKGFLVTSTDELINWAR 60

Query: 52  TGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           TGSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 61  TGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALR 120

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG+L
Sbjct: 121 KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVL 180

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 181 LLQKKIRRTGTIE 193


>gi|17987440|ref|NP_540074.1| NADH dehydrogenase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|260563836|ref|ZP_05834322.1| NADH-quinone oxidoreductase subunit C/D [Brucella melitensis bv. 1
           str. 16M]
 gi|260566633|ref|ZP_05837103.1| NADH-quinone oxidoreductase subunit C/D [Brucella suis bv. 4 str.
           40]
 gi|17983133|gb|AAL52338.1| NADH-quinone oxidoreductase chain b [Brucella melitensis bv. 1 str.
           16M]
 gi|260153852|gb|EEW88944.1| NADH-quinone oxidoreductase subunit C/D [Brucella melitensis bv. 1
           str. 16M]
 gi|260156151|gb|EEW91231.1| NADH-quinone oxidoreductase subunit C/D [Brucella suis bv. 4 str.
           40]
          Length = 200

 Score =  303 bits (775), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT  N  +++ Q    L+          DA F+ ++ E++ KGF+VTS D L+TWART
Sbjct: 8   MGLTGTNTTLVAPQPKGILDPRTGKPVGSDDAFFNDLNGELSDKGFIVTSADALITWART 67

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 68  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 127

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGILL
Sbjct: 128 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILL 187

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 188 LQKKIRRTGTIE 199


>gi|298291846|ref|YP_003693785.1| NADH-quinone oxidoreductase subunit beta [Starkeya novella DSM 506]
 gi|296928357|gb|ADH89166.1| NADH-quinone oxidoreductase, B subunit [Starkeya novella DSM 506]
          Length = 192

 Score =  302 bits (774), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 138/175 (78%), Positives = 154/175 (88%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           II   +   +   D  F  +++E+  KGFLVT+ D+L+ WARTGSLMWMTFGLACCAVEM
Sbjct: 17  IIDPNTGKPVGTTDPFFVEVNAELADKGFLVTATDELINWARTGSLMWMTFGLACCAVEM 76

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 77  MQTSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 136

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVPVDIY+PGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 137 ANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGVLLLQKKIRRTGTIE 191


>gi|62289752|ref|YP_221545.1| NADH dehydrogenase subunit B [Brucella abortus bv. 1 str. 9-941]
 gi|82699680|ref|YP_414254.1| NADH dehydrogenase subunit B [Brucella melitensis biovar Abortus
           2308]
 gi|189023997|ref|YP_001934765.1| NADH dehydrogenase subunit B [Brucella abortus S19]
 gi|237815239|ref|ZP_04594237.1| NADH-quinone oxidoreductase, B subunit [Brucella abortus str. 2308
           A]
 gi|254689059|ref|ZP_05152313.1| NADH dehydrogenase subunit B [Brucella abortus bv. 6 str. 870]
 gi|254697193|ref|ZP_05159021.1| NADH dehydrogenase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730089|ref|ZP_05188667.1| NADH dehydrogenase subunit B [Brucella abortus bv. 4 str. 292]
 gi|256257308|ref|ZP_05462844.1| NADH dehydrogenase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260754557|ref|ZP_05866905.1| NADH-quinone oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260757778|ref|ZP_05870126.1| NADH-quinone oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260761603|ref|ZP_05873946.1| NADH-quinone oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883584|ref|ZP_05895198.1| NADH-quinone oxidoreductase subunit B [Brucella abortus bv. 9 str.
           C68]
 gi|75496975|sp|Q57DV0|NUOB_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|123546615|sp|Q2YNC8|NUOB_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527975|sp|B2S544|NUOB_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|62195884|gb|AAX74184.1| NuoB, NADH dehydrogenase I, B subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615781|emb|CAJ10779.1| NADH ubiquinone oxidoreductase domain, 20 kDa subunit:NADH
           dehydrogenase (ubiquinone), 20 kDa subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|189019569|gb|ACD72291.1| NADH dehydrogenase beta subunit [Brucella abortus S19]
 gi|237790076|gb|EEP64286.1| NADH-quinone oxidoreductase, B subunit [Brucella abortus str. 2308
           A]
 gi|260668096|gb|EEX55036.1| NADH-quinone oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260672035|gb|EEX58856.1| NADH-quinone oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674665|gb|EEX61486.1| NADH-quinone oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260873112|gb|EEX80181.1| NADH-quinone oxidoreductase subunit B [Brucella abortus bv. 9 str.
           C68]
          Length = 193

 Score =  302 bits (774), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT  N  +++ Q    L+          DA F+ ++ E++ KGF+VTS D L+TWART
Sbjct: 1   MGLTGTNTTLVAPQPKGILDPRTGKTVGSDDAFFNDLNGELSDKGFIVTSADALITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGILL
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILL 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|23501690|ref|NP_697817.1| NADH dehydrogenase subunit B [Brucella suis 1330]
 gi|148559527|ref|YP_001258781.1| NADH dehydrogenase subunit B [Brucella ovis ATCC 25840]
 gi|161618767|ref|YP_001592654.1| NADH dehydrogenase subunit B [Brucella canis ATCC 23365]
 gi|163843076|ref|YP_001627480.1| NADH dehydrogenase subunit B [Brucella suis ATCC 23445]
 gi|225627300|ref|ZP_03785337.1| NADH-quinone oxidoreductase, B subunit [Brucella ceti str. Cudo]
 gi|225852319|ref|YP_002732552.1| NADH dehydrogenase subunit B [Brucella melitensis ATCC 23457]
 gi|254693541|ref|ZP_05155369.1| NADH dehydrogenase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|254701571|ref|ZP_05163399.1| NADH dehydrogenase subunit B [Brucella suis bv. 5 str. 513]
 gi|254704118|ref|ZP_05165946.1| NADH dehydrogenase subunit B [Brucella suis bv. 3 str. 686]
 gi|254706982|ref|ZP_05168810.1| NADH dehydrogenase subunit B [Brucella pinnipedialis M163/99/10]
 gi|254709911|ref|ZP_05171722.1| NADH dehydrogenase subunit B [Brucella pinnipedialis B2/94]
 gi|254713912|ref|ZP_05175723.1| NADH dehydrogenase subunit B [Brucella ceti M644/93/1]
 gi|254717030|ref|ZP_05178841.1| NADH dehydrogenase subunit B [Brucella ceti M13/05/1]
 gi|254718912|ref|ZP_05180723.1| NADH dehydrogenase subunit B [Brucella sp. 83/13]
 gi|256031404|ref|ZP_05445018.1| NADH dehydrogenase subunit B [Brucella pinnipedialis M292/94/1]
 gi|256044482|ref|ZP_05447386.1| NADH dehydrogenase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060915|ref|ZP_05451073.1| NADH dehydrogenase subunit B [Brucella neotomae 5K33]
 gi|256113333|ref|ZP_05454195.1| NADH dehydrogenase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|256159525|ref|ZP_05457293.1| NADH dehydrogenase subunit B [Brucella ceti M490/95/1]
 gi|256254812|ref|ZP_05460348.1| NADH dehydrogenase subunit B [Brucella ceti B1/94]
 gi|256264182|ref|ZP_05466714.1| NADH dehydrogenase beta subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369235|ref|YP_003106743.1| NADH dehydrogenase beta subunit [Brucella microti CCM 4915]
 gi|260168538|ref|ZP_05755349.1| NADH dehydrogenase subunit B [Brucella sp. F5/99]
 gi|261213806|ref|ZP_05928087.1| NADH-quinone oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|261218837|ref|ZP_05933118.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M13/05/1]
 gi|261221993|ref|ZP_05936274.1| NADH-quinone oxidoreductase subunit B [Brucella ceti B1/94]
 gi|261314445|ref|ZP_05953642.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           M163/99/10]
 gi|261317457|ref|ZP_05956654.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           B2/94]
 gi|261321664|ref|ZP_05960861.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M644/93/1]
 gi|261324915|ref|ZP_05964112.1| NADH-quinone oxidoreductase subunit B [Brucella neotomae 5K33]
 gi|261752124|ref|ZP_05995833.1| NADH-quinone oxidoreductase subunit B [Brucella suis bv. 5 str.
           513]
 gi|261754784|ref|ZP_05998493.1| NADH-quinone oxidoreductase subunit B [Brucella suis bv. 3 str.
           686]
 gi|261758011|ref|ZP_06001720.1| NADH dehydrogenase subunit B [Brucella sp. F5/99]
 gi|265983899|ref|ZP_06096634.1| NADH-quinone oxidoreductase subunit B [Brucella sp. 83/13]
 gi|265988493|ref|ZP_06101050.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           M292/94/1]
 gi|265990906|ref|ZP_06103463.1| NADH-quinone oxidoreductase subunit B [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994743|ref|ZP_06107300.1| NADH-quinone oxidoreductase subunit B [Brucella melitensis bv. 3
           str. Ether]
 gi|265997957|ref|ZP_06110514.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M490/95/1]
 gi|294852160|ref|ZP_06792833.1| NADH-quinone oxidoreductase subunit B [Brucella sp. NVSL 07-0026]
 gi|306838240|ref|ZP_07471092.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. NF 2653]
 gi|306841959|ref|ZP_07474636.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. BO2]
 gi|306843740|ref|ZP_07476339.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. BO1]
 gi|81752805|sp|Q8G1B6|NUOB_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527976|sp|A9MAI0|NUOB_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527977|sp|A5VPY4|NUOB_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527978|sp|B0CLD0|NUOB_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528072|sp|Q8YGK1|NUOB_BRUME RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767790|sp|C0RIE0|NUOB_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|23347612|gb|AAN29732.1| NADH dehydrogenase I, B subunit [Brucella suis 1330]
 gi|148370784|gb|ABQ60763.1| NADH dehydrogenase I, B subunit [Brucella ovis ATCC 25840]
 gi|161335578|gb|ABX61883.1| NADH-quinone oxidoreductase, B subunit [Brucella canis ATCC 23365]
 gi|163673799|gb|ABY37910.1| NADH-quinone oxidoreductase, B subunit [Brucella suis ATCC 23445]
 gi|225617305|gb|EEH14350.1| NADH-quinone oxidoreductase, B subunit [Brucella ceti str. Cudo]
 gi|225640684|gb|ACO00598.1| NADH-quinone oxidoreductase, B subunit [Brucella melitensis ATCC
           23457]
 gi|255999395|gb|ACU47794.1| NADH dehydrogenase beta subunit [Brucella microti CCM 4915]
 gi|260915413|gb|EEX82274.1| NADH-quinone oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|260920577|gb|EEX87230.1| NADH-quinone oxidoreductase subunit B [Brucella ceti B1/94]
 gi|260923926|gb|EEX90494.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M13/05/1]
 gi|261294354|gb|EEX97850.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M644/93/1]
 gi|261296680|gb|EEY00177.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           B2/94]
 gi|261300895|gb|EEY04392.1| NADH-quinone oxidoreductase subunit B [Brucella neotomae 5K33]
 gi|261303471|gb|EEY06968.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           M163/99/10]
 gi|261737995|gb|EEY25991.1| NADH dehydrogenase subunit B [Brucella sp. F5/99]
 gi|261741877|gb|EEY29803.1| NADH-quinone oxidoreductase subunit B [Brucella suis bv. 5 str.
           513]
 gi|261744537|gb|EEY32463.1| NADH-quinone oxidoreductase subunit B [Brucella suis bv. 3 str.
           686]
 gi|262552425|gb|EEZ08415.1| NADH-quinone oxidoreductase subunit B [Brucella ceti M490/95/1]
 gi|262765856|gb|EEZ11645.1| NADH-quinone oxidoreductase subunit B [Brucella melitensis bv. 3
           str. Ether]
 gi|263001690|gb|EEZ14265.1| NADH-quinone oxidoreductase subunit B [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094400|gb|EEZ18245.1| NADH dehydrogenase beta subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660690|gb|EEZ30951.1| NADH-quinone oxidoreductase subunit B [Brucella pinnipedialis
           M292/94/1]
 gi|264662491|gb|EEZ32752.1| NADH-quinone oxidoreductase subunit B [Brucella sp. 83/13]
 gi|294820749|gb|EFG37748.1| NADH-quinone oxidoreductase subunit B [Brucella sp. NVSL 07-0026]
 gi|306275931|gb|EFM57644.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. BO1]
 gi|306287950|gb|EFM59361.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. BO2]
 gi|306406684|gb|EFM62911.1| NADH-quinone oxidoreductase, B subunit [Brucella sp. NF 2653]
 gi|326408826|gb|ADZ65891.1| NADH dehydrogenase subunit B [Brucella melitensis M28]
          Length = 193

 Score =  302 bits (774), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT  N  +++ Q    L+          DA F+ ++ E++ KGF+VTS D L+TWART
Sbjct: 1   MGLTGTNTTLVAPQPKGILDPRTGKPVGSDDAFFNDLNGELSDKGFIVTSADALITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMHISMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YGILL
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILL 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|163759542|ref|ZP_02166627.1| NADH dehydrogenase beta subunit [Hoeflea phototrophica DFL-43]
 gi|162283139|gb|EDQ33425.1| NADH dehydrogenase beta subunit [Hoeflea phototrophica DFL-43]
          Length = 191

 Score =  302 bits (773), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 138/177 (77%), Positives = 156/177 (88%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   + + DA F  +++E+  KGFLVTS D+L+ W+RTGSLMWMTFGLACCAV
Sbjct: 14  KGIIDPNTGKPVGQDDAFFGEVNNELADKGFLVTSTDELINWSRTGSLMWMTFGLACCAV 73

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 74  EMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 133

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKK+RR G ++
Sbjct: 134 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKMRRTGTIE 190


>gi|154248551|ref|YP_001419509.1| NADH-quinone oxidoreductase, B subunit [Xanthobacter autotrophicus
           Py2]
 gi|238065245|sp|A7IPA6|NUOB_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|154162636|gb|ABS69852.1| NADH-quinone oxidoreductase, B subunit [Xanthobacter autotrophicus
           Py2]
          Length = 194

 Score =  302 bits (773), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 138/177 (77%), Positives = 156/177 (88%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           Q I+   +   +   D  F  I+SE+  KGF++T+ D L+TWARTGSLMWMTFGLACCAV
Sbjct: 17  QGIVDPSTGRPVGADDPFFKEINSELADKGFILTTADDLITWARTGSLMWMTFGLACCAV 76

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 77  EMMQVSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 136

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYH+SY+VVRGCDRIVPVDIYVPGCPPTAEAL+YG+LLLQKKIRR+G ++
Sbjct: 137 SCANGGGYYHFSYAVVRGCDRIVPVDIYVPGCPPTAEALLYGVLLLQKKIRRIGTIE 193


>gi|307942118|ref|ZP_07657469.1| NADH-quinone oxidoreductase subunit b 1 [Roseibium sp. TrichSKD4]
 gi|307774404|gb|EFO33614.1| NADH-quinone oxidoreductase subunit b 1 [Roseibium sp. TrichSKD4]
          Length = 193

 Score =  301 bits (771), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLEK-----VDAD---FSRISSEITHKGFLVTSVDQLVTWART 52
           MGLT  ++ +I+ Q    ++      V AD   F  ++ ++  KGFLVTS D L+ WART
Sbjct: 1   MGLTQTSKPLIAEQPKGIIDPNTGKPVGADDPFFLEVNDQLADKGFLVTSTDNLIQWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMQMSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+L+
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLM 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|254503578|ref|ZP_05115729.1| NADH-quinone oxidoreductase, B subunit subfamily [Labrenzia
           alexandrii DFL-11]
 gi|222439649|gb|EEE46328.1| NADH-quinone oxidoreductase, B subunit subfamily [Labrenzia
           alexandrii DFL-11]
          Length = 199

 Score =  301 bits (771), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/191 (74%), Positives = 157/191 (82%), Gaps = 7/191 (3%)

Query: 1   MGLTTVN-------QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTG 53
           MGLTT         + II   +   +   D  F  ++ E+  KGFLVTS D L+ WARTG
Sbjct: 8   MGLTTAKPLIAEQPKGIIDPNTGKPVGADDPFFLEVNDELADKGFLVTSTDNLIQWARTG 67

Query: 54  SLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRV 113
           SLMWMTFGLACCAVEMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+V
Sbjct: 68  SLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKV 127

Query: 114 YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLL 173
           YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+L+L
Sbjct: 128 YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLML 187

Query: 174 QKKIRRVGNVK 184
           QKKIRR G ++
Sbjct: 188 QKKIRRTGTIE 198


>gi|158423292|ref|YP_001524584.1| NADH dehydrogenase subunit B [Azorhizobium caulinodans ORS 571]
 gi|218527974|sp|A8I3Y7|NUOB_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|158330181|dbj|BAF87666.1| NADH ubiqionone oxidoreductase chain B protein [Azorhizobium
           caulinodans ORS 571]
          Length = 192

 Score =  301 bits (770), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 138/177 (77%), Positives = 156/177 (88%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  +  I++E+  KGFLVT+VD L+TWARTGSLMWMTFGLACCAV
Sbjct: 15  KGIIDPSTGRPILSDDPFYKEINAELADKGFLVTTVDDLITWARTGSLMWMTFGLACCAV 74

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 75  EMMQVSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 134

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSY+VVRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQ+KIRR G ++
Sbjct: 135 SCANGGGYYHYSYAVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQRKIRRTGTIE 191


>gi|75676078|ref|YP_318499.1| NADH dehydrogenase subunit B [Nitrobacter winogradskyi Nb-255]
 gi|123613264|sp|Q3SRE4|NUOB_NITWN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|74420948|gb|ABA05147.1| NADH dehydrogenase subunit B [Nitrobacter winogradskyi Nb-255]
          Length = 207

 Score =  301 bits (770), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 45  DPYFLEVNHELSDKGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 104

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 105 GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 164

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRRVG ++
Sbjct: 165 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRVGTIE 206


>gi|121602032|ref|YP_989071.1| NADH dehydrogenase subunit B [Bartonella bacilliformis KC583]
 gi|238055234|sp|A1USW8|NUOB_BARBK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|120614209|gb|ABM44810.1| NADH dehydrogenase (quinone), B subunit [Bartonella bacilliformis
           KC583]
          Length = 193

 Score =  300 bits (769), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLE--------KVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGL   N  I++ Q+   ++          D  F  +++E++ KGFLVTSVD L+TWART
Sbjct: 1   MGLVFNNSTIVAPQAKGIIDPNTSKLIGANDQFFQDMNAELSDKGFLVTSVDSLITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWM+FGLACCAVEMMQ SMP YD ERFG+APRASPRQSDVM+VAGTLTNKMA ALR+
Sbjct: 61  GSLMWMSFGLACCAVEMMQCSMPHYDNERFGYAPRASPRQSDVMVVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGILL
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILL 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G+++
Sbjct: 181 LQKKIRRTGSIE 192


>gi|27380029|ref|NP_771558.1| NADH dehydrogenase subunit B [Bradyrhizobium japonicum USDA 110]
 gi|81736772|sp|Q89KI7|NUOB_BRAJA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|27353183|dbj|BAC50183.1| NADH ubiqionone oxidoreductase chain B [Bradyrhizobium japonicum
           USDA 110]
          Length = 202

 Score =  300 bits (768), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 138/182 (75%), Positives = 155/182 (85%)

Query: 3   LTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGL 62
           L    + I+   +   +   D  F  ++SE++ KGF V + D L+TWARTGSLMWMTFGL
Sbjct: 20  LAPAPKGILDPSTGKPVGANDPFFLEVNSELSDKGFFVAATDDLITWARTGSLMWMTFGL 79

Query: 63  ACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRY 122
           ACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRY
Sbjct: 80  ACCAVEMMQVSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRY 139

Query: 123 VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VISMGSCANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G 
Sbjct: 140 VISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGT 199

Query: 183 VK 184
           ++
Sbjct: 200 IE 201


>gi|85717029|ref|ZP_01047991.1| NADH dehydrogenase beta subunit [Nitrobacter sp. Nb-311A]
 gi|85696153|gb|EAQ34049.1| NADH dehydrogenase beta subunit [Nitrobacter sp. Nb-311A]
          Length = 200

 Score =  300 bits (768), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 38  DPYFLEVNHELSDKGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 97

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 98  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 157

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVD+YVPGCPPTAEAL+YGILLLQKKIRRVG ++
Sbjct: 158 VRGCDRIVPVDVYVPGCPPTAEALLYGILLLQKKIRRVGTIE 199


>gi|209885052|ref|YP_002288909.1| NADH-quinone oxidoreductase subunit b 1 [Oligotropha
           carboxidovorans OM5]
 gi|238065186|sp|B6JGW0|NUOB_OLICO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|209873248|gb|ACI93044.1| NADH-quinone oxidoreductase subunit b 1 [Oligotropha
           carboxidovorans OM5]
          Length = 198

 Score =  299 bits (766), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  I+ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 36  DRYFLEINHELSDKGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 95

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 96  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 155

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YG+LLLQKKIRR+G ++
Sbjct: 156 VRGCDRIVPVDIYVPGCPPTAEALLYGVLLLQKKIRRIGTIE 197


>gi|220924006|ref|YP_002499308.1| NADH dehydrogenase subunit B [Methylobacterium nodulans ORS 2060]
 gi|238065169|sp|B8IUU7|NUOB_METNO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|219948613|gb|ACL59005.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium nodulans
           ORS 2060]
          Length = 197

 Score =  299 bits (766), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  I+ E+  +GFL+T+ D L+TWARTGSLMWMTFGLACCAV
Sbjct: 20  KGIIDPATGLPVGATDPTFLSINDELADRGFLLTTADDLITWARTGSLMWMTFGLACCAV 79

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 80  EMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 139

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YG+LLLQKKIRR G ++
Sbjct: 140 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQKKIRRTGTIE 196


>gi|170742512|ref|YP_001771167.1| NADH dehydrogenase subunit B [Methylobacterium sp. 4-46]
 gi|238065172|sp|B0ULK5|NUOB_METS4 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|168196786|gb|ACA18733.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium sp. 4-46]
          Length = 195

 Score =  298 bits (764), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 136/177 (76%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + I+   +   +   D  F  I+ E+  +GFL+T+ D L+TWARTGSLMWMTFGLACCAV
Sbjct: 18  KGILDPATGLPIGATDPTFLSINDELADRGFLLTTADDLITWARTGSLMWMTFGLACCAV 77

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 78  EMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 137

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YG+LLLQKKIRR G ++
Sbjct: 138 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQKKIRRTGTIE 194


>gi|92117743|ref|YP_577472.1| NADH dehydrogenase subunit B [Nitrobacter hamburgensis X14]
 gi|123387068|sp|Q1QL85|NUOB_NITHX RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|91800637|gb|ABE63012.1| NADH dehydrogenase subunit B [Nitrobacter hamburgensis X14]
          Length = 202

 Score =  298 bits (764), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%)

Query: 3   LTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGL 62
           +T     I+  ++   +   D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGL
Sbjct: 20  VTPAAASILDPRTGRPVGAGDPYFLEVNHELSDKGFFVAATDDLITWARTGSLMWMTFGL 79

Query: 63  ACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRY 122
           ACCAVEMMQ SMPRYD+ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRY
Sbjct: 80  ACCAVEMMQVSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRY 139

Query: 123 VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VISMGSCANGGGYYHYSYSVVRGCDRIVP+D+YVPGCPPTAEAL+YGILLLQKKIRR G 
Sbjct: 140 VISMGSCANGGGYYHYSYSVVRGCDRIVPIDVYVPGCPPTAEALLYGILLLQKKIRRTGT 199

Query: 183 VK 184
           ++
Sbjct: 200 IE 201


>gi|49475657|ref|YP_033698.1| NADH dehydrogenase subunit B [Bartonella henselae str. Houston-1]
 gi|81647866|sp|Q6G389|NUOB_BARHE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|49238464|emb|CAF27692.1| NADH dehydrogenase I, B subunit [Bartonella henselae str.
           Houston-1]
          Length = 193

 Score =  298 bits (763), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 142/192 (73%), Positives = 163/192 (84%), Gaps = 8/192 (4%)

Query: 1   MGLTTVNQKIISGQSSCSL-----EKVDAD---FSRISSEITHKGFLVTSVDQLVTWART 52
           MGL + N  I + +S   +     E + +D   F  +++E++ KGFLVTS D L+TWART
Sbjct: 1   MGLISSNSTITAPKSKGIIDPNTGELIGSDDRFFCEVNAELSEKGFLVTSADALITWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWM+FGLACCA+EMMQ SMP YD ERFG+APRASPRQSDVM+VAGTLTNKMA ALR+
Sbjct: 61  GSLMWMSFGLACCAIEMMQCSMPHYDNERFGYAPRASPRQSDVMVVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGILL
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILL 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G+++
Sbjct: 181 LQKKIRRTGSIE 192


>gi|319405697|emb|CBI79320.1| NADH dehydrogenase I, B subunit [Bartonella sp. AR 15-3]
          Length = 193

 Score =  298 bits (763), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/168 (82%), Positives = 154/168 (91%), Gaps = 3/168 (1%)

Query: 20  EKVDAD---FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
           E VD++   FS I++E+  KGFLVTS D L+TWARTGSLMWM+FGLACCAVEMMQ SMP 
Sbjct: 25  ELVDSNNKFFSDINTELGDKGFLVTSADALITWARTGSLMWMSFGLACCAVEMMQCSMPH 84

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD ERFG+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYY
Sbjct: 85  YDNERFGYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYY 144

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           HYSYSVVRGCDRIVPVDIY+PGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 145 HYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|299135032|ref|ZP_07028223.1| NADH-quinone oxidoreductase, B subunit [Afipia sp. 1NLS2]
 gi|298590009|gb|EFI50213.1| NADH-quinone oxidoreductase, B subunit [Afipia sp. 1NLS2]
          Length = 197

 Score =  298 bits (763), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 148/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  I+ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 35  DRYFLEINHELSDKGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 94

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 95  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 154

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 155 VRGCDRIVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 196


>gi|319898883|ref|YP_004158976.1| NADH dehydrogenase I, B subunit [Bartonella clarridgeiae 73]
 gi|319402847|emb|CBI76398.1| NADH dehydrogenase I, B subunit [Bartonella clarridgeiae 73]
          Length = 193

 Score =  298 bits (763), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 150/162 (92%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  FS I++E+  KGFLVTS D L+TWARTGSLMWM+FGLACCAVEMMQ SMP YD ERF
Sbjct: 31  DKFFSDINTELGDKGFLVTSADALITWARTGSLMWMSFGLACCAVEMMQCSMPHYDNERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 151 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|326538542|gb|ADZ86757.1| NADH-quinone oxidoreductase, B subunit [Brucella melitensis M5-90]
          Length = 191

 Score =  298 bits (763), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA F+ ++ E++ KGF+VTS D L+TWARTGSLMWMTFGLACCAVEMM  SMPRYD ERF
Sbjct: 29  DAFFNDLNGELSDKGFIVTSADALITWARTGSLMWMTFGLACCAVEMMHISMPRYDAERF 88

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 89  GIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 148

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YGILLLQKKIRR G ++
Sbjct: 149 VRGCDRVVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGTIE 190


>gi|319404258|emb|CBI77851.1| NADH dehydrogenase I, B subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 193

 Score =  298 bits (762), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 151/162 (93%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  FS I++E+  KGFLVTSVD L+TWARTGSLMWM+FGLACCAVEM+Q SMP YD ERF
Sbjct: 31  DKFFSDINAELGDKGFLVTSVDALITWARTGSLMWMSFGLACCAVEMIQCSMPHYDNERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIY+PGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 151 VRGCDRIVPVDIYIPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|114569906|ref|YP_756586.1| NADH dehydrogenase subunit B [Maricaulis maris MCS10]
 gi|122316124|sp|Q0APY9|NUOB_MARMM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|114340368|gb|ABI65648.1| NADH dehydrogenase subunit B [Maricaulis maris MCS10]
          Length = 188

 Score =  298 bits (762), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 150/165 (90%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           +K D  F  +S  +  KGF+V + D LVTWARTGSLMWMTFGLACCAVEMMQASMPRYD+
Sbjct: 23  KKHDPFFDGVSDALADKGFVVAAADDLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDV 82

Query: 80  ERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYS
Sbjct: 83  ERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYS 142

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKIRR G+++
Sbjct: 143 YSVVRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIRREGSIE 187


>gi|328543686|ref|YP_004303795.1| NADH-quinone oxidoreductase subunit B [polymorphum gilvum
           SL003B-26A1]
 gi|326413430|gb|ADZ70493.1| NADH-quinone oxidoreductase subunit B [Polymorphum gilvum
           SL003B-26A1]
          Length = 193

 Score =  298 bits (762), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 142/192 (73%), Positives = 157/192 (81%), Gaps = 8/192 (4%)

Query: 1   MGLTTVN--------QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWART 52
           MGLTT          + II   +   +   D  F  ++ E+  KGFLVT+ D L+ WART
Sbjct: 1   MGLTTTKGPLVAPAPRGIIDPNTGKPVGANDPFFMGMNDELADKGFLVTTTDNLIQWART 60

Query: 53  GSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRR 112
           GSLMWMTFGLACCAVEMMQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+
Sbjct: 61  GSLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRK 120

Query: 113 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILL 172
           VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+L+
Sbjct: 121 VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLM 180

Query: 173 LQKKIRRVGNVK 184
           LQKKIRR G ++
Sbjct: 181 LQKKIRRTGTIE 192


>gi|188580284|ref|YP_001923729.1| NADH dehydrogenase subunit B [Methylobacterium populi BJ001]
 gi|238065170|sp|B1ZA45|NUOB_METPB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|179343782|gb|ACB79194.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium populi
           BJ001]
          Length = 195

 Score =  297 bits (761), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 138/177 (77%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  ISSE+  +GFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 18  KGIIDPATGRPIGANDPTFLSISSELADRGFLVTSADELINWARTGSLMWMTFGLACCAV 77

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 78  EMMQMSMPRYDCERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 137

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YG+LLLQ+KIRR G ++
Sbjct: 138 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQRKIRRTGTIE 194


>gi|319408580|emb|CBI82235.1| NADH dehydrogenase I, B subunit [Bartonella schoenbuchensis R1]
          Length = 176

 Score =  297 bits (761), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 137/162 (84%), Positives = 150/162 (92%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  I++E++ KGFLVTS D L+TWARTGSLMWM+FGLACCAVEMMQ SMP YD ERF
Sbjct: 14  DKFFHDINAELSDKGFLVTSADALITWARTGSLMWMSFGLACCAVEMMQCSMPHYDNERF 73

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 74  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 133

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 134 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIE 175


>gi|146341114|ref|YP_001206162.1| NADH dehydrogenase subunit B [Bradyrhizobium sp. ORS278]
 gi|238055272|sp|A4YVL1|NUOB_BRASO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146193920|emb|CAL77937.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B)
           (NDH-1, chain B) [Bradyrhizobium sp. ORS278]
          Length = 193

 Score =  297 bits (760), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +  E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 31  DPYFLEVKHELSDKGFFVATADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 151 VRGCDRIVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 192


>gi|319407266|emb|CBI80905.1| NADH dehydrogenase I, B subunit [Bartonella sp. 1-1C]
          Length = 193

 Score =  297 bits (760), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 136/162 (83%), Positives = 151/162 (93%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F+ I++E+  KGFLVTSVD L+TWARTGSLMWM+FGLACCAVEM+Q SMP YD ERF
Sbjct: 31  DKFFNDINAELGDKGFLVTSVDSLITWARTGSLMWMSFGLACCAVEMIQCSMPHYDNERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIY+PGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 151 VRGCDRIVPVDIYIPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|148255914|ref|YP_001240499.1| NADH dehydrogenase subunit B [Bradyrhizobium sp. BTAi1]
 gi|238055271|sp|A5EK99|NUOB_BRASB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146408087|gb|ABQ36593.1| NADH dehydrogenase subunit B [Bradyrhizobium sp. BTAi1]
          Length = 194

 Score =  296 bits (759), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +  E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD+ERF
Sbjct: 32  DPYFLEVRHELSDKGFFVATADDLITWARTGSLMWMTFGLACCAVEMMQVSMPRYDVERF 91

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 92  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 151

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVP+DIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 152 VRGCDRIVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 193


>gi|170748477|ref|YP_001754737.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|238065171|sp|B1LUN6|NUOB_METRJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|170654999|gb|ACB24054.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 195

 Score =  296 bits (759), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 152/177 (85%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  IS E+  +GFL+T+ D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 18  KGIIDPNTGRPIGADDPTFLSISDELADRGFLLTTTDELINWARTGSLMWMTFGLACCAV 77

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 78  EMMQMSMPRYDCERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 137

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 138 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 194


>gi|49474178|ref|YP_032220.1| NADH dehydrogenase subunit B [Bartonella quintana str. Toulouse]
 gi|81647090|sp|Q6FZZ0|NUOB_BARQU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|49239682|emb|CAF26057.1| NADH dehydrogenase I, B subunit [Bartonella quintana str. Toulouse]
          Length = 193

 Score =  296 bits (759), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 138/178 (77%), Positives = 156/178 (87%)

Query: 7   NQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCA 66
           ++ II   +   +   D  F  I++E++ KGFLVTS D L+TWARTGSLMWM+FGLACCA
Sbjct: 15  SKGIIDPNTGKLIGSDDRFFHDINAELSDKGFLVTSADALITWARTGSLMWMSFGLACCA 74

Query: 67  VEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISM 126
           +EMMQ SMP YD ERFG+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISM
Sbjct: 75  IEMMQCSMPHYDNERFGYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISM 134

Query: 127 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 135 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|15888598|ref|NP_354279.1| NADH dehydrogenase subunit B [Agrobacterium tumefaciens str. C58]
 gi|15156318|gb|AAK87064.1| NADH ubiqionone oxidoreductase chain B [Agrobacterium tumefaciens
           str. C58]
          Length = 201

 Score =  296 bits (758), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 140/193 (72%), Positives = 161/193 (83%), Gaps = 9/193 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWART 52
           MG++  N  +++ Q    ++          DA F+ I+ E+  KGFLVTS D+L+TWART
Sbjct: 8   MGMSQNNSTLVAPQPKGIIDPATGKPVGSNDAYFTEINDELADKGFLVTSTDELITWART 67

Query: 53  GSLMWMTFGLACCAVE-MMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           GSLMWM FGLACCAVE +MQAS PRYD+ERFG APRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 68  GSLMWMQFGLACCAVEGLMQASGPRYDMERFGVAPRASPRQSDVMIVAGTLTNKMAPALR 127

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVPGCPPTAEAL+YG+L
Sbjct: 128 KVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVPGCPPTAEALLYGVL 187

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 188 LLQKKIRRTGTIE 200


>gi|254469713|ref|ZP_05083118.1| NADH-ubiquinone oxidoreductase chain b protein [Pseudovibrio sp.
           JE062]
 gi|211961548|gb|EEA96743.1| NADH-ubiquinone oxidoreductase chain b protein [Pseudovibrio sp.
           JE062]
          Length = 194

 Score =  296 bits (758), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 154/177 (87%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   + + D  F  +++E++ KGFLVTS + L+ WARTGSLMWMTFGLACCAV
Sbjct: 17  KGIIDPNTGRPVGENDPFFMNVNNELSDKGFLVTSSESLIQWARTGSLMWMTFGLACCAV 76

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 77  EMMQMSMPRYDAERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 136

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 137 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 193


>gi|86749691|ref|YP_486187.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris HaA2]
 gi|86572719|gb|ABD07276.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 204

 Score =  296 bits (758), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 151/175 (86%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           II   +   +   D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEM
Sbjct: 29  IIDPNTGKPVGADDPFFLDVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEM 88

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 89  MQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 148

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++LLQKKIRR G ++
Sbjct: 149 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIE 203


>gi|163868372|ref|YP_001609581.1| NADH dehydrogenase subunit B [Bartonella tribocorum CIP 105476]
 gi|238055237|sp|A9IUQ3|NUOB_BART1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|161018028|emb|CAK01586.1| NADH dehydrogenase I, B subunit [Bartonella tribocorum CIP 105476]
          Length = 193

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/162 (83%), Positives = 150/162 (92%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  I++E++ KGFLVTS D L+TWARTGSLMWM+FGLACCA+EMMQ SMP YD ERF
Sbjct: 31  DRFFRDINAELSDKGFLVTSADALITWARTGSLMWMSFGLACCAIEMMQCSMPHYDNERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 151 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|182679352|ref|YP_001833498.1| NADH-quinone oxidoreductase, B subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|238055244|sp|B2IHW6|NUOB_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|182635235|gb|ACB96009.1| NADH-quinone oxidoreductase, B subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 180

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 154/184 (83%), Gaps = 5/184 (2%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
           MGL    Q ++    +      D  F  I+ ++  KGFLVTS D+L+ WARTGSLMWMTF
Sbjct: 1   MGLIATPQPVVGTPPA-----QDNYFLSINDQLADKGFLVTSTDELINWARTGSLMWMTF 55

Query: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           GLACCAVEMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEP
Sbjct: 56  GLACCAVEMMQMSMPRYDCERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEP 115

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP+AEAL+YG+LLLQKKIRR 
Sbjct: 116 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGVLLLQKKIRRT 175

Query: 181 GNVK 184
           G ++
Sbjct: 176 GTIE 179


>gi|115524527|ref|YP_781438.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris BisA53]
 gi|122296214|sp|Q07NM6|NUOB2_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|115518474|gb|ABJ06458.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           BisA53]
          Length = 200

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +++E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 38  DRFFVEVNNELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERF 97

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+V
Sbjct: 98  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAV 157

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVP+DIYVPGCPPTAEAL+YG++LLQKKIRR+G ++
Sbjct: 158 VRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRIGTIE 199


>gi|316933892|ref|YP_004108874.1| NADH-quinone oxidoreductase subunit B [Rhodopseudomonas palustris
           DX-1]
 gi|315601606|gb|ADU44141.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 198

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/175 (77%), Positives = 151/175 (86%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           II   +   +   D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEM
Sbjct: 23  IIDPSTGKPVGANDPFFLNVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEM 82

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 83  MQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 142

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG++LLQKKIRR G ++
Sbjct: 143 ANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIE 197


>gi|325292633|ref|YP_004278497.1| NADH dehydrogenase I chain B [Agrobacterium sp. H13-3]
 gi|238065076|sp|A9CJB2|NUOB_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|325060486|gb|ADY64177.1| NADH dehydrogenase I chain B [Agrobacterium sp. H13-3]
          Length = 194

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 140/193 (72%), Positives = 161/193 (83%), Gaps = 9/193 (4%)

Query: 1   MGLTTVNQKIISGQSSCSLEKV--------DADFSRISSEITHKGFLVTSVDQLVTWART 52
           MG++  N  +++ Q    ++          DA F+ I+ E+  KGFLVTS D+L+TWART
Sbjct: 1   MGMSQNNSTLVAPQPKGIIDPATGKPVGSNDAYFTEINDELADKGFLVTSTDELITWART 60

Query: 53  GSLMWMTFGLACCAVE-MMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           GSLMWM FGLACCAVE +MQAS PRYD+ERFG APRASPRQSDVMIVAGTLTNKMA ALR
Sbjct: 61  GSLMWMQFGLACCAVEGLMQASGPRYDMERFGVAPRASPRQSDVMIVAGTLTNKMAPALR 120

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVPGCPPTAEAL+YG+L
Sbjct: 121 KVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVPGCPPTAEALLYGVL 180

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 181 LLQKKIRRTGTIE 193


>gi|163850516|ref|YP_001638559.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium extorquens
           PA1]
 gi|218529213|ref|YP_002420029.1| NADH dehydrogenase subunit B [Methylobacterium chloromethanicum
           CM4]
 gi|240137581|ref|YP_002962052.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B)
           [Methylobacterium extorquens AM1]
 gi|254560052|ref|YP_003067147.1| NADH-quinone oxidoreductase subunit B [Methylobacterium extorquens
           DM4]
 gi|238065167|sp|A9W1N2|NUOB_METEP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767795|sp|B7KQ65|NUOB_METC4 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|163662121|gb|ABY29488.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium extorquens
           PA1]
 gi|218521516|gb|ACK82101.1| NADH-quinone oxidoreductase, B subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240007549|gb|ACS38775.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B)
           [Methylobacterium extorquens AM1]
 gi|254267330|emb|CAX23162.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B)
           [Methylobacterium extorquens DM4]
          Length = 195

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/177 (76%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  I+ E+  +GFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 18  KGIIDPATGRPIGANDPTFLSINDELADRGFLVTSADELINWARTGSLMWMTFGLACCAV 77

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 78  EMMQMSMPRYDCERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 137

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YG+LLLQ+KIRR+G ++
Sbjct: 138 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQRKIRRIGTIE 194


>gi|240850584|ref|YP_002971984.1| NADH dehydrogenase I subunit B [Bartonella grahamii as4aup]
 gi|240267707|gb|ACS51295.1| NADH dehydrogenase I subunit B [Bartonella grahamii as4aup]
          Length = 193

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (92%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +++E++ KGFLVTS D L+TWARTGSLMWM+FGLACCA+EMMQ SMP YD ERF
Sbjct: 31  DKFFRDLNAELSDKGFLVTSADALITWARTGSLMWMSFGLACCAIEMMQCSMPHYDNERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G+APRASPRQSDVM+VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 91  GYAPRASPRQSDVMVVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G+++
Sbjct: 151 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGSIE 192


>gi|110633377|ref|YP_673585.1| NADH dehydrogenase subunit B [Mesorhizobium sp. BNC1]
 gi|122966123|sp|Q11JK5|NUOB_MESSB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|110284361|gb|ABG62420.1| NADH dehydrogenase subunit B [Chelativorans sp. BNC1]
          Length = 190

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 153/178 (85%)

Query: 7   NQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCA 66
           ++ II   +   +   D  +  I+ E++ KGFLVTS + L+TWARTGSLMWMTFGLACCA
Sbjct: 12  SRGIIDPNTGNPVGANDPFYGAINEELSDKGFLVTSSEALITWARTGSLMWMTFGLACCA 71

Query: 67  VEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISM 126
           VEMM  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISM
Sbjct: 72  VEMMHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISM 131

Query: 127 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQKKIRR G ++
Sbjct: 132 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILLLQKKIRRTGTIE 189


>gi|90417843|ref|ZP_01225755.1| NADH dehydrogenase I, B subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337515|gb|EAS51166.1| NADH dehydrogenase I, B subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 194

 Score =  296 bits (757), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D   + +++E+  KGFLVTS + L+ WARTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 32  DPFVTDVNNELADKGFLVTSTEDLIQWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERF 91

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 92  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 151

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 152 VRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 193


>gi|23006634|ref|ZP_00048864.1| COG0377: NADH:ubiquinone oxidoreductase 20 kD subunit and related
           Fe-S oxidoreductases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 195

 Score =  295 bits (756), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/177 (76%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   +   D  F  I+ E+  +GFLVTS D+L+ WARTGSLMWMTFGLACCAV
Sbjct: 18  KGIIDPATGRPIGANDPTFLSINDELADRGFLVTSADELINWARTGSLMWMTFGLACCAV 77

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMMQ SMPRYD ERFGFAPR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 78  EMMQMSMPRYDCERFGFAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 137

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YG+LLLQ+KIRR+G ++
Sbjct: 138 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGVLLLQRKIRRLGTIE 194


>gi|39936016|ref|NP_948292.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris CGA009]
 gi|192291671|ref|YP_001992276.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris TIE-1]
 gi|81562349|sp|Q6N5M3|NUOB1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|238065014|sp|B3Q7N5|NUOB1_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|39649870|emb|CAE28392.1| NADH-ubiquinone dehydrogenase chain B [Rhodopseudomonas palustris
           CGA009]
 gi|192285420|gb|ACF01801.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 198

 Score =  295 bits (755), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/175 (77%), Positives = 151/175 (86%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           II   +   +   D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEM
Sbjct: 23  IIDPNTGRPVGADDPFFLNVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEM 82

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 83  MQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 142

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG++LLQKKIRR G ++
Sbjct: 143 ANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIE 197


>gi|329850728|ref|ZP_08265573.1| NADH-quinone oxidoreductase subunit B [Asticcacaulis biprosthecum
           C19]
 gi|328841043|gb|EGF90614.1| NADH-quinone oxidoreductase subunit B [Asticcacaulis biprosthecum
           C19]
          Length = 184

 Score =  295 bits (754), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S+E+  KGFLV S D ++TWARTGSLMWMTFGLACCAVEMMQASMPRYD+ERF
Sbjct: 22  DKFFESVSAELDAKGFLVASADDVITWARTGSLMWMTFGLACCAVEMMQASMPRYDMERF 81

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+PRYV+SMGSCANGGGYYHYSYSV
Sbjct: 82  GMAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPDPRYVLSMGSCANGGGYYHYSYSV 141

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVD+YVPGCPP+AEAL+YG+L LQKKIRR GN++
Sbjct: 142 VRGCDRIVPVDVYVPGCPPSAEALLYGLLQLQKKIRRTGNIR 183


>gi|91977356|ref|YP_570015.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris BisB5]
 gi|122969140|sp|Q135X5|NUOB2_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|91683812|gb|ABE40114.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           BisB5]
          Length = 199

 Score =  295 bits (754), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/175 (77%), Positives = 151/175 (86%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           II   +   +   D  F  ++ E++ KGF V + D L+TWARTGSLMWMTFGLACCAVEM
Sbjct: 24  IIDPNTGKPVGADDPFFLGVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEM 83

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 84  MQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 143

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVP+DIYVPGCPPTAEAL+YG++LLQKKIRR G ++
Sbjct: 144 ANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIE 198


>gi|90423901|ref|YP_532271.1| NADH dehydrogenase subunit B [Rhodopseudomonas palustris BisB18]
 gi|122476336|sp|Q215I4|NUOB1_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|90105915|gb|ABD87952.1| NADH-quinone oxidoreductase, B subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 201

 Score =  294 bits (753), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +++E+  KGF V + D L+TWARTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 39  DRFFLEVNNELADKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERF 98

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+V
Sbjct: 99  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAV 158

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVP+DIYVPGCPPTAEAL+YG++LLQKKIRR G ++
Sbjct: 159 VRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIE 200


>gi|304391399|ref|ZP_07373341.1| NADH-quinone oxidoreductase subunit b 1 [Ahrensia sp. R2A130]
 gi|303295628|gb|EFL89986.1| NADH-quinone oxidoreductase subunit b 1 [Ahrensia sp. R2A130]
          Length = 191

 Score =  294 bits (753), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 134/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  I++E+  KGF+VT+ D L+ W+RTGSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 29  DPFFGEINNELADKGFIVTTTDDLINWSRTGSLMWMTFGLACCAVEMMQMSMPRYDSERF 88

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 89  GIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 148

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPP+AEAL+YG+LLLQKKIRR G ++
Sbjct: 149 VRGCDRIVPVDIYVPGCPPSAEALLYGVLLLQKKIRRTGTIE 190


>gi|114707368|ref|ZP_01440265.1| NADH-ubiquinone oxidoreductase chain B protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537249|gb|EAU40376.1| NADH-ubiquinone oxidoreductase chain B protein [Fulvimarina pelagi
           HTCC2506]
          Length = 194

 Score =  293 bits (750), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 146/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D   + I+ E+  KGFLVTS D L+ WAR GSLMWMTFGLACCAVEMMQ SMPRYD ERF
Sbjct: 32  DPFVTAINDELADKGFLVTSTDDLIQWARNGSLMWMTFGLACCAVEMMQMSMPRYDAERF 91

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 92  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 151

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR++PVDIYVPGCPP+AEAL+YG++LLQKKIRR G ++
Sbjct: 152 VRGCDRVIPVDIYVPGCPPSAEALLYGVMLLQKKIRRTGTIE 193


>gi|315499789|ref|YP_004088592.1| NADH-quinone oxidoreductase, b subunit [Asticcacaulis excentricus
           CB 48]
 gi|315417801|gb|ADU14441.1| NADH-quinone oxidoreductase, B subunit [Asticcacaulis excentricus
           CB 48]
          Length = 186

 Score =  293 bits (749), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 148/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +SSE+  KGFLV S D ++TWARTGSLMWMTFGLACCAVEMMQASMPRYD+ERF
Sbjct: 24  DKFFEAVSSELNEKGFLVASADDVITWARTGSLMWMTFGLACCAVEMMQASMPRYDMERF 83

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+PRYV+SMGSCANGGGYYHYSYSV
Sbjct: 84  GMAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPDPRYVLSMGSCANGGGYYHYSYSV 143

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVD+YVPGCPP+AEAL+YG+L LQKKIRR G ++
Sbjct: 144 VRGCDRIVPVDVYVPGCPPSAEALLYGLLQLQKKIRRNGTIR 185


>gi|86358166|ref|YP_470058.1| NADH dehydrogenase subunit B [Rhizobium etli CFN 42]
 gi|123511609|sp|Q2K755|NUOB2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|86282268|gb|ABC91331.1| NADH-ubiquinone oxidoreductase chain B protein [Rhizobium etli CFN
           42]
          Length = 186

 Score =  293 bits (749), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 134/162 (82%), Positives = 149/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     I++E+  KGFLVTS D+L+TWARTGSLMWMTFGLACCA+EMMQ SMPRYD+ERF
Sbjct: 24  DPTMGTINAELADKGFLVTSTDELITWARTGSLMWMTFGLACCAIEMMQMSMPRYDIERF 83

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTL NKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 84  GVAPRASPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 143

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YGILLLQ+KIRR G+++
Sbjct: 144 VRGCDRVVPVDIYVPGCPPTAEALLYGILLLQRKIRRNGSIE 185


>gi|154253664|ref|YP_001414488.1| NADH-quinone oxidoreductase subunit B [Parvibaculum lavamentivorans
           DS-1]
 gi|238065187|sp|A7HY48|NUOB_PARL1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|154157614|gb|ABS64831.1| NADH-quinone oxidoreductase, B subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 191

 Score =  292 bits (747), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 139/189 (73%), Positives = 157/189 (83%), Gaps = 6/189 (3%)

Query: 1   MGLTTVNQKI------ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGS 54
           MG+T  ++ I      +   +S    + DA F + + ++  KGF++T+VD L+ W+RTGS
Sbjct: 1   MGVTNPDKVISNTPGVVDPATSVPAWQDDAFFRQATDQLADKGFVLTTVDDLINWSRTGS 60

Query: 55  LMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVY 114
           LMWMTFGLACCAVEMMQ SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VY
Sbjct: 61  LMWMTFGLACCAVEMMQTSMPRYDAERFGVAPRASPRQSDVMIVAGTLTNKMAPALRKVY 120

Query: 115 DQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQ 174
           DQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ
Sbjct: 121 DQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILALQ 180

Query: 175 KKIRRVGNV 183
           KKIRR G +
Sbjct: 181 KKIRRTGTL 189


>gi|83858414|ref|ZP_00951936.1| NADH dehydrogenase beta subunit [Oceanicaulis alexandrii HTCC2633]
 gi|83853237|gb|EAP91089.1| NADH dehydrogenase beta subunit [Oceanicaulis alexandrii HTCC2633]
          Length = 187

 Score =  291 bits (746), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 135/165 (81%), Positives = 147/165 (89%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           +K D  F  +S  +  KGFLV + D L+TWARTGSLMWMTFGLACCAVEMMQASMPRYD+
Sbjct: 22  KKHDPFFDGVSDALADKGFLVAAADDLITWARTGSLMWMTFGLACCAVEMMQASMPRYDV 81

Query: 80  ERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           ER G APR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYS
Sbjct: 82  ERLGAAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYS 141

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSVVRGCDRIVP+DIYVPGCPPTAEAL+YGIL LQKKIRR G+++
Sbjct: 142 YSVVRGCDRIVPIDIYVPGCPPTAEALVYGILQLQKKIRREGSIE 186


>gi|241518517|ref|YP_002979145.1| NADH-quinone oxidoreductase, B subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862930|gb|ACS60594.1| NADH-quinone oxidoreductase, B subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 185

 Score =  291 bits (745), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     I++E+  KGFLVTS D+L+TWARTGSLMWMTFGLACCA+EMMQ SMPRYD+ERF
Sbjct: 23  DPTMGMINAELADKGFLVTSTDELITWARTGSLMWMTFGLACCAIEMMQMSMPRYDVERF 82

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APR SPRQSD+MIVAGTL NKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 83  GVAPRGSPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YGILLLQKKIRR G ++
Sbjct: 143 VRGCDRVVPVDIYVPGCPPTAEALLYGILLLQKKIRRNGTIE 184


>gi|218463554|ref|ZP_03503645.1| NADH dehydrogenase subunit B [Rhizobium etli Kim 5]
          Length = 186

 Score =  291 bits (744), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 134/162 (82%), Positives = 148/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     I++E+  KGFLVTS D+L+TWARTGSLMWMTFGLACCA+EMMQ SMPRYD+ERF
Sbjct: 24  DPMMGTINAELADKGFLVTSTDELITWARTGSLMWMTFGLACCAIEMMQMSMPRYDIERF 83

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APR SPRQSD+MIVAGTL NKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 84  GVAPRGSPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 143

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEAL+YGILLLQ+KIRR G+++
Sbjct: 144 VRGCDRIVPVDIYVPGCPPTAEALLYGILLLQRKIRRNGSIE 185


>gi|296444795|ref|ZP_06886758.1| NADH-quinone oxidoreductase, B subunit [Methylosinus trichosporium
           OB3b]
 gi|296257743|gb|EFH04807.1| NADH-quinone oxidoreductase, B subunit [Methylosinus trichosporium
           OB3b]
          Length = 194

 Score =  290 bits (743), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 138/193 (71%), Positives = 160/193 (82%), Gaps = 9/193 (4%)

Query: 1   MGLTTVNQKIISGQSSCSL------EKVDAD---FSRISSEITHKGFLVTSVDQLVTWAR 51
           MGL T     +   S+  L      + V AD   +  ++ E+  KGF+VT+ D ++ WAR
Sbjct: 1   MGLITRQSPTLVAPSAKGLVDPRTGKPVGADDPFYLGLNDELADKGFVVTATDDIINWAR 60

Query: 52  TGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALR 111
           TGSLMWMTFGLACCAVEM+QA+MPRYDLERFGFAPRASPRQSDV+I+AGTLTNKMA ALR
Sbjct: 61  TGSLMWMTFGLACCAVEMIQAAMPRYDLERFGFAPRASPRQSDVIIIAGTLTNKMAPALR 120

Query: 112 RVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGIL 171
           +VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEAL+YG+L
Sbjct: 121 KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPSAEALVYGVL 180

Query: 172 LLQKKIRRVGNVK 184
           LLQKKIRR G ++
Sbjct: 181 LLQKKIRRSGTIE 193


>gi|323138146|ref|ZP_08073219.1| NADH-quinone oxidoreductase, B subunit [Methylocystis sp. ATCC
           49242]
 gi|322396608|gb|EFX99136.1| NADH-quinone oxidoreductase, B subunit [Methylocystis sp. ATCC
           49242]
          Length = 194

 Score =  290 bits (743), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 148/162 (91%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F +I+ E+  KGF VT+ D ++ WARTGSLMWMTFGLACCAVEM+QA+MPRYDLERF
Sbjct: 32  DPFFLQINEELADKGFFVTATDDVINWARTGSLMWMTFGLACCAVEMIQAAMPRYDLERF 91

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSD +I+AGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 92  GFAPRASPRQSDCIIIAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 151

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRI+PVD+YVPGCPP+AEAL+YG+LLLQKKIRR G ++
Sbjct: 152 VRGCDRIIPVDVYVPGCPPSAEALVYGMLLLQKKIRRTGTIE 193


>gi|262277300|ref|ZP_06055093.1| NADH-quinone oxidoreductase subunit b (nadhdehydrogenase i subunit
           b) (ndh-1 subunit b) [alpha proteobacterium HIMB114]
 gi|262224403|gb|EEY74862.1| NADH-quinone oxidoreductase subunit b (nadhdehydrogenase i subunit
           b) (ndh-1 subunit b) [alpha proteobacterium HIMB114]
          Length = 173

 Score =  290 bits (741), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 132/166 (79%), Positives = 148/166 (89%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           L+++  +F  ++ E + KGF+  + D L+ WARTGSL WMTFGLACCAVEMMQASMPRYD
Sbjct: 7   LDQIPQEFREVAEEFSEKGFVTIASDTLINWARTGSLHWMTFGLACCAVEMMQASMPRYD 66

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           LERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHY
Sbjct: 67  LERFGAAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHY 126

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SYSVVRGCDRIVPVDIYVPGCPP+AEAL+Y IL LQKKIRR G+++
Sbjct: 127 SYSVVRGCDRIVPVDIYVPGCPPSAEALLYAILQLQKKIRREGSLQ 172


>gi|13471406|ref|NP_102972.1| NADH dehydrogenase subunit B [Mesorhizobium loti MAFF303099]
 gi|14022148|dbj|BAB48758.1| NADH-ubiquinone dehydrogenase chain B 1 [Mesorhizobium loti
           MAFF303099]
          Length = 200

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   + + D  F  I++E+  KGFLVTS + L+TWAR+GSLM+MTFGLACCAV
Sbjct: 23  KGIIDPNTGRPVGEDDPFFLEINNELADKGFLVTSTEALITWARSGSLMFMTFGLACCAV 82

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EM+  SMPRYD ERFG APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 83  EMIHTSMPRYDSERFGVAPRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 142

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP+AEAL+YGILLLQKKIRR G ++
Sbjct: 143 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGILLLQKKIRRTGTIE 199


>gi|260462231|ref|ZP_05810475.1| NADH-quinone oxidoreductase, B subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259032091|gb|EEW33358.1| NADH-quinone oxidoreductase, B subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 193

 Score =  289 bits (739), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 134/177 (75%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   + + D  F  I++E+  KGFLVTS + L+TWAR+GSLM+MTFGLACCAV
Sbjct: 16  KGIIDPNTGKPVGQDDPFFLEINNELADKGFLVTSTEALITWARSGSLMFMTFGLACCAV 75

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EM+  SMPRYD ERFG APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 76  EMIHTSMPRYDSERFGVAPRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 135

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPP+AEAL+YGILLLQKKIRR G ++
Sbjct: 136 SCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPSAEALLYGILLLQKKIRRTGTIE 192


>gi|319782982|ref|YP_004142458.1| NADH-quinone oxidoreductase, subunit beta [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|218528069|sp|Q98KQ6|NUOB_RHILO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|317168870|gb|ADV12408.1| NADH-quinone oxidoreductase, B subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 193

 Score =  289 bits (739), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 153/177 (86%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           + II   +   + + D  F  I++E+  KGFLVTS + L+TWAR+GSLM+MTFGLACCAV
Sbjct: 16  KGIIDPNTGRPVGEDDPFFLEINNELADKGFLVTSTEALITWARSGSLMFMTFGLACCAV 75

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EM+  SMPRYD ERFG APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMG
Sbjct: 76  EMIHTSMPRYDSERFGVAPRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRYVISMG 135

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP+AEAL+YGILLLQKKIRR G ++
Sbjct: 136 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPSAEALLYGILLLQKKIRRTGTIE 192


>gi|330813983|ref|YP_004358222.1| NADH-ubiquinone oxidoreductase chain B [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487078|gb|AEA81483.1| NADH-ubiquinone oxidoreductase chain B [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 175

 Score =  288 bits (738), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 147/167 (88%)

Query: 18  SLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
            L+ +  +F  ++ E T KGF+    D+L+ WARTGSL WMTFGLACCAVEMMQ SMPRY
Sbjct: 8   KLKDIPKEFREVAEEFTEKGFVTIGSDRLINWARTGSLHWMTFGLACCAVEMMQTSMPRY 67

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           DLERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYH
Sbjct: 68  DLERFGAAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYH 127

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSYSVVRGCD+IVPVDIYVPGCPP+AEAL+YGIL LQKKIRR G+++
Sbjct: 128 YSYSVVRGCDKIVPVDIYVPGCPPSAEALLYGILQLQKKIRREGSLQ 174


>gi|222148275|ref|YP_002549232.1| NADH dehydrogenase subunit B [Agrobacterium vitis S4]
 gi|238065049|sp|B9JVE6|NUOB_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|221735263|gb|ACM36226.1| NADH ubiqionone oxidoreductase chain B [Agrobacterium vitis S4]
          Length = 195

 Score =  288 bits (737), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 134/160 (83%), Positives = 145/160 (90%), Gaps = 1/160 (0%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVE-MMQASMPRYDLERFGF 84
           F  I+ E+  KGFLVTS   L+TWARTGSLMWM FGLACCAVE +MQAS PRYD+ERFG 
Sbjct: 35  FGEINDELADKGFLVTSTQALITWARTGSLMWMQFGLACCAVEGLMQASGPRYDMERFGV 94

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
           APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVR
Sbjct: 95  APRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 154

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCDR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 155 GCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 194


>gi|302383046|ref|YP_003818869.1| NADH-quinone oxidoreductase subunit beta [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193674|gb|ADL01246.1| NADH-quinone oxidoreductase, B subunit [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 193

 Score =  288 bits (737), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +++EI  +GFL  S+D ++ WARTGSLMWMTFGLACCAVEM+QASMPRYDLERF
Sbjct: 31  DKFFEAVNTEIAEQGFLTASLDDVINWARTGSLMWMTFGLACCAVEMIQASMPRYDLERF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+PRYV+SMGSCANGGGYYHYSYSV
Sbjct: 91  GMAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPDPRYVLSMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD YVPGCPPTAEALIYG+L LQKKIRR G +
Sbjct: 151 VRGCDRIVPVDAYVPGCPPTAEALIYGLLQLQKKIRRTGTI 191


>gi|260428201|ref|ZP_05782180.1| NADH-quinone oxidoreductase subunit b [Citreicella sp. SE45]
 gi|260422693|gb|EEX15944.1| NADH-quinone oxidoreductase subunit b [Citreicella sp. SE45]
          Length = 175

 Score =  286 bits (732), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 130/155 (83%), Positives = 143/155 (92%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TSVD ++ WARTGSL WMTFGLACCA+EMMQ SMPRYDLERFG APRA
Sbjct: 19  LNRELQDKGFLLTSVDDVINWARTGSLHWMTFGLACCAIEMMQTSMPRYDLERFGTAPRA 78

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 79  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 138

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YGI+ LQKKIRR G +
Sbjct: 139 IVPVDVYVPGCPPTAEALLYGIMALQKKIRRTGTI 173


>gi|312116344|ref|YP_004013940.1| NADH-quinone oxidoreductase subunit beta [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221473|gb|ADP72841.1| NADH-quinone oxidoreductase, B subunit [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 184

 Score =  286 bits (731), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (91%)

Query: 25  DFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           DF  +++++  KGFLVTS + ++ WARTGSLMWMTFGLACCAVEM+Q SMPRYDLERFG 
Sbjct: 24  DFDGLNAQLADKGFLVTSTEDVINWARTGSLMWMTFGLACCAVEMIQVSMPRYDLERFGT 83

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
           APRASPRQSD+MIVAGTL NKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVR
Sbjct: 84  APRASPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 143

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCDR+VPVD+Y+PGCPP+AEAL+YGI+LLQKKIRR G ++
Sbjct: 144 GCDRVVPVDVYIPGCPPSAEALLYGIMLLQKKIRRTGTIE 183


>gi|126461943|ref|YP_001043057.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides ATCC 17029]
 gi|218528014|sp|A3PIW9|NUOB1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|126103607|gb|ABN76285.1| NADH-quinone oxidoreductase, B subunit [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 176

 Score =  286 bits (731), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D D   ++ E+  KGFL+T+ + L+ WARTGSL WMTFGLACCAVEMM  SMPRYD+ERF
Sbjct: 14  DYDTQSLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERF 73

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 74  GVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 133

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 134 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTI 174


>gi|149202673|ref|ZP_01879645.1| NADH dehydrogenase subunit B [Roseovarius sp. TM1035]
 gi|149143955|gb|EDM31989.1| NADH dehydrogenase subunit B [Roseovarius sp. TM1035]
          Length = 177

 Score =  286 bits (731), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  +MPRYD+ERFGFAPRA
Sbjct: 21  LNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTAMPRYDVERFGFAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 141 IVPVDIYVPGCPPTAEALVYGILQLQRKIRRTGTI 175


>gi|77463071|ref|YP_352575.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides 2.4.1]
 gi|221638927|ref|YP_002525189.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides KD131]
 gi|332557944|ref|ZP_08412266.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides WS8N]
 gi|123592237|sp|Q3J3G0|NUOB1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|238065016|sp|B9KQW1|NUOB1_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|77387489|gb|ABA78674.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain B [Rhodobacter
           sphaeroides 2.4.1]
 gi|221159708|gb|ACM00688.1| NADH dehydrogenase I, B subunit [Rhodobacter sphaeroides KD131]
 gi|332275656|gb|EGJ20971.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides WS8N]
          Length = 174

 Score =  285 bits (730), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D D   ++ E+  KGFL+T+ + L+ WARTGSL WMTFGLACCAVEMM  SMPRYD+ERF
Sbjct: 12  DYDTQSLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERF 71

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 72  GVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 131

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 132 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTI 172


>gi|304322207|ref|YP_003855850.1| NADH dehydrogenase subunit beta [Parvularcula bermudensis HTCC2503]
 gi|303301109|gb|ADM10708.1| NADH dehydrogenase beta subunit [Parvularcula bermudensis HTCC2503]
          Length = 226

 Score =  285 bits (729), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 144/162 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F+ ++ E+  +GF+    D ++ WARTGSLMWMTFGLACCAVEMMQASMPRYD+ERF
Sbjct: 64  DPFFTSLNRELADQGFITAPADAVINWARTGSLMWMTFGLACCAVEMMQASMPRYDMERF 123

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMP PRYV+SMGSCANGGGYYHYSYSV
Sbjct: 124 GMAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPAPRYVVSMGSCANGGGYYHYSYSV 183

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIYVPGCPPTAEALIYG+L LQKK+RR G ++
Sbjct: 184 VRGCDRIVPVDIYVPGCPPTAEALIYGLLQLQKKMRREGTIR 225


>gi|56697623|ref|YP_167992.1| NADH dehydrogenase subunit B [Ruegeria pomeroyi DSS-3]
 gi|56679360|gb|AAV96026.1| NADH dehydrogenase I, B subunit [Ruegeria pomeroyi DSS-3]
          Length = 184

 Score =  285 bits (729), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 130/174 (74%), Positives = 151/174 (86%), Gaps = 1/174 (0%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEM
Sbjct: 10  VMTGANTAGVDK-EVATQALNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEM 68

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 69  MHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 128

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+KIRR G +
Sbjct: 129 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQRKIRRTGTI 182


>gi|197105267|ref|YP_002130644.1| NADH dehydrogenase I, B subunit [Phenylobacterium zucineum HLK1]
 gi|238065189|sp|B4RCM8|NUOB_PHEZH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|196478687|gb|ACG78215.1| NADH dehydrogenase I, B subunit [Phenylobacterium zucineum HLK1]
          Length = 193

 Score =  285 bits (728), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S  +  KGF+  + D L+TWARTGSLMWMTFGLACCAVEMMQASMPRYDLER+
Sbjct: 31  DPYFDGVSQRLADKGFVTAAADDLITWARTGSLMWMTFGLACCAVEMMQASMPRYDLERY 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTL NKMA ALR+VYDQMPEPRYVISMGSCANGGGYY++SYS 
Sbjct: 91  GFAPRASPRQSDVMIVAGTLVNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYYFSYST 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDR+VPVD+YVPGCPPTAEAL+YG+L LQKKIRR G +
Sbjct: 151 VRGCDRVVPVDVYVPGCPPTAEALVYGVLQLQKKIRRTGTI 191


>gi|218528064|sp|Q5LPR4|NUOB_SILPO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 177

 Score =  285 bits (728), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 130/174 (74%), Positives = 151/174 (86%), Gaps = 1/174 (0%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEM
Sbjct: 3   VMTGANTAGVDK-EVATQALNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEM 61

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 62  MHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 121

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+KIRR G +
Sbjct: 122 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQRKIRRTGTI 175


>gi|149914578|ref|ZP_01903108.1| NADH dehydrogenase subunit B [Roseobacter sp. AzwK-3b]
 gi|149811371|gb|EDM71206.1| NADH dehydrogenase subunit B [Roseobacter sp. AzwK-3b]
          Length = 177

 Score =  285 bits (728), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 130/155 (83%), Positives = 142/155 (91%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFLVTS + ++ WARTGSL WMTFGLACCAVEMM ASMPRYDLERFG APRA
Sbjct: 21  LNRELQDKGFLVTSTEDIINWARTGSLHWMTFGLACCAVEMMHASMPRYDLERFGTAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGI+ LQ+KIRR G +
Sbjct: 141 IVPVDIYVPGCPPTAEALVYGIMQLQRKIRRTGTI 175


>gi|114764719|ref|ZP_01443904.1| NADH dehydrogenase beta subunit [Pelagibaca bermudensis HTCC2601]
 gi|114542919|gb|EAU45940.1| NADH dehydrogenase beta subunit [Roseovarius sp. HTCC2601]
          Length = 206

 Score =  285 bits (728), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 128/155 (82%), Positives = 143/155 (92%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E++ KGFL+TSVD ++ WARTGSL WMTFGLACCA+EMM  SMPRYDLERFG APRA
Sbjct: 50  LNRELSDKGFLLTSVDDVINWARTGSLHWMTFGLACCAIEMMHTSMPRYDLERFGSAPRA 109

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 110 SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 169

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YG++ LQKKIRR G +
Sbjct: 170 IVPVDVYVPGCPPTAEALLYGLMALQKKIRRTGTI 204


>gi|85703212|ref|ZP_01034316.1| NADH dehydrogenase beta subunit [Roseovarius sp. 217]
 gi|85672140|gb|EAQ26997.1| NADH dehydrogenase beta subunit [Roseovarius sp. 217]
          Length = 174

 Score =  285 bits (728), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 128/155 (82%), Positives = 143/155 (92%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KG+L+TS + ++ WARTGSL WMTFGLACCAVEMM  +MPRYD+ERFGFAPRA
Sbjct: 18  LNAELQDKGYLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTAMPRYDVERFGFAPRA 77

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 78  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 137

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 138 IVPVDIYVPGCPPTAEALVYGILQLQRKIRRTGTI 172


>gi|254461551|ref|ZP_05074967.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain b
           [Rhodobacterales bacterium HTCC2083]
 gi|206678140|gb|EDZ42627.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain b
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 181

 Score =  284 bits (727), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D   + +++E+  KGFL+TS D ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERF
Sbjct: 19  DHGTAALNAELADKGFLLTSTDDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERF 78

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 79  GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 138

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGI+ LQ+K+RR G +
Sbjct: 139 VRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQRKMRRTGTI 179


>gi|3025802|gb|AAC12755.1| NADH-ubiqionone oxidoreductase subunit NuoB [Sinorhizobium
           meliloti]
          Length = 165

 Score =  284 bits (727), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 132/158 (83%), Positives = 143/158 (90%), Gaps = 1/158 (0%)

Query: 28  RISSEITHKGFLVTSVDQLVTWARTGSLMWMTFG-LACCAVEMMQASMPRYDLERFGFAP 86
            I++E+  KGFLVTS D+L+ WARTGSLMW     LACCAVEMMQ SMPRYD ERFGFAP
Sbjct: 7   EINNELADKGFLVTSTDELINWARTGSLMWNELSVLACCAVEMMQMSMPRYDAERFGFAP 66

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC 146
           RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC
Sbjct: 67  RASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC 126

Query: 147 DRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           DR+VPVDIYVPGCPPTAEAL+YG+LLLQKKIRR G ++
Sbjct: 127 DRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIE 164


>gi|146278043|ref|YP_001168202.1| NADH dehydrogenase subunit B [Rhodobacter sphaeroides ATCC 17025]
 gi|218528015|sp|A4WU33|NUOB2_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|145556284|gb|ABP70897.1| NADH-quinone oxidoreductase, B subunit [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 174

 Score =  284 bits (727), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 130/161 (80%), Positives = 144/161 (89%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D D + ++ E+  KGFL+T+ + L+ WARTGSL WMTFGLACCAVEMM  SMPRYD+ERF
Sbjct: 12  DYDTAGLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERF 71

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 72  GVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 131

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ++IRR G +
Sbjct: 132 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRRIRRTGTI 172


>gi|163746197|ref|ZP_02153556.1| NADH dehydrogenase subunit B [Oceanibulbus indolifex HEL-45]
 gi|161380942|gb|EDQ05352.1| NADH dehydrogenase subunit B [Oceanibulbus indolifex HEL-45]
          Length = 204

 Score =  284 bits (727), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 144/161 (89%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM +SMPRYDLERF
Sbjct: 42  DVATHSLNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHSSMPRYDLERF 101

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 102 GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 161

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 162 VRGCDRIVPVDVYVPGCPPTAEALLYGILQLQRKIRRTGTI 202


>gi|329889333|ref|ZP_08267676.1| NADH-quinone oxidoreductase subunit B [Brevundimonas diminuta ATCC
           11568]
 gi|328844634|gb|EGF94198.1| NADH-quinone oxidoreductase subunit B [Brevundimonas diminuta ATCC
           11568]
          Length = 192

 Score =  284 bits (726), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 146/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +++E+  +GFL TS+D ++TWARTGSLMWM+FGLACCAVEM+  SMPR+DLERF
Sbjct: 30  DKFFESVNTELGERGFLTTSLDDVITWARTGSLMWMSFGLACCAVEMIHLSMPRFDLERF 89

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APR SPRQSD+MIVAGTLTNKMA ALR+VYDQMP+PRYVISMGSCANGGGYYHYSYSV
Sbjct: 90  GTAPRGSPRQSDLMIVAGTLTNKMAPALRKVYDQMPDPRYVISMGSCANGGGYYHYSYSV 149

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVD+YVPGCPPTAEAL+YGIL LQKKIRR G ++
Sbjct: 150 VRGCDRVVPVDVYVPGCPPTAEALLYGILQLQKKIRRTGTIE 191


>gi|254450431|ref|ZP_05063868.1| NADH dehydrogenase i, b subunit [Octadecabacter antarcticus 238]
 gi|198264837|gb|EDY89107.1| NADH dehydrogenase i, b subunit [Octadecabacter antarcticus 238]
          Length = 184

 Score =  284 bits (726), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 133/171 (77%), Positives = 147/171 (85%), Gaps = 1/171 (0%)

Query: 13  GQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQA 72
           G ++  +++ D     ++ E+T KGFLVTS   L+ WARTGSL WMTFGLACCAVEMM  
Sbjct: 13  GDNTAGVDR-DVATQDLNKELTDKGFLVTSSADLINWARTGSLHWMTFGLACCAVEMMHT 71

Query: 73  SMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANG 132
           SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANG
Sbjct: 72  SMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANG 131

Query: 133 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 132 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKMRRTGTI 182


>gi|89067783|ref|ZP_01155237.1| NADH dehydrogenase beta subunit [Oceanicola granulosus HTCC2516]
 gi|89046753|gb|EAR52808.1| NADH dehydrogenase beta subunit [Oceanicola granulosus HTCC2516]
          Length = 204

 Score =  284 bits (726), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 130/155 (83%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFLVTS   ++ WARTGSL WMTFGLACCAVEMM +SMPRYDLERFG APRA
Sbjct: 48  LNRELQDKGFLVTSTADIINWARTGSLHWMTFGLACCAVEMMHSSMPRYDLERFGTAPRA 107

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 108 SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 167

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 168 IVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTI 202


>gi|84686428|ref|ZP_01014322.1| NADH dehydrogenase beta subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665611|gb|EAQ12087.1| NADH dehydrogenase beta subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 174

 Score =  284 bits (726), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%)

Query: 28  RISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPR 87
           ++S E+  KGFL+T+ D ++ WARTGSL WMTFGLACCAVEMMQ+SMPRYDLER+G APR
Sbjct: 17  QLSDELQDKGFLLTTTDDIINWARTGSLHWMTFGLACCAVEMMQSSMPRYDLERYGTAPR 76

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD
Sbjct: 77  ASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 136

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           R+VPVD+YVPGCPP+AEAL+YGIL LQ+KIRR G +
Sbjct: 137 RVVPVDVYVPGCPPSAEALVYGILQLQRKIRRTGTI 172


>gi|126736072|ref|ZP_01751816.1| NADH dehydrogenase beta subunit [Roseobacter sp. CCS2]
 gi|126714629|gb|EBA11496.1| NADH dehydrogenase beta subunit [Roseobacter sp. CCS2]
          Length = 176

 Score =  284 bits (726), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 131/155 (84%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           I+SE+  KGFLVTS   +V WARTGSL WMTFGLACCAVEMM  SMPRYDLERFG APRA
Sbjct: 20  INSELQDKGFLVTSTADIVNWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERFGTAPRA 79

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 80  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 139

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 140 IVPVDVYVPGCPPTAEALLYGILQLQRKMRRTGTI 174


>gi|254436528|ref|ZP_05050022.1| NADH-quinone oxidoreductase, B subunit subfamily [Octadecabacter
           antarcticus 307]
 gi|198251974|gb|EDY76288.1| NADH-quinone oxidoreductase, B subunit subfamily [Octadecabacter
           antarcticus 307]
          Length = 177

 Score =  284 bits (726), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 133/171 (77%), Positives = 146/171 (85%), Gaps = 1/171 (0%)

Query: 13  GQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQA 72
           G ++   ++ D     ++ E+T KGFLVTS   L+ WARTGSL WMTFGLACCAVEMM  
Sbjct: 6   GDNTAGFDR-DVATQDLNHELTDKGFLVTSSADLINWARTGSLHWMTFGLACCAVEMMHT 64

Query: 73  SMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANG 132
           SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANG
Sbjct: 65  SMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANG 124

Query: 133 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 125 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKMRRTGTI 175


>gi|254486398|ref|ZP_05099603.1| NADH-quinone oxidoreductase chain b [Roseobacter sp. GAI101]
 gi|214043267|gb|EEB83905.1| NADH-quinone oxidoreductase chain b [Roseobacter sp. GAI101]
          Length = 178

 Score =  283 bits (725), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 130/161 (80%), Positives = 142/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERF
Sbjct: 16  DVATQNLNKELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERF 75

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 76  GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 135

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 136 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTI 176


>gi|260434181|ref|ZP_05788152.1| NADH-quinone oxidoreductase, b subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418009|gb|EEX11268.1| NADH-quinone oxidoreductase, b subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 174

 Score =  283 bits (725), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (86%), Gaps = 1/173 (0%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM
Sbjct: 1   MTGANTAGVDK-EVATQALNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMM 59

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 60  HTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 119

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+KIRR G +
Sbjct: 120 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQRKIRRTGTI 172


>gi|89053661|ref|YP_509112.1| NADH dehydrogenase subunit B [Jannaschia sp. CCS1]
 gi|122499244|sp|Q28T75|NUOB_JANSC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|88863210|gb|ABD54087.1| NADH dehydrogenase subunit B [Jannaschia sp. CCS1]
          Length = 177

 Score =  283 bits (724), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 130/155 (83%), Positives = 140/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFLVTS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYD ERFG APRA
Sbjct: 21  LNRELQDKGFLVTSSEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDAERFGIAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGIL LQ+KIRR G +
Sbjct: 141 IVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTI 175


>gi|114771817|ref|ZP_01449210.1| NADH dehydrogenase subunit B [alpha proteobacterium HTCC2255]
 gi|114547633|gb|EAU50524.1| NADH dehydrogenase subunit B [alpha proteobacterium HTCC2255]
          Length = 177

 Score =  283 bits (723), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 128/157 (81%), Positives = 143/157 (91%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP 86
           S ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM ++MPRYDLERFG AP
Sbjct: 19  SALNRELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMHSAMPRYDLERFGTAP 78

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC 146
           RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC
Sbjct: 79  RASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC 138

Query: 147 DRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DRIVPVDIYVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 139 DRIVPVDIYVPGCPPTAEALLYGILQLQRKMRRTGTI 175


>gi|254511808|ref|ZP_05123875.1| NADH dehydrogenase i, b subunit [Rhodobacteraceae bacterium KLH11]
 gi|221535519|gb|EEE38507.1| NADH dehydrogenase i, b subunit [Rhodobacteraceae bacterium KLH11]
          Length = 174

 Score =  282 bits (722), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 129/173 (74%), Positives = 150/173 (86%), Gaps = 1/173 (0%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM
Sbjct: 1   MTGANTAGVDK-EVATQALNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMM 59

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 60  HTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 119

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 120 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLMQLQRKIRRTGTI 172


>gi|259418740|ref|ZP_05742657.1| NADH-quinone oxidoreductase subunit b [Silicibacter sp. TrichCH4B]
 gi|259344962|gb|EEW56816.1| NADH-quinone oxidoreductase subunit b [Silicibacter sp. TrichCH4B]
          Length = 177

 Score =  282 bits (721), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (86%), Gaps = 1/174 (0%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEM
Sbjct: 3   VMAGANTAGVDK-EVVTQALNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEM 61

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 62  MHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 121

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 122 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLMQLQRKIRRTGTL 175


>gi|84516742|ref|ZP_01004100.1| NADH dehydrogenase beta subunit [Loktanella vestfoldensis SKA53]
 gi|84509210|gb|EAQ05669.1| NADH dehydrogenase beta subunit [Loktanella vestfoldensis SKA53]
          Length = 173

 Score =  282 bits (721), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KGFLVTS   ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERFG APRA
Sbjct: 17  LNAELQDKGFLVTSTADVINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERFGTAPRA 76

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 77  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 136

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 137 IVPVDIYVPGCPPTAEALLYGILQLQRKMRRTGTI 171


>gi|254456317|ref|ZP_05069746.1| NADH dehydrogenase i chain b [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083319|gb|EDZ60745.1| NADH dehydrogenase i chain b [Candidatus Pelagibacter sp. HTCC7211]
          Length = 171

 Score =  282 bits (721), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 126/164 (76%), Positives = 146/164 (89%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           +++V  +F +++ + +  GF+ TS+D L+ W+R+GSL WMTFGLACCAVEMMQ +MPRYD
Sbjct: 5   IDQVPEEFKQLAEDFSKNGFITTSLDNLINWSRSGSLHWMTFGLACCAVEMMQTAMPRYD 64

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           LERFG APR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHY
Sbjct: 65  LERFGAAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHY 124

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           SYSVVRGCDRIVPVD+YVPGCPP+AEAL+YGIL LQKKIR  G+
Sbjct: 125 SYSVVRGCDRIVPVDVYVPGCPPSAEALLYGILQLQKKIRNKGS 168


>gi|83942674|ref|ZP_00955135.1| NADH dehydrogenase beta subunit [Sulfitobacter sp. EE-36]
 gi|83953913|ref|ZP_00962634.1| NADH dehydrogenase beta subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841858|gb|EAP81027.1| NADH dehydrogenase beta subunit [Sulfitobacter sp. NAS-14.1]
 gi|83846767|gb|EAP84643.1| NADH dehydrogenase beta subunit [Sulfitobacter sp. EE-36]
          Length = 178

 Score =  281 bits (720), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/161 (78%), Positives = 142/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D     ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERF
Sbjct: 16  DVATQNLNKELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERF 75

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 76  GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 135

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDR+VPVD+YVPGCPPTAEAL+YGI+ LQ+KIRR G +
Sbjct: 136 VRGCDRVVPVDVYVPGCPPTAEALLYGIMQLQRKIRRTGTI 176


>gi|159043857|ref|YP_001532651.1| NADH dehydrogenase subunit B [Dinoroseobacter shibae DFL 12]
 gi|218527990|sp|A8LIT6|NUOB_DINSH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|157911617|gb|ABV93050.1| NADH-quinone oxidoreductase [Dinoroseobacter shibae DFL 12]
          Length = 177

 Score =  281 bits (720), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYD ERFG APRA
Sbjct: 21  LNNELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDAERFGIAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           +VPVDIYVPGCPPTAEAL+YG+L LQ+KIRR G +
Sbjct: 141 VVPVDIYVPGCPPTAEALLYGLLQLQRKIRRTGTI 175


>gi|114799608|ref|YP_760447.1| NADH dehydrogenase subunit B [Hyphomonas neptunium ATCC 15444]
 gi|122942427|sp|Q0C1E6|NUOB_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|114739782|gb|ABI77907.1| NADH-quinone oxidoreductase, B subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 190

 Score =  281 bits (720), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 142/162 (87%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  +S +S ++  KG+   + D L++WARTGSLMWMTFGLACCAVEMM A  PRYDLERF
Sbjct: 28  DPFYSGLSDQLADKGYFTAAADDLISWARTGSLMWMTFGLACCAVEMMHAGNPRYDLERF 87

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 88  GMAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 147

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVDIY+PGCPPTAEAL+YG L LQKKIRR G+++
Sbjct: 148 VRGCDRIVPVDIYIPGCPPTAEALVYGFLQLQKKIRREGSIE 189


>gi|119384981|ref|YP_916037.1| NADH dehydrogenase subunit B [Paracoccus denitrificans PD1222]
 gi|218527939|sp|A1B497|NUOB_PARDP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NADH
           dehydrogenase I, subunit 6; AltName: Full=NADH-quinone
           oxidoreductase subunit 6; Short=NQO6; AltName:
           Full=NDH-1 subunit B; AltName: Full=NDH-1, subunit 6
 gi|119374748|gb|ABL70341.1| NADH dehydrogenase subunit B [Paracoccus denitrificans PD1222]
          Length = 175

 Score =  281 bits (720), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (86%), Gaps = 1/174 (0%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +++G ++   ++ D   + ++ E+  KGFL+T+ + ++ WAR GSL WMTFGLACCAVEM
Sbjct: 1   MMTGLNTAGADR-DLATAELNRELQDKGFLLTTTEDIINWARNGSLHWMTFGLACCAVEM 59

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           MQ SMPRYDLERFG APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 60  MQTSMPRYDLERFGTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 119

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ++IRR G +
Sbjct: 120 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRRIRRTGTL 173


>gi|126729549|ref|ZP_01745362.1| NADH dehydrogenase subunit B [Sagittula stellata E-37]
 gi|126709668|gb|EBA08721.1| NADH dehydrogenase subunit B [Sagittula stellata E-37]
          Length = 174

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERFG APRA
Sbjct: 18  LNRELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERFGTAPRA 77

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 78  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 137

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           +VPVD+YVPGCPPTAEAL+YGI+ LQKKIRR G +
Sbjct: 138 VVPVDVYVPGCPPTAEALLYGIMALQKKIRRTGTL 172


>gi|260574759|ref|ZP_05842762.1| NADH-quinone oxidoreductase, B subunit [Rhodobacter sp. SW2]
 gi|259023176|gb|EEW26469.1| NADH-quinone oxidoreductase, B subunit [Rhodobacter sp. SW2]
          Length = 177

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 143/155 (92%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E++ KGFL+TS + ++ WARTGSL WMTFGLACCAVEM+Q SMPRYDLERFG APRA
Sbjct: 21  LNRELSDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMIQLSMPRYDLERFGTAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 141 IVPVDVYVPGCPPTAEALLYGILQLQRKMRRTGTI 175


>gi|409251|gb|AAA03036.1| NADH dehydrogenase [Paracoccus denitrificans]
          Length = 174

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 143/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D   + ++ E+  KGFL+T+ + ++ WAR GSL WMTFGLACCAVEMMQ SMPRYDLERF
Sbjct: 12  DLATAELNRELQDKGFLLTTTEDIINWARNGSLHWMTFGLACCAVEMMQTSMPRYDLERF 71

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 72  GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 131

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ++IRR G +
Sbjct: 132 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRRIRRTGTL 172


>gi|99080583|ref|YP_612737.1| NADH dehydrogenase subunit B [Ruegeria sp. TM1040]
 gi|123077741|sp|Q1GIP1|NUOB_SILST RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|99036863|gb|ABF63475.1| NADH-quinone oxidoreductase B subunit [Ruegeria sp. TM1040]
          Length = 174

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYD ERFG APRA
Sbjct: 18  LNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDAERFGIAPRA 77

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 78  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 137

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 138 IVPVDIYVPGCPPTAEALLYGLMQLQRKIRRTGTL 172


>gi|86137600|ref|ZP_01056177.1| NADH dehydrogenase beta subunit [Roseobacter sp. MED193]
 gi|85825935|gb|EAQ46133.1| NADH dehydrogenase beta subunit [Roseobacter sp. MED193]
          Length = 174

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 129/173 (74%), Positives = 150/173 (86%), Gaps = 1/173 (0%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM
Sbjct: 1   MTGANTAGVDK-EVVTQALNAELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMM 59

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 60  HTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 119

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 120 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLMQLQRKIRRTGTL 172


>gi|71083583|ref|YP_266302.1| NADH dehydrogenase subunit B [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91761996|ref|ZP_01263961.1| NADH dehydrogenase beta subunit [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|123646646|sp|Q4FM90|NUOB_PELUB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|71062696|gb|AAZ21699.1| NADH Dehydrogenase I Chain B [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717798|gb|EAS84448.1| NADH dehydrogenase beta subunit [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 173

 Score =  281 bits (719), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/165 (75%), Positives = 145/165 (87%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           +++  +F +++ + +  GF+ TS+D L+ W+R GSL WMTFGLACCAVEMMQ +MPRYDL
Sbjct: 8   KEIPEEFKKLAEDFSKNGFITTSLDNLINWSRAGSLHWMTFGLACCAVEMMQTAMPRYDL 67

Query: 80  ERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           ERFG APR SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYS
Sbjct: 68  ERFGAAPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYS 127

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSVVRGCD+IVPVDIYVPGCPP+AEAL+YGIL LQKKIR  G+ +
Sbjct: 128 YSVVRGCDKIVPVDIYVPGCPPSAEALLYGILQLQKKIRNKGSFE 172


>gi|126740377|ref|ZP_01756065.1| NADH dehydrogenase subunit B [Roseobacter sp. SK209-2-6]
 gi|126718513|gb|EBA15227.1| NADH dehydrogenase subunit B [Roseobacter sp. SK209-2-6]
          Length = 174

 Score =  281 bits (718), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/173 (73%), Positives = 150/173 (86%), Gaps = 1/173 (0%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++G ++  ++K +     I++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM
Sbjct: 1   MTGANTAGVDK-EVVTQAINAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMM 59

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 60  HTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 119

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           NGGGYYHYSYSVVRGCDR+VPVD+YVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 120 NGGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTL 172


>gi|310816715|ref|YP_003964679.1| NADH-quinone oxidoreductase, B subunit [Ketogulonicigenium vulgare
           Y25]
 gi|308755450|gb|ADO43379.1| NADH-quinone oxidoreductase, B subunit [Ketogulonicigenium vulgare
           Y25]
          Length = 188

 Score =  281 bits (718), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 149/184 (80%), Gaps = 6/184 (3%)

Query: 6   VNQKIISGQSSCSLEK----VDADFSRI--SSEITHKGFLVTSVDQLVTWARTGSLMWMT 59
           +NQ     Q S    +     DAD + +     +  KGFLVTS   ++ WARTGSL WMT
Sbjct: 3   LNQLSTGAQGSVQTGRNSAGADADHAALVLGRAVQDKGFLVTSTADIINWARTGSLHWMT 62

Query: 60  FGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPE 119
           FGLACCAVEMMQ SMPRYDLERFG APRASPRQ+D+MIVAGTLTNKMA ALR+VYDQMPE
Sbjct: 63  FGLACCAVEMMQLSMPRYDLERFGTAPRASPRQADLMIVAGTLTNKMAPALRKVYDQMPE 122

Query: 120 PRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           PRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPTAEAL+YGI+ LQ+KIRR
Sbjct: 123 PRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIMQLQRKIRR 182

Query: 180 VGNV 183
            G +
Sbjct: 183 TGTI 186


>gi|254476799|ref|ZP_05090185.1| NADH-quinone oxidoreductase chain b [Ruegeria sp. R11]
 gi|214031042|gb|EEB71877.1| NADH-quinone oxidoreductase chain b [Ruegeria sp. R11]
          Length = 177

 Score =  281 bits (718), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/174 (72%), Positives = 151/174 (86%), Gaps = 1/174 (0%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEM
Sbjct: 3   VMTGANTAGVDK-EMVTQALNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEM 61

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 62  MHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 121

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           ANGGGYYHYSYSVVRGCDR+VPVD+YVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 122 ANGGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTL 175


>gi|84502605|ref|ZP_01000724.1| NADH dehydrogenase beta subunit [Oceanicola batsensis HTCC2597]
 gi|84389000|gb|EAQ01798.1| NADH dehydrogenase beta subunit [Oceanicola batsensis HTCC2597]
          Length = 207

 Score =  281 bits (718), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 139/155 (89%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + L+ WARTGSL WMTFGLACCAVEMM  SMPRYD ERFG APRA
Sbjct: 51  LNKELQDKGFLLTSTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDAERFGIAPRA 110

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 111 SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDR 170

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGI+ L +KIRR G +
Sbjct: 171 IVPVDIYVPGCPPTAEALLYGIMQLARKIRRTGTI 205


>gi|163732066|ref|ZP_02139512.1| NADH dehydrogenase subunit B [Roseobacter litoralis Och 149]
 gi|161394364|gb|EDQ18687.1| NADH dehydrogenase subunit B [Roseobacter litoralis Och 149]
          Length = 177

 Score =  280 bits (717), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  +MPRYD+ERFG APRA
Sbjct: 21  LNRELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTAMPRYDMERFGTAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGI+ LQ+KIRR G +
Sbjct: 141 IVPVDIYVPGCPPTAEALLYGIMQLQRKIRRTGTI 175


>gi|149184638|ref|ZP_01862956.1| NADH dehydrogenase subunit B [Erythrobacter sp. SD-21]
 gi|148831958|gb|EDL50391.1| NADH dehydrogenase subunit B [Erythrobacter sp. SD-21]
          Length = 168

 Score =  280 bits (717), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 130/167 (77%), Positives = 147/167 (88%), Gaps = 1/167 (0%)

Query: 19  LEKVDAD-FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           + K DAD F+ + +E+  KGFLVTS + L  WARTGSL WMTFGLACCAVEM+  +MPRY
Sbjct: 1   MRKPDADYFNALQTEVNDKGFLVTSTEDLFQWARTGSLWWMTFGLACCAVEMIHVNMPRY 60

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D+ERFG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM EP+YVISMGSCANGGGYYH
Sbjct: 61  DMERFGVAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSEPKYVISMGSCANGGGYYH 120

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRRVG ++
Sbjct: 121 YSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRVGTIE 167


>gi|255262340|ref|ZP_05341682.1| NADH-quinone oxidoreductase subunit b [Thalassiobium sp. R2A62]
 gi|255104675|gb|EET47349.1| NADH-quinone oxidoreductase subunit b [Thalassiobium sp. R2A62]
          Length = 177

 Score =  280 bits (716), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/155 (81%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYDLERFG APRA
Sbjct: 21  LNRELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDLERFGTAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YGIL LQ+K+RR G +
Sbjct: 141 IVPVDVYVPGCPPTAEALLYGILQLQRKMRRTGTL 175


>gi|163738798|ref|ZP_02146212.1| NADH dehydrogenase subunit B [Phaeobacter gallaeciensis BS107]
 gi|163741491|ref|ZP_02148882.1| NADH dehydrogenase subunit B [Phaeobacter gallaeciensis 2.10]
 gi|161385225|gb|EDQ09603.1| NADH dehydrogenase subunit B [Phaeobacter gallaeciensis 2.10]
 gi|161388126|gb|EDQ12481.1| NADH dehydrogenase subunit B [Phaeobacter gallaeciensis BS107]
          Length = 174

 Score =  280 bits (716), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 150/173 (86%), Gaps = 1/173 (0%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++G ++  ++K +     +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM
Sbjct: 1   MTGANTAGVDK-EVVTQALNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMM 59

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             SMPRYD ERFG APRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCA
Sbjct: 60  HTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCA 119

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           NGGGYYHYSYSVVRGCDR+VPVD+YVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 120 NGGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTL 172


>gi|110680471|ref|YP_683478.1| NADH dehydrogenase subunit B [Roseobacter denitrificans OCh 114]
 gi|123172224|sp|Q163Q1|NUOB_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|109456587|gb|ABG32792.1| NADH-quinone oxidoreductase chain B [Roseobacter denitrificans OCh
           114]
          Length = 177

 Score =  280 bits (716), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 125/155 (80%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  +MPRYD+ERFG APRA
Sbjct: 21  LNRELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTAMPRYDMERFGTAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVD+YVPGCPPTAEAL+YGI+ LQ+KIRR G +
Sbjct: 141 IVPVDVYVPGCPPTAEALLYGIMQLQRKIRRTGTI 175


>gi|254465701|ref|ZP_05079112.1| NADH-quinone oxidoreductase chain b [Rhodobacterales bacterium Y4I]
 gi|206686609|gb|EDZ47091.1| NADH-quinone oxidoreductase chain b [Rhodobacterales bacterium Y4I]
          Length = 174

 Score =  280 bits (715), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 125/155 (80%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  SMPRYD ERFG APRA
Sbjct: 18  LNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMHTSMPRYDAERFGIAPRA 77

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 78  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 137

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           +VPVD+YVPGCPPTAEAL+YG++ LQ+KIRR G +
Sbjct: 138 VVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTL 172


>gi|148555890|ref|YP_001263472.1| NADH dehydrogenase subunit B [Sphingomonas wittichii RW1]
 gi|218528008|sp|A5VAL8|NUOB_SPHWW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|148501080|gb|ABQ69334.1| NADH-quinone oxidoreductase, B subunit [Sphingomonas wittichii RW1]
          Length = 187

 Score =  278 bits (711), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/163 (79%), Positives = 144/163 (88%), Gaps = 1/163 (0%)

Query: 23  DAD-FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLER 81
           D D F  + +E+  KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYDLER
Sbjct: 24  DPDYFKALQAEVNDKGFLVTSAEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDLER 83

Query: 82  FGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYS 141
           FG APRASPRQSDVMIVAGTL NKMA ALRRVYDQM EP+YVISMGSCANGGGYYHYSYS
Sbjct: 84  FGAAPRASPRQSDVMIVAGTLCNKMAPALRRVYDQMSEPKYVISMGSCANGGGYYHYSYS 143

Query: 142 VVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VVRGCDRIVPVDIYVPGCPPTAEAL+YGI+ LQ+KIRR+G ++
Sbjct: 144 VVRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQRKIRRIGTLE 186


>gi|254420093|ref|ZP_05033817.1| NADH-quinone oxidoreductase, B subunit subfamily [Brevundimonas sp.
           BAL3]
 gi|196186270|gb|EDX81246.1| NADH-quinone oxidoreductase, B subunit subfamily [Brevundimonas sp.
           BAL3]
          Length = 173

 Score =  277 bits (709), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  ++ E+  +GFL  S+D ++TWARTGSLMWMTFGLACCAVEM+Q SMPR+D+ERF
Sbjct: 11  DKFFESVNMELGERGFLTASLDDVITWARTGSLMWMTFGLACCAVEMIQMSMPRFDVERF 70

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APR SPR SD+MIVAGTLTNKMA A+R+VYDQMP+PRYV+SMGSCANGGGYYHYSYSV
Sbjct: 71  GMAPRGSPRHSDLMIVAGTLTNKMAPAIRKVYDQMPDPRYVVSMGSCANGGGYYHYSYSV 130

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDR+VPVD+YVPGCPPTAEAL+YG+L LQKKIRR G +
Sbjct: 131 VRGCDRVVPVDVYVPGCPPTAEALLYGLLQLQKKIRRTGTI 171


>gi|307293269|ref|ZP_07573115.1| NADH-quinone oxidoreductase, B subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306881335|gb|EFN12551.1| NADH-quinone oxidoreductase, B subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 184

 Score =  277 bits (708), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/163 (78%), Positives = 146/163 (89%), Gaps = 1/163 (0%)

Query: 23  DADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLER 81
           D DF + ++SE++ KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ER
Sbjct: 21  DQDFFNALNSEVSDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMER 80

Query: 82  FGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYS 141
           FG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM  P+YVISMGSCANGGGYYHYSYS
Sbjct: 81  FGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPKYVISMGSCANGGGYYHYSYS 140

Query: 142 VVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR+G V+
Sbjct: 141 VVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRIGTVE 183


>gi|126727142|ref|ZP_01742979.1| NADH dehydrogenase subunit B [Rhodobacterales bacterium HTCC2150]
 gi|126703570|gb|EBA02666.1| NADH dehydrogenase subunit B [Rhodobacterales bacterium HTCC2150]
          Length = 176

 Score =  277 bits (708), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E+  KGFL+TS + ++ WARTGSL WMTFGLACCAVEMM  +MPRYD+ERFG APRA
Sbjct: 20  LNRELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMHTAMPRYDMERFGTAPRA 79

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 80  SPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVLSMGSCANGGGYYHYSYSVVRGCDR 139

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           +VPVD+YVPGCPPTAEAL+YG+L LQ+KIRR G +
Sbjct: 140 VVPVDMYVPGCPPTAEALLYGLLQLQRKIRRTGTI 174


>gi|294011308|ref|YP_003544768.1| NADH dehydrogenase I chain B [Sphingobium japonicum UT26S]
 gi|292674638|dbj|BAI96156.1| NADH dehydrogenase I chain B [Sphingobium japonicum UT26S]
          Length = 184

 Score =  276 bits (707), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 143/159 (89%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F  ++SE++ KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ERFG A
Sbjct: 25  FDALNSEVSDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMERFGAA 84

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQSDVMIVAGTL NKMA ALR+VYDQM  P+YVISMGSCANGGGYYHYSYSVVRG
Sbjct: 85  PRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPKYVISMGSCANGGGYYHYSYSVVRG 144

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           CDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR+G V+
Sbjct: 145 CDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRIGTVE 183


>gi|296283830|ref|ZP_06861828.1| NADH dehydrogenase subunit B [Citromicrobium bathyomarinum JL354]
          Length = 192

 Score =  276 bits (706), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 128/179 (71%), Positives = 149/179 (83%), Gaps = 1/179 (0%)

Query: 7   NQKIISGQSSCSLEKVDAD-FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACC 65
           N ++        + + D+D F+ + +E+  KGFLVTS ++L  WARTGSL WMTFGLACC
Sbjct: 13  NPQMQPAAQPGEVRQPDSDYFNALQTEVNDKGFLVTSTEELFQWARTGSLWWMTFGLACC 72

Query: 66  AVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVIS 125
           AVEM+  +MPRYD+ERFG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM  P+YVIS
Sbjct: 73  AVEMIHVNMPRYDMERFGVAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPKYVIS 132

Query: 126 MGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           MGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G V+
Sbjct: 133 MGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRSGTVE 191


>gi|294677055|ref|YP_003577670.1| NADH-quinone oxidoreductase subunit B [Rhodobacter capsulatus SB
           1003]
 gi|6647658|sp|O84970|NUOB_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|3282560|gb|AAC24986.1| NUOB [Rhodobacter capsulatus]
 gi|294475875|gb|ADE85263.1| NADH-quinone oxidoreductase, B subunit [Rhodobacter capsulatus SB
           1003]
          Length = 177

 Score =  276 bits (705), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (90%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ ++  KGFL+T+ + ++ WAR GSL WMTFGLACCAVEMM  +MPRYD+ER+GFAPRA
Sbjct: 21  LNRDLQDKGFLLTTAEDIINWARNGSLHWMTFGLACCAVEMMHTAMPRYDVERYGFAPRA 80

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 81  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 140

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPP+AEAL+YGIL LQ+KIRR G +
Sbjct: 141 IVPVDIYVPGCPPSAEALMYGILQLQRKIRRTGTL 175


>gi|87200316|ref|YP_497573.1| NADH dehydrogenase subunit B [Novosphingobium aromaticivorans DSM
           12444]
 gi|123488910|sp|Q2G5Y4|NUOB_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|87135997|gb|ABD26739.1| NADH dehydrogenase subunit B [Novosphingobium aromaticivorans DSM
           12444]
          Length = 181

 Score =  276 bits (705), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/161 (77%), Positives = 143/161 (88%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           A F  +++E+  KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ERFG
Sbjct: 20  AFFDSLNAEVNDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMERFG 79

Query: 84  FAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
            APRASPRQSDVMIVAGTL NKMA ALR+VYDQM +P+YVISMGSCANGGGYYHYSYSVV
Sbjct: 80  VAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSDPKYVISMGSCANGGGYYHYSYSVV 139

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           RGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 140 RGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRAGTLE 180


>gi|326387461|ref|ZP_08209070.1| NADH dehydrogenase subunit B [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208117|gb|EGD58925.1| NADH dehydrogenase subunit B [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 183

 Score =  276 bits (705), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/161 (77%), Positives = 144/161 (89%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           A F  +++E++ KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ERFG
Sbjct: 22  AFFDSLNAEVSDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMERFG 81

Query: 84  FAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
            APRASPRQSDVMIVAGTL NKMA ALR+VYDQM +P+YVISMGSCANGGGYYHYSYSVV
Sbjct: 82  VAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSDPKYVISMGSCANGGGYYHYSYSVV 141

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           RGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 142 RGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRAGTLE 182


>gi|332185849|ref|ZP_08387596.1| NADH-quinone oxidoreductase, B subunit [Sphingomonas sp. S17]
 gi|332014207|gb|EGI56265.1| NADH-quinone oxidoreductase, B subunit [Sphingomonas sp. S17]
          Length = 194

 Score =  275 bits (704), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 142/159 (89%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F  ++ E+T KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ERFG A
Sbjct: 35  FDGLNGELTDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMERFGAA 94

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQSDVMIVAGTL NKMA ALRRVYDQM  P+YVISMGSCANGGGYYHYSYSVVRG
Sbjct: 95  PRASPRQSDVMIVAGTLCNKMAPALRRVYDQMSNPKYVISMGSCANGGGYYHYSYSVVRG 154

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           CDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G+++
Sbjct: 155 CDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRAGSIE 193


>gi|254294103|ref|YP_003060126.1| NADH-quinone oxidoreductase subunit beta [Hirschia baltica ATCC
           49814]
 gi|254042634|gb|ACT59429.1| NADH-quinone oxidoreductase, B subunit [Hirschia baltica ATCC
           49814]
          Length = 188

 Score =  275 bits (703), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 150/183 (81%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
           M   TVN    +  +S  +   D  F+ +S E+  KGF+V  +D  ++WARTGSLM+M+F
Sbjct: 4   MSTPTVNSAQSASDASAKIRGDDPFFAGVSDELADKGFVVAKLDDAISWARTGSLMFMSF 63

Query: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           GLACCAVEMM A+ PRYD+ERFG APR +PRQSD+MIVAGTLTNKMA A+R+VYDQM EP
Sbjct: 64  GLACCAVEMMHAANPRYDMERFGMAPRGTPRQSDLMIVAGTLTNKMAPAMRKVYDQMAEP 123

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPTAEAL+YG+L LQKKIRR 
Sbjct: 124 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALMYGLLQLQKKIRRE 183

Query: 181 GNV 183
           G +
Sbjct: 184 GTI 186


>gi|85374165|ref|YP_458227.1| NADH dehydrogenase subunit B [Erythrobacter litoralis HTCC2594]
 gi|84787248|gb|ABC63430.1| NuoB, NADH dehydrogenase I, B subunit [Erythrobacter litoralis
           HTCC2594]
          Length = 217

 Score =  275 bits (702), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (0%)

Query: 18  SLEKVDAD-FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
            + + D D F+ + +E+  KGFLVTS + L  WARTGSL WMTFGLACCAVEM+  +MPR
Sbjct: 49  EVRQPDGDYFNALQTEVNDKGFLVTSTEDLFQWARTGSLWWMTFGLACCAVEMIHVNMPR 108

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD+ERFG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM +P+YVISMGSCANGGGYY
Sbjct: 109 YDMERFGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSDPKYVISMGSCANGGGYY 168

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           HYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 169 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRSGTIE 216


>gi|85708754|ref|ZP_01039820.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain B
           [Erythrobacter sp. NAP1]
 gi|85690288|gb|EAQ30291.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain B
           [Erythrobacter sp. NAP1]
          Length = 197

 Score =  275 bits (702), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (0%)

Query: 18  SLEKVDADFSR-ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
            + + D D+ R + +E+  KGFLVTS + L  WARTGSL WMTFGLACCAVEM+  +MPR
Sbjct: 29  EVRQPDEDYFRSLQTEVNDKGFLVTSTEDLFQWARTGSLWWMTFGLACCAVEMIHVNMPR 88

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD+ERFG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM +P+YVISMGSCANGGGYY
Sbjct: 89  YDMERFGIAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSDPKYVISMGSCANGGGYY 148

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           HYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 149 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRSGTIE 196


>gi|94496481|ref|ZP_01303058.1| NuoB, NADH dehydrogenase I, B subunit [Sphingomonas sp. SKA58]
 gi|94424227|gb|EAT09251.1| NuoB, NADH dehydrogenase I, B subunit [Sphingomonas sp. SKA58]
          Length = 172

 Score =  274 bits (701), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (88%), Gaps = 1/163 (0%)

Query: 23  DADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLER 81
           D DF + ++ E++ KGFLVTS ++L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ER
Sbjct: 9   DQDFFNALNGEVSDKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIHVNMPRYDMER 68

Query: 82  FGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYS 141
           FG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM  P+YVISMGSCANGGGYYHYSYS
Sbjct: 69  FGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPKYVISMGSCANGGGYYHYSYS 128

Query: 142 VVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR+G ++
Sbjct: 129 VVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRIGTIE 171


>gi|103486796|ref|YP_616357.1| NADH dehydrogenase subunit B [Sphingopyxis alaskensis RB2256]
 gi|122985072|sp|Q1GTJ8|NUOB_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|98976873|gb|ABF53024.1| NADH-quinone oxidoreductase, B subunit [Sphingopyxis alaskensis
           RB2256]
          Length = 177

 Score =  274 bits (700), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F  +S E+  KGFLVTS + L  WARTGSL WMTFGLACCAVEM+  +MPRYD+ERFG A
Sbjct: 18  FDDLSGEVGDKGFLVTSTEDLFNWARTGSLWWMTFGLACCAVEMIHVNMPRYDMERFGVA 77

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQSDVMIVAGTL NKMA ALRRVYDQM  P+YVISMGSCANGGGYYHYSYSVVRG
Sbjct: 78  PRASPRQSDVMIVAGTLCNKMAPALRRVYDQMSNPKYVISMGSCANGGGYYHYSYSVVRG 137

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           CDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 138 CDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRTGTIE 176


>gi|218528070|sp|Q2NA61|NUOB_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 187

 Score =  273 bits (699), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (0%)

Query: 18  SLEKVDAD-FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
            + + D D F+ + +E+  KGFLVTS + L  WARTGSL WMTFGLACCAVEM+  +MPR
Sbjct: 19  EVRQPDGDYFNALQTEVNDKGFLVTSTEDLFQWARTGSLWWMTFGLACCAVEMIHVNMPR 78

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD+ERFG APRASPRQSDVMIVAGTL NKMA ALR+VYDQM +P+YVISMGSCANGGGYY
Sbjct: 79  YDMERFGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSDPKYVISMGSCANGGGYY 138

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           HYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG++ LQ+KIRR G ++
Sbjct: 139 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVMQLQRKIRRSGTIE 186


>gi|114327965|ref|YP_745122.1| NADH dehydrogenase subunit B [Granulibacter bethesdensis CGDNIH1]
 gi|122327073|sp|Q0BSK3|NUOB_GRABC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|114316139|gb|ABI62199.1| NADH-quinone oxidoreductase chain B [Granulibacter bethesdensis
           CGDNIH1]
          Length = 194

 Score =  273 bits (699), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 142/161 (88%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           +A    I+ E+  KGF+V ++D+LV WARTGSL  MTFGLACCAVEM+ A MPRYDL+RF
Sbjct: 31  EAVLRGITGEMADKGFVVANLDKLVNWARTGSLWPMTFGLACCAVEMIHAYMPRYDLDRF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PRASPRQSDVMIVAGTLTNKMA ALRRVYDQMPEPR+VISMGSCANGGGYYHYSYSV
Sbjct: 91  GVIPRASPRQSDVMIVAGTLTNKMAPALRRVYDQMPEPRWVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEAL+YGI+ LQKKIRR G +
Sbjct: 151 VRGCDRIVPVDVYVPGCPPTAEALVYGIMQLQKKIRRTGTI 191


>gi|266656|sp|P29918|NQO6_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 6; AltName:
           Full=NADH dehydrogenase I subunit 6; AltName: Full=NDH-1
           subunit 6
          Length = 173

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 138/154 (89%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D   + ++ E+  KGFL+T+ + ++ WAR GSL WMTFGLACCAVEMMQ SMPRYDLERF
Sbjct: 12  DLATAELNRELQDKGFLLTTTEDIINWARNGSLHWMTFGLACCAVEMMQTSMPRYDLERF 71

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G APRASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSV
Sbjct: 72  GTAPRASPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSV 131

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKK 176
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ++
Sbjct: 132 VRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRR 165


>gi|162148810|ref|YP_001603271.1| NADH dehydrogenase subunit B [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545442|ref|YP_002277671.1| NADH dehydrogenase subunit B [Gluconacetobacter diazotrophicus PAl
           5]
 gi|221272394|sp|A9HRU3|NUOB2_GLUDA RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|161787387|emb|CAP56982.1| NADH-quinone oxidoreductase chain B [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533119|gb|ACI53056.1| NADH-quinone oxidoreductase, B subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 191

 Score =  270 bits (690), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 138/161 (85%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    I+ EIT KGF+V S+D+LV W RTGSL  M+FGLACCAVEM+ A MPRYDL+R 
Sbjct: 28  DAVIKGITGEITEKGFVVASLDKLVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRM 87

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 88  GIIPRGSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSV 147

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEALIYGI  LQKKIRR G +
Sbjct: 148 VRGCDRIVPVDVYVPGCPPTAEALIYGIFQLQKKIRRTGTI 188


>gi|330994055|ref|ZP_08317985.1| NADH-quinone oxidoreductase subunit B 2 [Gluconacetobacter sp.
           SXCC-1]
 gi|329759001|gb|EGG75515.1| NADH-quinone oxidoreductase subunit B 2 [Gluconacetobacter sp.
           SXCC-1]
          Length = 192

 Score =  269 bits (688), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    I+ E+T KGF+V ++D+LV W RTGSL  M+FGLACCAVEM+ A MPRYDL+R 
Sbjct: 29  DAVIKGITGEMTEKGFVVANLDRLVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRM 88

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 89  GIIPRGSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSV 148

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVPVD+YVPGCPPTAEALIYGIL LQKKIRR G ++
Sbjct: 149 VRGCDRIVPVDVYVPGCPPTAEALIYGILQLQKKIRRTGTIR 190


>gi|148259933|ref|YP_001234060.1| NADH dehydrogenase subunit B [Acidiphilium cryptum JF-5]
 gi|326403113|ref|YP_004283194.1| NADH-quinone oxidoreductase subunit B [Acidiphilium multivorum
           AIU301]
 gi|218527971|sp|A5FX09|NUOB1_ACICJ RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|146401614|gb|ABQ30141.1| NADH dehydrogenase subunit B [Acidiphilium cryptum JF-5]
 gi|325049974|dbj|BAJ80312.1| NADH-quinone oxidoreductase subunit B [Acidiphilium multivorum
           AIU301]
          Length = 186

 Score =  269 bits (687), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 138/155 (89%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           I+ EI  KGF+V ++D+LV WARTGSL  MTFGLACCAVEM+ A MPR+DL+RFG  PR 
Sbjct: 29  ITGEIAGKGFVVANLDRLVNWARTGSLWPMTFGLACCAVEMIHAYMPRWDLDRFGIIPRN 88

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 89  SPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDR 148

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           IVPVDIYVPGCPPTAEAL+YGI  LQKKIRR G +
Sbjct: 149 IVPVDIYVPGCPPTAEALVYGITQLQKKIRRTGTI 183


>gi|296536155|ref|ZP_06898283.1| NADH dehydrogenase (ubiquinone) subunit B [Roseomonas cervicalis
           ATCC 49957]
 gi|296263526|gb|EFH10023.1| NADH dehydrogenase (ubiquinone) subunit B [Roseomonas cervicalis
           ATCC 49957]
          Length = 184

 Score =  268 bits (685), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/161 (77%), Positives = 140/161 (86%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +S EI  KGF+V ++D++V WARTGSL  MTFGLACCAV M+ A MPRYDL+RF
Sbjct: 21  DAVIKGVSGEIEDKGFIVANLDKVVNWARTGSLWPMTFGLACCAVPMIHAYMPRYDLDRF 80

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 81  GVIPRGSPRQSDVMIVAGTLTNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSV 140

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDR+VPVD+YVPGCPPTAEAL+YGIL LQKKIRR G++
Sbjct: 141 VRGCDRVVPVDVYVPGCPPTAEALVYGILQLQKKIRRTGSI 181


>gi|296116534|ref|ZP_06835144.1| NADH dehydrogenase subunit B [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976746|gb|EFG83514.1| NADH dehydrogenase subunit B [Gluconacetobacter hansenii ATCC
           23769]
          Length = 192

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    ++ EIT KGF+V ++D++V W RTGSL  M+FGLACCAVEM+ A MPRYDL+R 
Sbjct: 29  DAVIRGVTGEITEKGFVVANLDKIVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRM 88

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 89  GIIPRGSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSV 148

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEALIYGIL LQKKIRR G +
Sbjct: 149 VRGCDRIVPVDVYVPGCPPTAEALIYGILQLQKKIRRTGTI 189


>gi|295689628|ref|YP_003593321.1| NADH-quinone oxidoreductase subunit B [Caulobacter segnis ATCC
           21756]
 gi|295431531|gb|ADG10703.1| NADH-quinone oxidoreductase, B subunit [Caulobacter segnis ATCC
           21756]
          Length = 192

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S ++  KGF+  + D L+TWARTGSLMWMTFGLACCAVEMMQASMPRYDLER+
Sbjct: 30  DPFFDGVSQQLADKGFITAAADDLITWARTGSLMWMTFGLACCAVEMMQASMPRYDLERY 89

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYY+YSYSV
Sbjct: 90  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYYYSYSV 149

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+L LQKKIRR G ++
Sbjct: 150 VRGCDRVVPVDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIE 191


>gi|221234969|ref|YP_002517405.1| NADH dehydrogenase subunit B [Caulobacter crescentus NA1000]
 gi|238055282|sp|B8GWV5|NUOB_CAUCN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|220964141|gb|ACL95497.1| NADH-quinone oxidoreductase chain B [Caulobacter crescentus NA1000]
          Length = 200

 Score =  268 bits (685), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S ++  KGF+  + D L+TWARTGSLMWMTFGLACCAVEMMQASMPRYDLER+
Sbjct: 38  DPFFDGVSQQLADKGFITAAADDLITWARTGSLMWMTFGLACCAVEMMQASMPRYDLERY 97

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYY+YSYSV
Sbjct: 98  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYYYSYSV 157

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+L LQKKIRR G ++
Sbjct: 158 VRGCDRVVPVDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIE 199


>gi|16126198|ref|NP_420762.1| NADH dehydrogenase subunit B [Caulobacter crescentus CB15]
 gi|81621086|sp|Q9A6X1|NUOB_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|13423414|gb|AAK23930.1| NADH dehydrogenase I, B subunit [Caulobacter crescentus CB15]
          Length = 193

 Score =  268 bits (684), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S ++  KGF+  + D L+TWARTGSLMWMTFGLACCAVEMMQASMPRYDLER+
Sbjct: 31  DPFFDGVSQQLADKGFITAAADDLITWARTGSLMWMTFGLACCAVEMMQASMPRYDLERY 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYY+YSYSV
Sbjct: 91  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYYYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDR+VPVDIYVPGCPPTAEAL+YG+L LQKKIRR G ++
Sbjct: 151 VRGCDRVVPVDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIE 192


>gi|167646797|ref|YP_001684460.1| NADH dehydrogenase subunit B [Caulobacter sp. K31]
 gi|218527984|sp|B0SZ51|NUOB_CAUSK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|167349227|gb|ABZ71962.1| NADH-quinone oxidoreductase, B subunit [Caulobacter sp. K31]
          Length = 196

 Score =  264 bits (674), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 146/162 (90%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  F  +S ++  KGF+  + D L+TWARTGSLMWMTFGLACCAVEMM ++MPRYDLER+
Sbjct: 34  DPYFDGLSGQLADKGFVTAAADDLITWARTGSLMWMTFGLACCAVEMMHSAMPRYDLERY 93

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           GFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYY+YSYSV
Sbjct: 94  GFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYYYSYSV 153

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VRGCDRIVP+DIYVPGCPPTAEAL+YG+L LQKKIRR G ++
Sbjct: 154 VRGCDRIVPIDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIE 195


>gi|83311885|ref|YP_422149.1| NADH dehydrogenase subunit B [Magnetospirillum magneticum AMB-1]
 gi|123541537|sp|Q2W3I5|NUOB_MAGMM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|82946726|dbj|BAE51590.1| NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S
           oxidoreductase [Magnetospirillum magneticum AMB-1]
          Length = 186

 Score =  261 bits (667), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +++EI+ KGF++ SVD +V WARTGSL  MTFGLACCAVEMM A   RYD++RF
Sbjct: 24  DALLKAVTTEISDKGFVLASVDAVVNWARTGSLWPMTFGLACCAVEMMHAGCSRYDMDRF 83

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   R SPRQSD+MIVAGTLTNKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 84  GVVFRPSPRQSDLMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSV 143

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPP+AEAL+YGIL LQKKIRR G++
Sbjct: 144 VRGCDRIVPVDIYVPGCPPSAEALMYGILQLQKKIRRTGSI 184


>gi|46202360|ref|ZP_00053337.2| COG0377: NADH:ubiquinone oxidoreductase 20 kD subunit and related
           Fe-S oxidoreductases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 186

 Score =  261 bits (666), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +++EI+ KGF++ SVD +V WARTGSL  MTFGLACCAVEMM A   RYD++RF
Sbjct: 24  DALLKAVTTEISDKGFVLASVDAVVNWARTGSLWPMTFGLACCAVEMMHAGCSRYDMDRF 83

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   R SPRQSD+MIVAGTLTNKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 84  GVVFRPSPRQSDLMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSV 143

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPP+AEAL+YGIL LQKKIRR G++
Sbjct: 144 VRGCDRIVPVDIYVPGCPPSAEALMYGILQLQKKIRRTGSI 184


>gi|258542721|ref|YP_003188154.1| NADH dehydrogenase subunit B [Acetobacter pasteurianus IFO 3283-01]
 gi|256633799|dbj|BAH99774.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636858|dbj|BAI02827.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639911|dbj|BAI05873.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642967|dbj|BAI08922.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646022|dbj|BAI11970.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649075|dbj|BAI15016.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652062|dbj|BAI17996.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655119|dbj|BAI21046.1| NADH-quinone oxidoreductase chain B [Acetobacter pasteurianus IFO
           3283-12]
          Length = 186

 Score =  261 bits (666), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/161 (75%), Positives = 137/161 (85%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    I+  +  KGF+V ++D+LV W RTGSL  M+FGLACCAVEM+ A MPRYDL+R 
Sbjct: 23  DAVVRGITGVLAEKGFVVANLDKLVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRM 82

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA  LRR+Y+QM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 83  GIIPRGSPRQSDVMIVAGTLTNKMAPVLRRLYEQMAEPRWVISMGSCANGGGYYHYSYSV 142

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEALIYGI+LLQKKIRR G +
Sbjct: 143 VRGCDRIVPVDVYVPGCPPTAEALIYGIMLLQKKIRRTGTI 183


>gi|329114679|ref|ZP_08243438.1| NADH-quinone oxidoreductase subunit B 2 [Acetobacter pomorum DM001]
 gi|326696159|gb|EGE47841.1| NADH-quinone oxidoreductase subunit B 2 [Acetobacter pomorum DM001]
          Length = 186

 Score =  261 bits (666), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/161 (75%), Positives = 137/161 (85%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    I+  +  KGF+V ++D+LV W RTGSL  M+FGLACCAVEM+ A MPRYDL+R 
Sbjct: 23  DAVVRGITGVLAEKGFVVANLDKLVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRM 82

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGTLTNKMA  LRR+Y+QM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 83  GIIPRGSPRQSDVMIVAGTLTNKMAPVLRRLYEQMAEPRWVISMGSCANGGGYYHYSYSV 142

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEALIYGI+LLQKKIRR G +
Sbjct: 143 VRGCDRIVPVDVYVPGCPPTAEALIYGIMLLQKKIRRTGTI 183


>gi|144899466|emb|CAM76330.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 186

 Score =  259 bits (662), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/186 (67%), Positives = 149/186 (80%), Gaps = 5/186 (2%)

Query: 1   MGLTTVNQKIISGQSSCSLEK---VDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMW 57
           MG+T  N  +++   +  L +    D+    ++ E+  KGF++ +VD+LV WARTGSL  
Sbjct: 1   MGVT--NSGLVTPAHAAPLPQGAAQDSVLKLVTDELEDKGFVLANVDKLVNWARTGSLWP 58

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCAVEM+ A   RYD++RFG   R SPRQSDVMIVAGTLTNKMA ALRRVYDQM
Sbjct: 59  MTFGLACCAVEMIHAGCSRYDMDRFGVVFRPSPRQSDVMIVAGTLTNKMAPALRRVYDQM 118

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
            EPR+VISMGSCANGGGYYHYSYSVVRGCDR+VPVD+YVPGCPPTAEAL+YGIL LQKKI
Sbjct: 119 AEPRWVISMGSCANGGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGILQLQKKI 178

Query: 178 RRVGNV 183
           RR G++
Sbjct: 179 RRTGSI 184


>gi|194595689|gb|ACF77132.1| NADH dehydrogenase subunit B [Azospirillum brasilense]
          Length = 180

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/160 (77%), Positives = 135/160 (84%), Gaps = 1/160 (0%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    ++ EI  KGF+    + ++ WARTGSL  MTFGLACCAVEM+ A M RYDL+RF
Sbjct: 18  DAYLRAVTEEIQEKGFITAKYEDVLAWARTGSLWPMTFGLACCAVEMIHAYMSRYDLDRF 77

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSV
Sbjct: 78  GVIPRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSV 137

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKIRR GN
Sbjct: 138 VRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIRR-GN 176


>gi|288958988|ref|YP_003449329.1| NADH dehydrogenase I chain B [Azospirillum sp. B510]
 gi|288911296|dbj|BAI72785.1| NADH dehydrogenase I chain B [Azospirillum sp. B510]
          Length = 188

 Score =  258 bits (659), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/160 (77%), Positives = 136/160 (85%), Gaps = 1/160 (0%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +S EI  KGF++   + L+ WARTGSL  MTFGLACCAVEM+ A M RYDL+RF
Sbjct: 26  DAYIRAVSDEIQDKGFVLAKYEDLLAWARTGSLWPMTFGLACCAVEMIHAYMSRYDLDRF 85

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+V
Sbjct: 86  GVIPRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAV 145

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R GN
Sbjct: 146 VRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIKR-GN 184


>gi|163793188|ref|ZP_02187164.1| excinuclease ABC subunit A [alpha proteobacterium BAL199]
 gi|159181834|gb|EDP66346.1| excinuclease ABC subunit A [alpha proteobacterium BAL199]
          Length = 179

 Score =  257 bits (657), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 141/183 (77%), Gaps = 6/183 (3%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
           MG+    + + +G +       DA  S +S EI  KGF++   D+L  WAR GSL  MTF
Sbjct: 1   MGVINAERPVPAGANQ------DAILSAVSDEIREKGFVIAQADKLFNWARCGSLWPMTF 54

Query: 61  GLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           GLACCAVEMM  +  RYDL+RFG   R SPRQSDVMIVAGTLTNKMA ALR+VYDQM EP
Sbjct: 55  GLACCAVEMMHTAASRYDLDRFGLVFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMAEP 114

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           R+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+KI+R 
Sbjct: 115 RWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVLQLQRKIKRT 174

Query: 181 GNV 183
             +
Sbjct: 175 ATI 177


>gi|294083712|ref|YP_003550469.1| NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S
           oxidoreductase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663284|gb|ADE38385.1| NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S
           oxidoreductase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 182

 Score =  256 bits (655), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +  EIT++GF++   D+L  WAR+GSL  MTFGLACCAVEMM ++  RYD++R+
Sbjct: 19  DAILKAVGDEITNRGFVIAKADKLFNWARSGSLWPMTFGLACCAVEMMHSAASRYDMDRY 78

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   R SPRQSDVMIVAGTLTNKMA ALRRVYDQMPEPR+V+SMGSCANGGGYYHYSY+V
Sbjct: 79  GMLFRPSPRQSDVMIVAGTLTNKMAPALRRVYDQMPEPRWVLSMGSCANGGGYYHYSYAV 138

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVD+YVPGCPPTAEALIYG+L LQKKIRR   +
Sbjct: 139 VRGCDRIVPVDVYVPGCPPTAEALIYGLLQLQKKIRRTATI 179


>gi|147902669|ref|NP_001087274.1| MGC85267 protein [Xenopus laevis]
 gi|51873813|gb|AAH78494.1| MGC85267 protein [Xenopus laevis]
          Length = 217

 Score =  254 bits (650), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (0%)

Query: 27  SRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           ++ SS  ++KG F++T +D+LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG  
Sbjct: 54  AKKSSLPSNKGEFVITKLDELVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVV 113

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRG
Sbjct: 114 FRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRG 173

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           CDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R
Sbjct: 174 CDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKR 207


>gi|118404166|ref|NP_001072396.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase) [Xenopus (Silurana)
           tropicalis]
 gi|113197754|gb|AAI21597.1| hypothetical protein MGC147194 [Xenopus (Silurana) tropicalis]
          Length = 217

 Score =  254 bits (648), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (0%)

Query: 20  EKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           +K  A  ++ S   ++KG F++T +D+LV WAR  SL  MTFGLACCAVEMM  + PRYD
Sbjct: 47  QKSSAVTAKKSLLPSNKGEFVITKLDELVNWARRSSLWPMTFGLACCAVEMMHMAAPRYD 106

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           ++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHY
Sbjct: 107 MDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHY 166

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R   ++
Sbjct: 167 SYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLR 212


>gi|315583009|ref|NP_001186841.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, (NADH-coenzyme Q
           reductase) [Danio rerio]
          Length = 217

 Score =  253 bits (647), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 143/175 (81%), Gaps = 4/175 (2%)

Query: 14  QSSCSL---EKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
            SSC +   EK  A  ++ +S ++ KG +++T +D LV WAR  SL  MTFGLACCAVEM
Sbjct: 38  NSSCLVPFREKSTALAAKPASAVSSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEM 97

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSC
Sbjct: 98  MHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSC 157

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG L LQ+KI+R   +K
Sbjct: 158 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKRMK 212


>gi|138519723|gb|AAI35870.1| hypothetical protein MGC147194 [Xenopus (Silurana) tropicalis]
          Length = 217

 Score =  253 bits (646), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (0%)

Query: 20  EKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           +K  A  ++ S   ++KG F++T +D+LV WAR  SL  MTFGLACCAVEMM  + PRYD
Sbjct: 47  QKSSAVTAKKSLLPSNKGEFVITKLDELVNWARRSSLWPMTFGLACCAVEMMHMAAPRYD 106

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           ++RFG   RASPRQ+DVM+VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHY
Sbjct: 107 MDRFGVVFRASPRQADVMVVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHY 166

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R   ++
Sbjct: 167 SYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLR 212


>gi|153875120|ref|ZP_02003055.1| NADH-quinone oxidoreductase, B subunit [Beggiatoa sp. PS]
 gi|152068417|gb|EDN66946.1| NADH-quinone oxidoreductase, B subunit [Beggiatoa sp. PS]
          Length = 160

 Score =  253 bits (645), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ T+ D+L+ WARTGS+  MTFGLACCAVEMMQA   RYDL+RFG   R SPRQ
Sbjct: 6   ILQEGFVTTTADRLINWARTGSMWPMTFGLACCAVEMMQAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTLTNKMA ALR+VYDQMP PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLTNKMAPALRKVYDQMPNPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIY+PGCPPTAEAL+YGIL LQ KI+R   +
Sbjct: 126 DIYIPGCPPTAEALLYGILQLQNKIKRTNTI 156


>gi|318054193|ref|NP_001187743.1| mitochondrial NADH dehydrogenase (ubiquinone) iron-sulfur protein 7
           [Ictalurus punctatus]
 gi|308323857|gb|ADO29064.1| mitochondrial NADH dehydrogenase (ubiquinone) iron-sulfur protein 7
           [Ictalurus punctatus]
          Length = 217

 Score =  253 bits (645), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 138/166 (83%), Gaps = 1/166 (0%)

Query: 20  EKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           EK  A   + +S ++ KG +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD
Sbjct: 47  EKSTAVALKPTSAVSSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYD 106

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           ++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHY
Sbjct: 107 MDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHY 166

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG L LQ+KI+R   ++
Sbjct: 167 SYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKKMR 212


>gi|148236498|ref|NP_001088930.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase) [Xenopus laevis]
 gi|57032922|gb|AAH88820.1| LOC496303 protein [Xenopus laevis]
          Length = 180

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 137/160 (85%), Gaps = 1/160 (0%)

Query: 26  FSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
             + +S  ++KG F++T +D+LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG 
Sbjct: 16  LQKKTSLPSNKGEFVITKLDELVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGV 75

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVR
Sbjct: 76  VFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVR 135

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R   ++
Sbjct: 136 GCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLR 175


>gi|289207894|ref|YP_003459960.1| NADH-quinone oxidoreductase subunit beta [Thioalkalivibrio sp.
           K90mix]
 gi|288943525|gb|ADC71224.1| NADH-quinone oxidoreductase, B subunit [Thioalkalivibrio sp.
           K90mix]
          Length = 158

 Score =  251 bits (642), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIRRTNTI 156


>gi|308321280|gb|ADO27792.1| mitochondrial NADH dehydrogenase iron-sulfur protein 7 [Ictalurus
           furcatus]
          Length = 217

 Score =  251 bits (641), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (0%)

Query: 30  SSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +S ++ KG +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RA
Sbjct: 57  TSAVSSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRA 116

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 117 SPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 176

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           IVPVDIYVPGCPPTAEAL+YG L LQ+KI+R
Sbjct: 177 IVPVDIYVPGCPPTAEALLYGTLQLQRKIKR 207


>gi|320167168|gb|EFW44067.1| NADH2 dehydrogenase subunit 22K [Capsaspora owczarzaki ATCC 30864]
          Length = 206

 Score =  251 bits (641), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 116/166 (69%), Positives = 133/166 (80%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
            + + + F    +      F ++ +D LV W RTGS+  MTFGLACCAVEMMQA+  RYD
Sbjct: 36  FKPIKSSFPASLAPANQAEFALSKLDALVNWGRTGSVWPMTFGLACCAVEMMQAAAARYD 95

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
            +RFG   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHY
Sbjct: 96  FDRFGIVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHY 155

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SY+VVRGCDRIVPVD+YVPGCPPTAEAL+YGIL LQKKI+R    +
Sbjct: 156 SYAVVRGCDRIVPVDVYVPGCPPTAEALLYGILQLQKKIKRSNQAQ 201


>gi|198284143|ref|YP_002220464.1| NADH dehydrogenase subunit B [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667459|ref|YP_002426797.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218527940|sp|B5EM21|NUOB1_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|238065067|sp|B7J6H2|NUOB_ACIF2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|198248664|gb|ACH84257.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519672|gb|ACK80258.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 158

 Score =  251 bits (641), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  KGF+ TS+D +V W+RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   ILEKGFVTTSIDTVVNWSRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGLLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALI+G++ LQKKIRR   +
Sbjct: 126 DIYVPGCPPTAEALIFGLIQLQKKIRRTNTI 156


>gi|117926908|ref|YP_867525.1| NADH-quinone oxidoreductase subunit beta [Magnetococcus sp. MC-1]
 gi|238065166|sp|A0LDS6|NUOB_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|117610664|gb|ABK46119.1| NADH dehydrogenase subunit B [Magnetococcus sp. MC-1]
          Length = 167

 Score =  251 bits (641), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
              +  E++ +GFL+TS D+LV W R+ S+  MTFGLACCAVEMM A   RYDL+RFG  
Sbjct: 2   IEELHQEVSDRGFLLTSADKLVNWGRSMSMWPMTFGLACCAVEMMNAGASRYDLDRFGVV 61

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            R SPRQSDV+IVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG
Sbjct: 62  FRGSPRQSDVIIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 121

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           CDRI+PVD+Y+PGCPPTAEA++YGI+ LQKKI R G V
Sbjct: 122 CDRILPVDVYIPGCPPTAEAVMYGIMQLQKKINREGQV 159


>gi|157964436|ref|YP_001499260.1| NADH dehydrogenase subunit B [Rickettsia massiliae MTU5]
 gi|218528019|sp|A8F1C7|NUOB_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|157844212|gb|ABV84713.1| NADH dehydrogenase I chain B [Rickettsia massiliae MTU5]
          Length = 174

 Score =  251 bits (641), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +S+E++++GFL+T VD ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LSNELSNRGFLLTKVDNVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|150406467|ref|YP_001315111.1| NADH dehydrogenase subunit 10 [Chlorokybus atmophyticus]
 gi|126507704|gb|ABO15101.1| NADH dehydrogenase subunit 10 [Chlorokybus atmophyticus]
          Length = 158

 Score =  251 bits (640), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +L++ VDQL+ WAR GSL  MTFGLACCAVEMM     RYDL+RFG   R SPRQSDVMI
Sbjct: 7   YLISKVDQLIHWARKGSLWPMTFGLACCAVEMMHTGASRYDLDRFGIIFRPSPRQSDVMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 67  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 126

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKK++R  N K
Sbjct: 127 GCPPTAEALLYGILQLQKKMKRTKNTK 153


>gi|15892407|ref|NP_360121.1| NADH dehydrogenase subunit B [Rickettsia conorii str. Malish 7]
 gi|34580591|ref|ZP_00142071.1| NADH dehydrogenase I chain B [Rickettsia sibirica 246]
 gi|157828358|ref|YP_001494600.1| NADH dehydrogenase subunit B [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933066|ref|YP_001649855.1| NADH dehydrogenase subunit B [Rickettsia rickettsii str. Iowa]
 gi|238651035|ref|YP_002916892.1| NADH dehydrogenase subunit B [Rickettsia peacockii str. Rustic]
 gi|20139043|sp|Q92ID6|NUOB_RICCN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528020|sp|B0BX73|NUOB_RICRO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528021|sp|A8GRR7|NUOB_RICRS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|259514688|sp|C4K2P3|NUOB_RICPU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|15619558|gb|AAL03022.1| NADH dehydrogenase I chain B [Rickettsia conorii str. Malish 7]
 gi|28261976|gb|EAA25480.1| NADH dehydrogenase I chain B [Rickettsia sibirica 246]
 gi|157800839|gb|ABV76092.1| NADH dehydrogenase subunit B [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908153|gb|ABY72449.1| NADH-quinone oxidoreductase chain B [Rickettsia rickettsii str.
           Iowa]
 gi|238625133|gb|ACR47839.1| NADH dehydrogenase subunit B [Rickettsia peacockii str. Rustic]
          Length = 174

 Score =  251 bits (640), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +S+E++++GFL+T VD ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LSNELSNRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|229586623|ref|YP_002845124.1| NADH dehydrogenase subunit B [Rickettsia africae ESF-5]
 gi|259514686|sp|C3PN71|NUOB_RICAE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|228021673|gb|ACP53381.1| NADH dehydrogenase I chain B [Rickettsia africae ESF-5]
          Length = 174

 Score =  251 bits (640), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +S+E++++GFL+T VD ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LSNELSNRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMTEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|83592891|ref|YP_426643.1| NADH dehydrogenase subunit B [Rhodospirillum rubrum ATCC 11170]
 gi|123526697|sp|Q2RU39|NUOB_RHORT RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|83575805|gb|ABC22356.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 185

 Score =  250 bits (639), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (84%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D    +++ EI  KGF++++VD LV WAR GSL  MTFGLACCA+EM+  +  RYDL+RF
Sbjct: 23  DLILGQVAREIEEKGFVLSNVDSLVNWARAGSLWPMTFGLACCALEMIHCACARYDLDRF 82

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   R SPRQSDVMIVAGTLTNKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 83  GTVFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSV 142

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           VRGCDRIVPVDIYVPGCPPT+EAL+YG+L LQKKI+R G
Sbjct: 143 VRGCDRIVPVDIYVPGCPPTSEALLYGVLQLQKKIKRTG 181


>gi|221108593|ref|XP_002170450.1| PREDICTED: similar to NADH-ubiquinone oxidoreductase Fe-S protein
           7, partial [Hydra magnipapillata]
          Length = 198

 Score =  250 bits (639), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 116/147 (78%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V  VD LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 47  FVVAKVDDLVNWARRSSLWPMTFGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQADVMI 106

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRRVYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVP
Sbjct: 107 VAGTLTNKMAPALRRVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVP 166

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKKI+R   +K
Sbjct: 167 GCPPTAEALLYGVLQLQKKIKRTREIK 193


>gi|220934163|ref|YP_002513062.1| NADH-quinone oxidoreductase, B subunit [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|238065221|sp|B8GNY6|NUOB_THISH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|219995473|gb|ACL72075.1| NADH-quinone oxidoreductase, B subunit [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 158

 Score =  250 bits (639), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGIL LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALLYGILQLQNKIRRTNTI 156


>gi|326934474|ref|XP_003213314.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial-like, partial [Meleagris gallopavo]
          Length = 212

 Score =  250 bits (639), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 120/165 (72%), Positives = 136/165 (82%), Gaps = 1/165 (0%)

Query: 21  KVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           K  A   + S   T +G ++VT +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD+
Sbjct: 43  KSSAVLPKKSYVPTSRGEYIVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDM 102

Query: 80  ERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           +RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYS
Sbjct: 103 DRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYS 162

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R   ++
Sbjct: 163 YSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKKIQ 207


>gi|197128812|gb|ACH45310.1| putative NADH dehydrogenase Fe-S protein 7 >Feature gb|DQ213771
           [Taeniopygia guttata]
          Length = 216

 Score =  250 bits (639), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (81%), Gaps = 1/169 (0%)

Query: 12  SGQSSCSLEKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           +  SS  ++K  A   R S   + +G +++  +D LV WAR  SL  MTFGLACCAVEMM
Sbjct: 38  AADSSVQVQKSSAVVPRKSYVPSSRGEYVIAKLDDLVNWARRSSLWPMTFGLACCAVEMM 97

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCA
Sbjct: 98  HMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCA 157

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI+R
Sbjct: 158 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKR 206


>gi|239947491|ref|ZP_04699244.1| NADH-quinone oxidoreductase subunit B [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921767|gb|EER21791.1| NADH-quinone oxidoreductase subunit B [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 187

 Score =  250 bits (638), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (86%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++ E++++GFL+T VD ++ WART SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 25  LNHELSNRGFLLTKVDDVIGWARTNSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 84

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 85  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 144

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVDIYVPGCPPTAE LIYG++ LQKKI+R    K
Sbjct: 145 IVPVDIYVPGCPPTAETLIYGLMQLQKKIKRTTGFK 180


>gi|157827450|ref|YP_001496514.1| NADH dehydrogenase subunit B [Rickettsia bellii OSU 85-389]
 gi|218528017|sp|A8GX77|NUOB_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|157802754|gb|ABV79477.1| NADH dehydrogenase subunit B [Rickettsia bellii OSU 85-389]
          Length = 174

 Score =  250 bits (638), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 137/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E++++GFL+T VD ++ WAR+ SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNNELSNRGFLLTKVDDVIGWARSNSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|255019908|ref|ZP_05291983.1| NADH-ubiquinone oxidoreductase chain B [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970688|gb|EET28175.1| NADH-ubiquinone oxidoreductase chain B [Acidithiobacillus caldus
           ATCC 51756]
          Length = 158

 Score =  250 bits (638), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS+D +V W+RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTSIDTVVNWSRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL++G++ LQKKIRR   +
Sbjct: 126 DVYVPGCPPTAEALLFGLIQLQKKIRRTNTI 156


>gi|126323645|ref|XP_001373250.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 304

 Score =  250 bits (638), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 115/142 (80%), Positives = 127/142 (89%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 153 YVITKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 212

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 213 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 272

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQKKI+R
Sbjct: 273 GCPPTAEALLYGILQLQKKIKR 294


>gi|21312950|ref|NP_083548.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Mus musculus]
 gi|47117311|sp|Q9DC70|NDUS7_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|12833606|dbj|BAB22592.1| unnamed protein product [Mus musculus]
 gi|15488721|gb|AAH13503.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Mus musculus]
 gi|148699633|gb|EDL31580.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_b [Mus
           musculus]
          Length = 224

 Score =  250 bits (638), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 73  YVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 132

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 133 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 192

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQ+KI+R   +K
Sbjct: 193 GCPPTAEALLYGILQLQRKIKREQKLK 219


>gi|299471504|emb|CBN79990.1| NUO10 homolog, NADH dehydrogenase (ubiquinone) subunit 10
           [Ectocarpus siliculosus]
          Length = 225

 Score =  250 bits (638), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD LV WAR GSL  MTFGLACCAVEMM ++  RYDLERFG   RASPRQSDVMI
Sbjct: 74  FVVSKVDDLVNWARKGSLWPMTFGLACCAVEMMHSAASRYDLERFGMVFRASPRQSDVMI 133

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 134 VAGTLCNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 193

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+YG+L LQKKI+
Sbjct: 194 GCPPTAEALLYGLLQLQKKIK 214


>gi|56606108|ref|NP_001008525.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial [Rattus norvegicus]
 gi|55824717|gb|AAH86574.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Rattus norvegicus]
 gi|149034571|gb|EDL89308.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_d
           [Rattus norvegicus]
          Length = 218

 Score =  250 bits (638), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 67  YVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 186

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQ+KI+R   +K
Sbjct: 187 GCPPTAEALLYGILQLQRKIKREQKLK 213


>gi|114321118|ref|YP_742801.1| NADH-quinone oxidoreductase, B subunit [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|122311303|sp|Q0A776|NUOB_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|114227512|gb|ABI57311.1| NADH dehydrogenase subunit B [Alkalilimnicola ehrlichii MLHE-1]
          Length = 158

 Score =  249 bits (637), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 116/151 (76%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D+++ WARTGS+  MTFGLACCAVEMMQA   RYDL+RFG   R SPRQ
Sbjct: 6   LLEKGFVTTSADKVINWARTGSMWPMTFGLACCAVEMMQAGAARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDR+VPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALI+GI+ LQKKIR    +
Sbjct: 126 DVYVPGCPPTAEALIWGIMQLQKKIRTTNTI 156


>gi|261856549|ref|YP_003263832.1| NADH-quinone oxidoreductase subunit beta [Halothiobacillus
           neapolitanus c2]
 gi|261837018|gb|ACX96785.1| NADH-quinone oxidoreductase, B subunit [Halothiobacillus
           neapolitanus c2]
          Length = 159

 Score =  249 bits (637), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALLYGIIQLQNKIRRTNTI 156


>gi|67458958|ref|YP_246582.1| NADH dehydrogenase subunit B [Rickettsia felis URRWXCal2]
 gi|75536604|sp|Q4UM06|NUOB_RICFE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|67004491|gb|AAY61417.1| NADH dehydrogenase I chain B [Rickettsia felis URRWXCal2]
          Length = 174

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E++++GFL+T VD ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNNELSNRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|225707068|gb|ACO09380.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Osmerus mordax]
          Length = 220

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (87%), Gaps = 1/147 (0%)

Query: 34  THKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           T KG +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ
Sbjct: 64  TSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQ 123

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 124 SDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPV 183

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           DIYVPGCPPTAEAL+YG L LQKKI+R
Sbjct: 184 DIYVPGCPPTAEALLYGTLQLQKKIKR 210


>gi|224007275|ref|XP_002292597.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220971459|gb|EED89793.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 216

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V+ VD LV WAR GSL  MTFGLACCAVEMM A+  RYD+ERFG   RASPRQSDVMI
Sbjct: 65  YAVSRVDDLVNWARKGSLWPMTFGLACCAVEMMHAAASRYDMERFGMVFRASPRQSDVMI 124

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 125 VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 184

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+YG+L LQKKI+
Sbjct: 185 GCPPTAEALLYGLLQLQKKIK 205


>gi|297275661|ref|XP_002808210.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 7, mitochondrial-like [Macaca
           mulatta]
          Length = 362

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/179 (65%), Positives = 139/179 (77%)

Query: 6   VNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACC 65
           V+Q + +   S +   +    + +    +   ++V  +D LV WAR  SL  MTFGLACC
Sbjct: 179 VHQSVATDGPSSAQPALPKAGAMVPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACC 238

Query: 66  AVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVIS 125
           AVEMM  + PRYD++RFG   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYVIS
Sbjct: 239 AVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVIS 298

Query: 126 MGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           MGSCANGGGYYHYSYSVVRGCDRIVPVDIY+PGCPPTAEAL+YG+L LQ+KI+R   V+
Sbjct: 299 MGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGVLQLQRKIKRERKVQ 357


>gi|15604224|ref|NP_220740.1| NADH dehydrogenase subunit B [Rickettsia prowazekii str. Madrid E]
 gi|6647678|sp|Q9ZDH2|NUOB_RICPR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|3860916|emb|CAA14816.1| NADH DEHYDROGENASE I CHAIN B (nuoB) [Rickettsia prowazekii]
 gi|292571965|gb|ADE29880.1| NADH dehydrogenase I chain B [Rickettsia prowazekii Rp22]
          Length = 174

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 137/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++S +T++GFL++ VD++++WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNSGLTNRGFLLSKVDEVISWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMTEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|296420699|ref|XP_002839906.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636113|emb|CAZ84097.1| unnamed protein product [Tuber melanosporum]
          Length = 213

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 3/171 (1%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           ++ + S S+++ +     + S++  KG   +++TS+DQ+  WAR GSL  MTFGLACCAV
Sbjct: 32  LAPRDSSSIDRSNRREVLLPSQVPKKGVMQYVLTSLDQVANWARQGSLWPMTFGLACCAV 91

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+V+SMG
Sbjct: 92  EMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWVVSMG 151

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           SCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGIL LQKK+R
Sbjct: 152 SCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGILQLQKKMR 202


>gi|196002435|ref|XP_002111085.1| predicted protein [Trichoplax adhaerens]
 gi|190587036|gb|EDV27089.1| predicted protein [Trichoplax adhaerens]
          Length = 164

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 128/146 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V  VD ++ WAR  SL  MTFGLACCA+EMMQ + PRYD++RFG   RASPRQ+DVMI
Sbjct: 13  FVVAKVDDVINWARRSSLWPMTFGLACCAIEMMQFAAPRYDMDRFGIVFRASPRQADVMI 72

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA A R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 73  VAGTLTNKMAPAFRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 132

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNV 183
           GCPPTAEAL+YG LLLQKKIRR  +V
Sbjct: 133 GCPPTAEALLYGFLLLQKKIRRSKSV 158


>gi|167536644|ref|XP_001749993.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163771503|gb|EDQ85168.1| predicted protein [Monosiga brevicollis MX1]
          Length = 218

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 1/154 (0%)

Query: 27  SRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           S+I + I ++  + +  +D LV WAR GS+  MTFGLACCAVEMM  + PRYD++RFG  
Sbjct: 55  SKIPANIDNRADYALAKLDDLVNWARKGSMWPMTFGLACCAVEMMHVAAPRYDMDRFGIV 114

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSY+VVRG
Sbjct: 115 FRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYAVVRG 174

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           CDRIVPVDIYVPGCPPT+EAL+YG+L LQKKI+R
Sbjct: 175 CDRIVPVDIYVPGCPPTSEALLYGLLQLQKKIKR 208


>gi|47217431|emb|CAG00791.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 219

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (85%), Gaps = 1/159 (0%)

Query: 27  SRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           ++ +S  + KG +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG  
Sbjct: 56  AKPASVASSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVV 115

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQ+DVMIVAGTLTNKMA ALR+VY+QMPEPRYVISMGSCANGGGYYHYSY+VVRG
Sbjct: 116 FRASPRQADVMIVAGTLTNKMAPALRKVYEQMPEPRYVISMGSCANGGGYYHYSYAVVRG 175

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           CDRIVPVDIYVPGCPPTAEAL+YG+L LQ+KI+R   ++
Sbjct: 176 CDRIVPVDIYVPGCPPTAEALLYGVLQLQRKIKREKKLR 214


>gi|194212381|ref|XP_001503839.2| PREDICTED: similar to PSST subunit of the NADH: ubiquinone
           oxidoreductase complex [Equus caballus]
          Length = 259

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 137/163 (84%), Gaps = 1/163 (0%)

Query: 18  SLEKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
           ++ K  A   + ++  + +G ++VT +D LV WAR  SL  MTFGLACCAVEMM  + PR
Sbjct: 87  AMSKAGAVVPKPTALPSSRGEYVVTKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPR 146

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD++RFG   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYY
Sbjct: 147 YDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYY 206

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           HYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI+R
Sbjct: 207 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKR 249


>gi|84000019|ref|NP_001033111.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Bos taurus]
 gi|1171865|sp|P42026|NDUS7_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; AltName: Full=PSST
           subunit; Flags: Precursor
 gi|599691|emb|CAA46154.1| PSST subunit of the NADH: ubiquinone oxidoreductase complex [Bos
           taurus]
 gi|83638667|gb|AAI09717.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase) [Bos taurus]
 gi|296485358|gb|DAA27473.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Bos taurus]
          Length = 216

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 65  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 124

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 125 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 184

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQKKI+R
Sbjct: 185 GCPPTAEALLYGILQLQKKIKR 206


>gi|198284345|ref|YP_002220666.1| NADH dehydrogenase subunit B [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666644|ref|YP_002427007.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218527968|sp|B5EN70|NUOB2_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|198248866|gb|ACH84459.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518857|gb|ACK79443.1| NADH-quinone oxidoreductase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 158

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D +V W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   LLEKGFVTTTIDTVVNWGRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYS+VRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSIVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL++G++ LQKKIRR   +
Sbjct: 126 DIYVPGCPPTAEALLFGLVQLQKKIRRTNTI 156


>gi|209964549|ref|YP_002297464.1| NADH-quinone oxidoreductase chain B [Rhodospirillum centenum SW]
 gi|238065202|sp|B6ISY0|NUOB_RHOCS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|209958015|gb|ACI98651.1| NADH-quinone oxidoreductase chain B [Rhodospirillum centenum SW]
          Length = 194

 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 132/160 (82%), Gaps = 1/160 (0%)

Query: 23  DADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DA    +  E+  KG+LV   D L+ WARTGSL  MTFGLACCAVEM+ A M RYDL+RF
Sbjct: 31  DAYLQAVQQEMQDKGYLVARFDALMDWARTGSLWPMTFGLACCAVEMIHAYMARYDLDRF 90

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G  PR SPRQSDVMIVAGT+ NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSV
Sbjct: 91  GVIPRPSPRQSDVMIVAGTVCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSV 150

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VRG DRIVPVDIYVPGCPPTAEAL+YG+L LQKKI+  GN
Sbjct: 151 VRGVDRIVPVDIYVPGCPPTAEALVYGVLQLQKKIKN-GN 189


>gi|269469169|gb|EEZ80711.1| NADH dehydrogenase I chain B [uncultured SUP05 cluster bacterium]
          Length = 159

 Score =  248 bits (633), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  + F+ TS+D+++ WARTGSL  MTFGLACCAVEMM+A   RYDL+RFG   R +PRQ
Sbjct: 6   LMKESFVTTSLDKVINWARTGSLWPMTFGLACCAVEMMEAGSSRYDLDRFGIVFRPTPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGIL LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGILQLQDKIRRTNTI 156


>gi|307206424|gb|EFN84462.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial [Harpegnathos saltator]
          Length = 224

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 113/147 (76%), Positives = 129/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  VD L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSD +I
Sbjct: 73  YALARVDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDCII 132

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMASALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 133 VAGTLTNKMASALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 192

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKKI+R+ NV+
Sbjct: 193 GCPPTAEALLYGVLQLQKKIKRMQNVQ 219


>gi|260800203|ref|XP_002595024.1| hypothetical protein BRAFLDRAFT_99644 [Branchiostoma floridae]
 gi|229280264|gb|EEN51035.1| hypothetical protein BRAFLDRAFT_99644 [Branchiostoma floridae]
          Length = 194

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/142 (81%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 43  FVVARLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 102

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 103 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 162

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQKKI+R
Sbjct: 163 GCPPTAEALLYGILQLQKKIKR 184


>gi|198285499|gb|ACH85288.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 [Salmo salar]
          Length = 215

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 64  YVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 123

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 124 VAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 183

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG L LQKKI+R
Sbjct: 184 GCPPTAEALLYGTLQLQKKIKR 205


>gi|51473550|ref|YP_067307.1| NADH dehydrogenase subunit B [Rickettsia typhi str. Wilmington]
 gi|81390150|sp|Q68X17|NUOB_RICTY RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|51459862|gb|AAU03825.1| NADH dehydrogenase (ubiquinone) subunit B [Rickettsia typhi str.
           Wilmington]
          Length = 171

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 112/156 (71%), Positives = 137/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++S +T++GFL++ +D++++WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNSCLTNRGFLLSKIDEVISWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMTEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|73987562|ref|XP_533960.2| PREDICTED: similar to NADH-ubiquinone oxidoreductase Fe-S protein 7
           [Canis familiaris]
          Length = 216

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/147 (77%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 65  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 124

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 125 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 184

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQ+KI+R   ++
Sbjct: 185 GCPPTAEALLYGILQLQRKIKREKKLR 211


>gi|157803902|ref|YP_001492451.1| NADH dehydrogenase subunit B [Rickettsia canadensis str. McKiel]
 gi|218528018|sp|A8EZ83|NUOB_RICCK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|157785165|gb|ABV73666.1| NADH dehydrogenase beta subunit [Rickettsia canadensis str. McKiel]
          Length = 174

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 112/156 (71%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++++++++GFL+T VD ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNNKLSNRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVDIY+PGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDIYIPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|209730616|gb|ACI66177.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Salmo salar]
 gi|209731354|gb|ACI66546.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Salmo salar]
 gi|223646164|gb|ACN09840.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Salmo salar]
 gi|223672011|gb|ACN12187.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Salmo salar]
 gi|303660793|gb|ADM16006.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Salmo salar]
          Length = 220

 Score =  248 bits (632), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 69  YVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 129 VAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 188

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG L LQKKI+R
Sbjct: 189 GCPPTAEALLYGTLQLQKKIKR 210


>gi|319943349|ref|ZP_08017631.1| NADH-quinone oxidoreductase subunit B [Lautropia mirabilis ATCC
           51599]
 gi|319743164|gb|EFV95569.1| NADH-quinone oxidoreductase subunit B [Lautropia mirabilis ATCC
           51599]
          Length = 159

 Score =  248 bits (632), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+VD+L+ W RTGSL  MTFGLACCAVEM+ A + RYDL+RFG   R SPR 
Sbjct: 6   VLNEGFVTTNVDKLINWTRTGSLWAMTFGLACCAVEMIHAGVSRYDLDRFGVIFRPSPRH 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYGI+ LQ+KIR    +
Sbjct: 126 DIYVPGCPPTAEALIYGIIQLQRKIRETNTI 156


>gi|229366862|gb|ACQ58411.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Anoplopoma fimbria]
          Length = 219

 Score =  248 bits (632), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 114/147 (77%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 68  YAITKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 127

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 128 VAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 187

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG L LQKKI+R   ++
Sbjct: 188 GCPPTAEALLYGTLQLQKKIKREKKLR 214


>gi|254491467|ref|ZP_05104646.1| NADH-quinone oxidoreductase, B subunit subfamily [Methylophaga
           thiooxidans DMS010]
 gi|224462945|gb|EEF79215.1| NADH-quinone oxidoreductase, B subunit subfamily [Methylophaga
           thiooxydans DMS010]
          Length = 162

 Score =  248 bits (632), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KG + TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGVVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGI+ LQKKI+R   +
Sbjct: 126 DIYVPGCPPTAEALLYGIVQLQKKIQRTNTI 156


>gi|198431614|ref|XP_002130919.1| PREDICTED: similar to NADH-ubiquinone oxidoreductase Fe-S protein 7
           [Ciona intestinalis]
          Length = 236

 Score =  247 bits (631), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%)

Query: 9   KIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVE 68
           K I  + +  L+ + ++ SR+ +  +   ++ T +D LV + RT SL  MTFGLACCAVE
Sbjct: 37  KKIETEPAQVLQPIRSEISRLKNADSRGEYIATRIDDLVNYVRTNSLWPMTFGLACCAVE 96

Query: 69  MMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGS 128
           MM  + PRYD++RFG   RASPRQSD+MIVAGTLTNKMA ALRRVYDQM +P++V+SMGS
Sbjct: 97  MMHFAAPRYDMDRFGVVFRASPRQSDLMIVAGTLTNKMAPALRRVYDQMADPKWVLSMGS 156

Query: 129 CANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           CANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQKK+RR
Sbjct: 157 CANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVLQLQKKVRR 207


>gi|158455101|gb|AAI53838.1| NDUFS7 protein [Bos taurus]
          Length = 179

 Score =  247 bits (631), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 28  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 87

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 88  VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 147

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R   ++
Sbjct: 148 GCPPTAEALLYGILQLQKKIKREKRLR 174


>gi|88608136|ref|YP_506317.1| NADH dehydrogenase I, B subunit [Neorickettsia sennetsu str.
           Miyayama]
 gi|123491986|sp|Q2GDX9|NUOB_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|88600305|gb|ABD45773.1| NADH dehydrogenase I, B subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 167

 Score =  247 bits (631), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (84%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           S ++  G+LV  +D L+ WAR+GSL  MTFGLACCAVEMM  +  RYD++RFG   R SP
Sbjct: 12  SNVSSDGYLVAKLDDLINWARSGSLWPMTFGLACCAVEMMHFTASRYDMDRFGMIFRPSP 71

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMIVAGTLTNKMA ALRRVYDQM EP+YVISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 72  RQSDVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSCANGGGYYHYSYSVVRGCDRIV 131

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           PVD+YVPGCPPTAEAL+YG+L LQKKI R  N
Sbjct: 132 PVDVYVPGCPPTAEALLYGVLCLQKKINRQRN 163


>gi|52842986|ref|YP_096785.1| NADH dehydrogenase subunit B [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295617|ref|YP_128032.1| NADH dehydrogenase subunit B [Legionella pneumophila str. Lens]
 gi|54298771|ref|YP_125140.1| NADH dehydrogenase subunit B [Legionella pneumophila str. Paris]
 gi|296108431|ref|YP_003620132.1| NADH dehydrogenase I chain B [Legionella pneumophila 2300/99 Alcoy]
 gi|81376641|sp|Q5ZRT9|NUOB_LEGPH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81601171|sp|Q5WT21|NUOB_LEGPL RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81601638|sp|Q5X1A8|NUOB_LEGPA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|52630097|gb|AAU28838.1| NADH dehydrogenase I, B subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752556|emb|CAH13988.1| NADH dehydrogenase I chain B [Legionella pneumophila str. Paris]
 gi|53755449|emb|CAH16945.1| NADH dehydrogenase I chain B [Legionella pneumophila str. Lens]
 gi|295650333|gb|ADG26180.1| NADH dehydrogenase I chain B [Legionella pneumophila 2300/99 Alcoy]
          Length = 158

 Score =  247 bits (631), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/149 (77%), Positives = 130/149 (87%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           +E+  KGF +T+V++LV WAR+GS+  MTFGLACCAVEMM     RYDL+RFG   R SP
Sbjct: 4   AELEKKGFELTTVEKLVGWARSGSMWPMTFGLACCAVEMMHVGAARYDLDRFGIIFRPSP 63

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 64  RQSDVMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 123

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           PVD+YVPGCPPTAEAL+YGI+ LQ KIRR
Sbjct: 124 PVDVYVPGCPPTAEALLYGIIQLQNKIRR 152


>gi|301776330|ref|XP_002923562.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 240

 Score =  247 bits (630), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 89  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 148

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 149 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 208

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 209 GCPPTAEALLYGILQLQRKIKR 230


>gi|91205212|ref|YP_537567.1| NADH dehydrogenase subunit B [Rickettsia bellii RML369-C]
 gi|122425872|sp|Q1RJI6|NUOB_RICBR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|91068756|gb|ABE04478.1| NADH dehydrogenase I chain B [Rickettsia bellii RML369-C]
          Length = 174

 Score =  247 bits (630), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 112/156 (71%), Positives = 136/156 (87%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++E++++G L+T VD ++ WAR+ SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNNELSNRGVLLTKVDDVIGWARSNSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EP++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|119589914|gb|EAW69508.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase), isoform CRA_b [Homo
           sapiens]
          Length = 224

 Score =  247 bits (630), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 73  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 132

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 133 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 192

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 193 GCPPTAEALLYGILQLQRKIKR 214


>gi|319787442|ref|YP_004146917.1| NADH-quinone oxidoreductase subunit beta [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465954|gb|ADV27686.1| NADH-quinone oxidoreductase, B subunit [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 192

 Score =  247 bits (630), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/161 (74%), Positives = 132/161 (81%), Gaps = 2/161 (1%)

Query: 25  DFSRISSE--ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           D  R + E  +  KG++ TSVD LV WARTGS+  MTFGLACCAVEMM A   R DL+R+
Sbjct: 22  DILRPAGENPLLEKGYVTTSVDALVNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRY 81

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   R SPRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSV
Sbjct: 82  GVVFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSV 141

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI R   V
Sbjct: 142 VRGCDRIVPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTV 182


>gi|270158113|ref|ZP_06186770.1| NADH-quinone oxidoreductase B subunit [Legionella longbeachae
           D-4968]
 gi|289163622|ref|YP_003453760.1| NADH dehydrogenase I chain B [Legionella longbeachae NSW150]
 gi|269990138|gb|EEZ96392.1| NADH-quinone oxidoreductase B subunit [Legionella longbeachae
           D-4968]
 gi|288856795|emb|CBJ10606.1| NADH dehydrogenase I chain B [Legionella longbeachae NSW150]
          Length = 158

 Score =  247 bits (630), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (86%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           +E+   GF+ TSV++LV WAR+GS+  MTFGLACCAVEMM A   RYDL+RFG   R SP
Sbjct: 4   AELQKSGFVTTSVEKLVGWARSGSMWPMTFGLACCAVEMMHAGAARYDLDRFGIIFRPSP 63

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 64  RQSDVMIVAGTLCNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIV 123

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           PVD+YVPGCPPTAEAL+YGI+ LQ KIR 
Sbjct: 124 PVDVYVPGCPPTAEALLYGIIQLQNKIRH 152


>gi|159031992|ref|NP_001103713.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Pan troglodytes]
 gi|115502489|sp|Q0MQI0|NDUS7_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|111661826|gb|ABH12163.1| mitochondrial complex I subunit NDUFS7 [Pan troglodytes]
          Length = 213

 Score =  246 bits (629), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 182 GCPPTAEALLYGILQLQRKIKR 203


>gi|187929292|ref|YP_001899779.1| NADH dehydrogenase subunit B [Ralstonia pickettii 12J]
 gi|241663483|ref|YP_002981843.1| NADH dehydrogenase subunit B [Ralstonia pickettii 12D]
 gi|309781853|ref|ZP_07676586.1| NADH dehydrogenase (ubiquinone), B subunit [Ralstonia sp.
           5_7_47FAA]
 gi|218528007|sp|B2U7R0|NUOB_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|187726182|gb|ACD27347.1| NADH-quinone oxidoreductase, B subunit [Ralstonia pickettii 12J]
 gi|240865510|gb|ACS63171.1| NADH-quinone oxidoreductase, B subunit [Ralstonia pickettii 12D]
 gi|308919494|gb|EFP65158.1| NADH dehydrogenase (ubiquinone), B subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 160

 Score =  246 bits (629), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALIYGIIQLQAKIRRTNTI 156


>gi|82702221|ref|YP_411787.1| NADH dehydrogenase subunit B [Nitrosospira multiformis ATCC 25196]
 gi|123544732|sp|Q2YA26|NUOB2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|82410286|gb|ABB74395.1| NADH dehydrogenase subunit B [Nitrosospira multiformis ATCC 25196]
          Length = 158

 Score =  246 bits (629), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           ++ +  KGF+ TS+D ++ W RTGS+  MTFGLACCAVEMMQA   RYDL+RFG   R S
Sbjct: 3   TNGVMEKGFVTTSLDSVINWGRTGSMWPMTFGLACCAVEMMQAGASRYDLDRFGIVFRPS 62

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 63  PRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGI+ LQ KI R   +
Sbjct: 123 VPVDIYVPGCPPTAEALLYGIIQLQNKIHRTNTI 156


>gi|256821516|ref|YP_003145479.1| NADH-quinone oxidoreductase subunit B [Kangiella koreensis DSM
           16069]
 gi|256795055|gb|ACV25711.1| NADH-quinone oxidoreductase, B subunit [Kangiella koreensis DSM
           16069]
          Length = 186

 Score =  246 bits (629), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (84%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +  ++   GF+ TS+  L  WARTGS+  +TFGLACCA+EMM A   RYD++RFG   R 
Sbjct: 3   LEQQLQGDGFVTTSIKDLFDWARTGSMWPVTFGLACCAIEMMHAGAARYDMDRFGVIFRP 62

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTLTNKMA ALRRVYDQMPEP++VISMGSCANGGGYYHYSYSVVRGCDR
Sbjct: 63  SPRQSDVMIVAGTLTNKMAPALRRVYDQMPEPKWVISMGSCANGGGYYHYSYSVVRGCDR 122

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           IVPVDIYVPGCPPTAEAL+YGI+ LQ KIRR
Sbjct: 123 IVPVDIYVPGCPPTAEALLYGIIQLQNKIRR 153


>gi|13543603|gb|AAH05954.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase) [Homo sapiens]
 gi|84105526|gb|AAI11518.1| NDUFS7 protein [Homo sapiens]
 gi|325464357|gb|ADZ15949.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase) [synthetic construct]
          Length = 213

 Score =  246 bits (629), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 182 GCPPTAEALLYGILQLQRKIKR 203


>gi|115502488|sp|Q0MQH9|NDUS7_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|269969394|sp|P0CB84|NDUS7_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|111661828|gb|ABH12164.1| mitochondrial complex I subunit NDUFS7 [Gorilla gorilla]
 gi|111661830|gb|ABH12165.1| mitochondrial complex I subunit NDUFS7 [Pongo pygmaeus]
          Length = 213

 Score =  246 bits (628), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 182 GCPPTAEALLYGILQLQRKIKR 203


>gi|187281616|ref|NP_077718.3| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Homo sapiens]
 gi|90110040|sp|O75251|NDUS7_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; AltName: Full=PSST
           subunit; Flags: Precursor
 gi|33150724|gb|AAP97240.1|AF115969_1 NADH:ubiquinone oxidoreductase PSST subunit [Homo sapiens]
 gi|62897035|dbj|BAD96458.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 variant [Homo
           sapiens]
          Length = 213

 Score =  246 bits (628), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 182 GCPPTAEALLYGILQLQRKIKR 203


>gi|17546780|ref|NP_520182.1| NADH dehydrogenase subunit B [Ralstonia solanacearum GMI1000]
 gi|83746298|ref|ZP_00943351.1| NADH-quinone oxidoreductase chain B [Ralstonia solanacearum UW551]
 gi|207723874|ref|YP_002254272.1| nadh dehydrogenaseI(chain b) protein [Ralstonia solanacearum MolK2]
 gi|207742736|ref|YP_002259128.1| nadh dehydrogenaseI(chain b) protein [Ralstonia solanacearum
           IPO1609]
 gi|81504305|sp|Q8XXQ2|NUOB_RALSO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|17429080|emb|CAD15768.1| probable nadh dehydrogenaseI(chain b) oxidoreductase protein
           [Ralstonia solanacearum GMI1000]
 gi|83727048|gb|EAP74173.1| NADH-quinone oxidoreductase chain B [Ralstonia solanacearum UW551]
 gi|206589079|emb|CAQ36041.1| nadh dehydrogenaseI(chain b) protein [Ralstonia solanacearum MolK2]
 gi|206594130|emb|CAQ61057.1| nadh dehydrogenaseI(chain b) protein [Ralstonia solanacearum
           IPO1609]
 gi|299066334|emb|CBJ37518.1| NADH-quinone oxidoreductase subunit B [Ralstonia solanacearum
           CMR15]
          Length = 160

 Score =  246 bits (628), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALIYGIIQLQAKIRRTNTI 156


>gi|119589913|gb|EAW69507.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa
           (NADH-coenzyme Q reductase), isoform CRA_a [Homo
           sapiens]
          Length = 298

 Score =  246 bits (628), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 147 YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 206

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 207 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 266

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 267 GCPPTAEALLYGILQLQRKIKR 288


>gi|11466535|ref|NP_044784.1| NADH dehydrogenase subunit 10 [Reclinomonas americana]
 gi|6647649|sp|O21272|NDUS7_RECAM RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa subunit;
           AltName: Full=NADH dehydrogenase subunit 10
 gi|2258365|gb|AAD11899.1| NADH dehydrogenase subunit 10 [Reclinomonas americana]
          Length = 182

 Score =  246 bits (628), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 132/154 (85%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F  ++++     F+V+ +D+LV WAR GSL  MTFGLACCAVEMM ++  RYDL+RFG  
Sbjct: 19  FMILNNKQNKTEFIVSKMDELVNWARKGSLWPMTFGLACCAVEMMHSAASRYDLDRFGII 78

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            R SPRQSDVMIVAGTLTNKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRG
Sbjct: 79  FRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMSEPRWVVSMGSCANGGGYYHYSYSVVRG 138

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           CDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI+R
Sbjct: 139 CDRIVPVDIYVPGCPPTAEALLYGLLQLQKKIKR 172


>gi|197097452|ref|NP_001126953.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial precursor [Pongo abelii]
 gi|269969393|sp|P0CB83|NDUS7_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|55733271|emb|CAH93318.1| hypothetical protein [Pongo abelii]
          Length = 213

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 182 GCPPTAEALLYGILQLQRKIKR 203


>gi|34189943|gb|AAH01715.2| NDUFS7 protein [Homo sapiens]
          Length = 208

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 57  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 116

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 117 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 176

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 177 GCPPTAEALLYGILQLQRKIKR 198


>gi|254796791|ref|YP_003081628.1| NADH-quinone oxidoreductase chain b [Neorickettsia risticii str.
           Illinois]
 gi|254590025|gb|ACT69387.1| NADH-quinone oxidoreductase chain b [Neorickettsia risticii str.
           Illinois]
          Length = 167

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/159 (74%), Positives = 131/159 (82%), Gaps = 2/159 (1%)

Query: 26  FSRIS--SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           FS I+  S +   G+LV  +D L+ WAR GSL  MTFGLACCAVEMM  +  RYD++RFG
Sbjct: 5   FSDINALSNVGSDGYLVAKLDDLINWARAGSLWPMTFGLACCAVEMMHFTASRYDMDRFG 64

Query: 84  FAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
              R SPRQSDVMIVAGTLTNKMA ALRRVYDQM EP+YVISMGSCANGGGYYHYSYSVV
Sbjct: 65  MIFRPSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSCANGGGYYHYSYSVV 124

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           RGCDRIVPVD+YVPGCPPTAEAL+YG+L LQKKI R  N
Sbjct: 125 RGCDRIVPVDVYVPGCPPTAEALLYGVLCLQKKINRQRN 163


>gi|300691026|ref|YP_003752021.1| NADH-quinone oxidoreductase subunit B [Ralstonia solanacearum
           PSI07]
 gi|299078086|emb|CBJ50729.1| NADH-quinone oxidoreductase subunit B [Ralstonia solanacearum
           PSI07]
          Length = 160

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALIYGIIQLQAKIRRTNTI 156


>gi|292493667|ref|YP_003529106.1| NADH-quinone oxidoreductase subunit beta [Nitrosococcus halophilus
           Nc4]
 gi|291582262|gb|ADE16719.1| NADH-quinone oxidoreductase, B subunit [Nitrosococcus halophilus
           Nc4]
          Length = 158

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/147 (78%), Positives = 127/147 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +G + T+ D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLERGVVTTTADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           DIYVPGCPPTAEAL+YGI+ LQKKIRR
Sbjct: 126 DIYVPGCPPTAEALLYGIIQLQKKIRR 152


>gi|254247658|ref|ZP_04940979.1| NADH dehydrogenase beta subunit [Burkholderia cenocepacia PC184]
 gi|124872434|gb|EAY64150.1| NADH dehydrogenase beta subunit [Burkholderia cenocepacia PC184]
          Length = 173

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 170


>gi|110225660|ref|YP_665666.1| NADH dehydrogenase subunit 10 [Nephroselmis olivacea]
 gi|6066175|gb|AAF03193.1|AF110138_25 NADH dehydrogenase subunit 10 [Nephroselmis olivacea]
          Length = 158

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL+T +D L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSDVMI
Sbjct: 7   FLLTGIDSLLNWARKGSMWPMTFGLACCAVEMMHCGASRYDLDRFGIIFRPSPRQSDVMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 67  VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 126

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL+YG+L LQKKI+R  N
Sbjct: 127 GCPPTAEALLYGLLQLQKKIQRTNN 151


>gi|148244390|ref|YP_001219084.1| NADH dehydrogenase I chain B [Candidatus Vesicomyosocius okutanii
           HA]
 gi|218528012|sp|A5CXF8|NUOB_VESOH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146326217|dbj|BAF61360.1| NADH dehydrogenase I chain B [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 159

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+  S+D+++ WARTGSL  MTFGLACCAVEMM+A   RYDL+RFG   R +PRQ
Sbjct: 6   LIKQGFVTMSLDRVINWARTGSLWPMTFGLACCAVEMMEAGSSRYDLDRFGIVFRPTPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALR+VYDQMPEP++VISMGSCANGGGYYHYSY+V+RGCDRIVPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRKVYDQMPEPKWVISMGSCANGGGYYHYSYAVIRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALLYGIMQLQDKIRRTNTI 156


>gi|74317161|ref|YP_314901.1| NADH dehydrogenase subunit B [Thiobacillus denitrificans ATCC
           25259]
 gi|123611053|sp|Q3SEX7|NUOB_THIDA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|74056656|gb|AAZ97096.1| NADH dehydrogenase I chain B [Thiobacillus denitrificans ATCC
           25259]
          Length = 158

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/151 (76%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T  DQL+ + RTGS+  MTFGLACCAVEMMQA   RYDL+RFG   R SPRQ
Sbjct: 6   VLEQGFVTTKADQLINYMRTGSMWPMTFGLACCAVEMMQAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALI+GI+ LQKKIRR   +
Sbjct: 126 DIYVPGCPPTAEALIFGIIQLQKKIRRTNTI 156


>gi|312796901|ref|YP_004029823.1| NADH-quinone oxidoreductase chain B [Burkholderia rhizoxinica HKI
           454]
 gi|312168676|emb|CBW75679.1| NADH-quinone oxidoreductase chain B (EC 1.6.5.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 173

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 170


>gi|206560702|ref|YP_002231467.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia J2315]
 gi|198036744|emb|CAR52644.1| NADH dehydrogenase I chain B [Burkholderia cenocepacia J2315]
          Length = 173

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 170


>gi|254251862|ref|ZP_04945180.1| NADH dehydrogenase beta subunit [Burkholderia dolosa AUO158]
 gi|124894471|gb|EAY68351.1| NADH dehydrogenase beta subunit [Burkholderia dolosa AUO158]
          Length = 173

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 170


>gi|157825617|ref|YP_001493337.1| NADH dehydrogenase subunit B [Rickettsia akari str. Hartford]
 gi|218528016|sp|A8GN54|NUOB_RICAH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|157799575|gb|ABV74829.1| NADH dehydrogenase subunit B [Rickettsia akari str. Hartford]
          Length = 174

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/156 (71%), Positives = 135/156 (86%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +++EI+++GFL+T +D ++ WAR  SL  MTFGLACCAVEMMQA+  RYD++RFG   R 
Sbjct: 12  LNNEISNRGFLLTKIDDIIGWARAHSLWPMTFGLACCAVEMMQAASSRYDMDRFGMLFRP 71

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM  P++V+SMGSCANGGGYYH+SYSVVRGCDR
Sbjct: 72  SPRQSDLMIVAGTLTNKMAPALRKVYDQMAVPKWVLSMGSCANGGGYYHFSYSVVRGCDR 131

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IVPVD+YVPGCPPTAEALIYG++ LQKKI+R    K
Sbjct: 132 IVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFK 167


>gi|30249736|ref|NP_841806.1| NADH dehydrogenase subunit B [Nitrosomonas europaea ATCC 19718]
 gi|75540322|sp|Q82TU4|NUOB_NITEU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|30180773|emb|CAD85687.1| Respiratory-chain NADH dehydrogenase 20 Kd subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 158

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS+D L+ W RTGS+  MTFGLACCAVEMMQ    RYDL+RFG   R SPRQ
Sbjct: 6   VLDKGFVTTSLDSLINWGRTGSMWPMTFGLACCAVEMMQTGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DIYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|300703643|ref|YP_003745245.1| NADH-quinone oxidoreductase subunit B [Ralstonia solanacearum
           CFBP2957]
 gi|299071306|emb|CBJ42624.1| NADH-quinone oxidoreductase subunit B [Ralstonia solanacearum
           CFBP2957]
          Length = 160

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALIYGVIQLQAKIRRTNTI 156


>gi|121598483|ref|YP_992470.1| NADH dehydrogenase subunit B [Burkholderia mallei SAVP1]
 gi|124385700|ref|YP_001026727.1| NADH dehydrogenase subunit B [Burkholderia mallei NCTC 10229]
 gi|126439724|ref|YP_001058339.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 668]
 gi|126450627|ref|YP_001079988.1| NADH dehydrogenase subunit B [Burkholderia mallei NCTC 10247]
 gi|126451839|ref|YP_001065578.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 1106a]
 gi|167562178|ref|ZP_02355094.1| NADH dehydrogenase subunit B [Burkholderia oklahomensis EO147]
 gi|167569423|ref|ZP_02362297.1| NADH dehydrogenase subunit B [Burkholderia oklahomensis C6786]
 gi|167580423|ref|ZP_02373297.1| NADH dehydrogenase subunit B [Burkholderia thailandensis TXDOH]
 gi|167618532|ref|ZP_02387163.1| NADH dehydrogenase subunit B [Burkholderia thailandensis Bt4]
 gi|167718844|ref|ZP_02402080.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei DM98]
 gi|167737853|ref|ZP_02410627.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 14]
 gi|167815037|ref|ZP_02446717.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 91]
 gi|167823453|ref|ZP_02454924.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 9]
 gi|167836050|ref|ZP_02462933.1| NADH dehydrogenase subunit B [Burkholderia thailandensis MSMB43]
 gi|167845005|ref|ZP_02470513.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei B7210]
 gi|167893546|ref|ZP_02480948.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 7894]
 gi|167901992|ref|ZP_02489197.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei NCTC 13177]
 gi|167910228|ref|ZP_02497319.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 112]
 gi|167918261|ref|ZP_02505352.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei BCC215]
 gi|254175674|ref|ZP_04882334.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           10399]
 gi|254181186|ref|ZP_04887783.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1655]
 gi|254190549|ref|ZP_04897056.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195108|ref|ZP_04901537.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           S13]
 gi|254202109|ref|ZP_04908472.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei FMH]
 gi|254258086|ref|ZP_04949140.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1710a]
 gi|254298534|ref|ZP_04965986.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           406e]
 gi|254359861|ref|ZP_04976131.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei
           2002721280]
 gi|257139689|ref|ZP_05587951.1| NADH dehydrogenase subunit B [Burkholderia thailandensis E264]
 gi|218527942|sp|A3MIA2|NUOB1_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218527943|sp|A2S458|NUOB1_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218527965|sp|A1V2L7|NUOB1_BURMS RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218527966|sp|A3NTA7|NUOB1_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218527967|sp|A3N7L8|NUOB1_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218528060|sp|Q62IN6|NUOB1_BURMA RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218528063|sp|Q2SZN4|NUOB_BURTA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528080|sp|Q63VN2|NUOB1_BURPS RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|218528081|sp|Q3JUA8|NUOB1_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|121227293|gb|ABM49811.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei SAVP1]
 gi|124293720|gb|ABN02989.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10229]
 gi|126219217|gb|ABN82723.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           668]
 gi|126225481|gb|ABN89021.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1106a]
 gi|126243497|gb|ABO06590.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10247]
 gi|147746356|gb|EDK53433.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei FMH]
 gi|148029101|gb|EDK87006.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei
           2002721280]
 gi|157808426|gb|EDO85596.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           406e]
 gi|157938224|gb|EDO93894.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696718|gb|EDP86688.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           10399]
 gi|169651856|gb|EDS84549.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           S13]
 gi|184211724|gb|EDU08767.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1655]
 gi|254216775|gb|EET06159.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1710a]
          Length = 159

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALVYGVIQLQAKIRRTSTI 156


>gi|73540665|ref|YP_295185.1| NADH dehydrogenase subunit B [Ralstonia eutropha JMP134]
 gi|123625484|sp|Q473U2|NUOB_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|72118078|gb|AAZ60341.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Ralstonia eutropha
           JMP134]
          Length = 160

 Score =  246 bits (627), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYG++ LQ KI+R   +
Sbjct: 126 DIYVPGCPPTAEALIYGVIQLQNKIKRTNTI 156


>gi|189351038|ref|YP_001946666.1| NADH dehydrogenase subunit B [Burkholderia multivorans ATCC 17616]
 gi|189335060|dbj|BAG44130.1| NADH dehydrogenase I chain B [Burkholderia multivorans ATCC 17616]
          Length = 173

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 170


>gi|118602276|ref|YP_903491.1| NADH-quinone oxidoreductase, B subunit [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|218528022|sp|A1AVR3|NUOB_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|118567215|gb|ABL02020.1| NADH dehydrogenase subunit B [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 159

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 130/151 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS++ ++ WARTGSL  MTFGLACCAVEMM+A   RYDL+RFG   R +PRQ
Sbjct: 6   LMKQGFVTTSLNNVINWARTGSLWPMTFGLACCAVEMMEAGSSRYDLDRFGIVFRPTPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YGI+ LQ KIR    +
Sbjct: 126 DIYVPGCPPTAEALLYGIIQLQDKIRSTNTI 156


>gi|78067045|ref|YP_369814.1| NADH dehydrogenase subunit B [Burkholderia sp. 383]
 gi|107023187|ref|YP_621514.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia AU 1054]
 gi|115352337|ref|YP_774176.1| NADH dehydrogenase subunit B [Burkholderia ambifaria AMMD]
 gi|116690269|ref|YP_835892.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia HI2424]
 gi|134296432|ref|YP_001120167.1| NADH dehydrogenase subunit B [Burkholderia vietnamiensis G4]
 gi|161524205|ref|YP_001579217.1| NADH dehydrogenase subunit B [Burkholderia multivorans ATCC 17616]
 gi|167585972|ref|ZP_02378360.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ubonensis Bu]
 gi|170698110|ref|ZP_02889190.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ambifaria
           IOP40-10]
 gi|170733608|ref|YP_001765555.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia MC0-3]
 gi|171316304|ref|ZP_02905525.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ambifaria
           MEX-5]
 gi|172061208|ref|YP_001808860.1| NADH dehydrogenase subunit B [Burkholderia ambifaria MC40-6]
 gi|221211736|ref|ZP_03584715.1| NADH-quinone oxidoreductase subunit b (nadh dehydrogenase i subunit
           b) (ndh-1 subunit b) [Burkholderia multivorans CGD1]
 gi|122322642|sp|Q0BDD1|NUOB_BURCM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|123244856|sp|Q1BV14|NUOB_BURCA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|123568005|sp|Q39EE6|NUOB_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527979|sp|B1YTQ6|NUOB_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527980|sp|B1JVP0|NUOB_BURCC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527981|sp|A0K922|NUOB_BURCH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527982|sp|A4JGC9|NUOB_BURVG RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528023|sp|A9AFY8|NUOB_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528071|sp|B4E5M1|NUOB_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|77967790|gb|ABB09170.1| NADH dehydrogenase subunit B [Burkholderia sp. 383]
 gi|105893376|gb|ABF76541.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia AU 1054]
 gi|115282325|gb|ABI87842.1| NADH dehydrogenase subunit B [Burkholderia ambifaria AMMD]
 gi|116648358|gb|ABK08999.1| NADH dehydrogenase subunit B [Burkholderia cenocepacia HI2424]
 gi|134139589|gb|ABO55332.1| NADH dehydrogenase subunit B [Burkholderia vietnamiensis G4]
 gi|160341634|gb|ABX14720.1| NADH-quinone oxidoreductase, B subunit [Burkholderia multivorans
           ATCC 17616]
 gi|169816850|gb|ACA91433.1| NADH-quinone oxidoreductase, B subunit [Burkholderia cenocepacia
           MC0-3]
 gi|170136968|gb|EDT05216.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ambifaria
           IOP40-10]
 gi|171098530|gb|EDT43331.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ambifaria
           MEX-5]
 gi|171993725|gb|ACB64644.1| NADH-quinone oxidoreductase, B subunit [Burkholderia ambifaria
           MC40-6]
 gi|221169097|gb|EEE01565.1| NADH-quinone oxidoreductase subunit b (nadh dehydrogenase i subunit
           b) (ndh-1 subunit b) [Burkholderia multivorans CGD1]
 gi|325520398|gb|EGC99516.1| NADH dehydrogenase subunit B [Burkholderia sp. TJI49]
          Length = 159

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 156


>gi|53718848|ref|YP_107834.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei K96243]
 gi|53725818|ref|YP_103433.1| NADH dehydrogenase subunit B [Burkholderia mallei ATCC 23344]
 gi|76808565|ref|YP_332845.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 1710b]
 gi|83720537|ref|YP_441615.1| NADH dehydrogenase subunit B [Burkholderia thailandensis E264]
 gi|134283897|ref|ZP_01770593.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           305]
 gi|251767151|ref|ZP_02266185.2| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei PRL-20]
 gi|254207439|ref|ZP_04913789.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei JHU]
 gi|52209262|emb|CAH35207.1| NADH dehydrogenase I chain B [Burkholderia pseudomallei K96243]
 gi|52429241|gb|AAU49834.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           23344]
 gi|76578018|gb|ABA47493.1| NADH dehydrogenase I chain B [Burkholderia pseudomallei 1710b]
 gi|83654362|gb|ABC38425.1| NADH-quinone oxidoreductase, B subunit [Burkholderia thailandensis
           E264]
 gi|134244686|gb|EBA44784.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           305]
 gi|147751333|gb|EDK58400.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei JHU]
 gi|243063701|gb|EES45887.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei PRL-20]
          Length = 173

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 20  VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 80  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 139

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 140 DVYVPGCPPTAEALVYGVIQLQAKIRRTSTI 170


>gi|307168025|gb|EFN61349.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial [Camponotus floridanus]
          Length = 222

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/147 (75%), Positives = 129/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  VD L+ W R GS+  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDV+I
Sbjct: 71  YALARVDDLLNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVII 130

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 131 VAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 190

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R+ +++
Sbjct: 191 GCPPTAEALLYGILQLQKKIKRMQSIQ 217


>gi|28198172|ref|NP_778486.1| NADH dehydrogenase subunit B [Xylella fastidiosa Temecula1]
 gi|28056242|gb|AAO28135.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xylella fastidiosa
           Temecula1]
          Length = 191

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 36  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 95

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 96  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 155

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 156 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTKTI 189


>gi|168032288|ref|XP_001768651.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680150|gb|EDQ66589.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 201

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 5/159 (3%)

Query: 30  SSEITHKG-----FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +S  T KG     F+++ VD L+ WARTGS+  MTFGLACCAVEMM     RYDL+RFG 
Sbjct: 37  TSSTTSKGGPGAEFVLSKVDALMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGI 96

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             R SPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVR
Sbjct: 97  IFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVR 156

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           GCDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI R  +V
Sbjct: 157 GCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRKDV 195


>gi|11466592|ref|NP_066482.1| NADH dehydrogenase subunit 10 [Rhodomonas salina]
 gi|10444179|gb|AAG17753.1|AF288090_29 NADH dehydrogenase subunit 10 [Rhodomonas salina]
          Length = 158

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ +D L+ WAR GSL  MTFGLACCAVEMM A   RYD +RFG   RASPRQSD+MI
Sbjct: 7   FVISKIDDLLNWARRGSLWPMTFGLACCAVEMMHAGASRYDFDRFGIIFRASPRQSDIMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYH+SYSVVRGCD+IVPVD++VP
Sbjct: 67  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHFSYSVVRGCDKIVPVDVFVP 126

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R   V+
Sbjct: 127 GCPPTAEALLYGILQLQKKIKRTKTVQ 153


>gi|66809217|ref|XP_638331.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Dictyostelium
           discoideum AX4]
 gi|74853922|sp|Q54NI6|NDUS7_DICDI RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; Flags: Precursor
 gi|60466783|gb|EAL64831.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Dictyostelium
           discoideum AX4]
          Length = 178

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 133/165 (80%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           L K+ A   + +   T    +++ +D LV WARTGSL  MTFGLACCAVEMMQ    RYD
Sbjct: 8   LSKLLASSFKQAPPNTLPEVVISKIDGLVNWARTGSLWPMTFGLACCAVEMMQGYAARYD 67

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           ++RFG  PRASPRQSD +IVAGTLTNKMA ALR+VYDQMP PRYV+SMGSCANGGGYYHY
Sbjct: 68  MDRFGVIPRASPRQSDCIIVAGTLTNKMAPALRKVYDQMPNPRYVVSMGSCANGGGYYHY 127

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           SYSVVRGCDRI+PVD+Y+PGCPPTAEA +YGIL LQKKI R  N+
Sbjct: 128 SYSVVRGCDRIIPVDVYIPGCPPTAEAFVYGILQLQKKIGREQNL 172


>gi|182680806|ref|YP_001828966.1| NADH dehydrogenase subunit B [Xylella fastidiosa M23]
 gi|238065246|sp|B2I785|NUOB_XYLF2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065259|sp|Q87EQ4|NUOB_XYLFT RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|182630916|gb|ACB91692.1| NADH-quinone oxidoreductase, B subunit [Xylella fastidiosa M23]
 gi|307579274|gb|ADN63243.1| NADH dehydrogenase subunit B [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 184

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTKTI 182


>gi|326433088|gb|EGD78658.1| NDUFS7 protein [Salpingoeca sp. ATCC 50818]
          Length = 214

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D LV WAR  S+  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 63  YALAKLDDLVNWARKSSMWPMTFGLACCAVEMMHVAAPRYDMDRFGIVFRASPRQSDVMI 122

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 123 VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 182

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI+R
Sbjct: 183 GCPPTAEALLYGLLQLQKKIKR 204


>gi|15836909|ref|NP_297597.1| NADH dehydrogenase subunit B [Xylella fastidiosa 9a5c]
 gi|9105129|gb|AAF83117.1|AE003884_2 NADH-ubiquinone oxidoreductase, NQO6 subunit [Xylella fastidiosa
           9a5c]
          Length = 191

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/150 (76%), Positives = 128/150 (85%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 36  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 95

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 96  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 155

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R
Sbjct: 156 VPVDVYVPGCPPTAEALVYGILQLQKKIWR 185


>gi|288942133|ref|YP_003444373.1| NADH-quinone oxidoreductase subunit B [Allochromatium vinosum DSM
           180]
 gi|288897505|gb|ADC63341.1| NADH-quinone oxidoreductase, B subunit [Allochromatium vinosum DSM
           180]
          Length = 158

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +G + T+ D+L+ WARTGSL  MTFGLACCA+EMM A   RYDL+RFG   R SPRQ
Sbjct: 6   LLEEGVVTTTADKLINWARTGSLWPMTFGLACCAIEMMHAGAARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGIL LQ+KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGILQLQEKIRRTNTI 156


>gi|152980178|ref|YP_001353153.1| NADH dehydrogenase I chain B [Janthinobacterium sp. Marseille]
 gi|218527992|sp|A6SY06|NUOB_JANMA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|151280255|gb|ABR88665.1| NADH dehydrogenase I chain B [Janthinobacterium sp. Marseille]
          Length = 158

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGS+  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSMWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIMQLQNKIRRTNTI 156


>gi|15239782|ref|NP_196738.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           [Arabidopsis thaliana]
 gi|2499327|sp|Q42577|NDUS7_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa subunit,
           mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; Flags: Precursor
 gi|16226316|gb|AAL16132.1|AF428300_1 AT5g11770/T22P22_160 [Arabidopsis thaliana]
 gi|643090|emb|CAA58887.1| NADH dehydrogenase [Arabidopsis thaliana]
 gi|7573391|emb|CAB87695.1| NADH dehydrogenase (ubiquinone) [Arabidopsis thaliana]
 gi|15810287|gb|AAL07031.1| putative NADH dehydrogenase (ubiquinone) [Arabidopsis thaliana]
 gi|20466764|gb|AAM20699.1| NADH dehydrogenase / ubiquinone [Arabidopsis thaliana]
 gi|21537333|gb|AAM61674.1| NADH dehydrogenase ubiquinone [Arabidopsis thaliana]
 gi|22136468|gb|AAM91312.1| NADH dehydrogenase / ubiquinone [Arabidopsis thaliana]
 gi|332004336|gb|AED91719.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Arabidopsis
           thaliana]
          Length = 218

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WARTGS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 67  FVISKVDDLMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 186

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 187 GCPPTAEALLYGLLQLQKKINR 208


>gi|218528068|sp|Q9PGJ4|NUOB_XYLFA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 184

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/150 (76%), Positives = 128/150 (85%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWR 178


>gi|71275689|ref|ZP_00651974.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Dixon]
 gi|71897855|ref|ZP_00680081.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Ann-1]
 gi|170729490|ref|YP_001774923.1| NADH dehydrogenase subunit B [Xylella fastidiosa M12]
 gi|254767800|sp|B0U1W6|NUOB_XYLFM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|71163580|gb|EAO13297.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Dixon]
 gi|71732410|gb|EAO34464.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Ann-1]
 gi|167964283|gb|ACA11293.1| NADH dehydrogenase [Xylella fastidiosa M12]
          Length = 184

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|226372670|gb|ACO51960.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Rana catesbeiana]
          Length = 217

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 3/172 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGL 62
           T  N+  IS  +S   +K  A  +  SS  + KG F+VT +D LV WAR  SL  MTFGL
Sbjct: 33  TADNENSIS--ASLVRQKSSAVPATKSSVPSGKGEFIVTKLDDLVNWARRSSLWPMTFGL 90

Query: 63  ACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRY 122
           ACCAVEMM  + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRY
Sbjct: 91  ACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRY 150

Query: 123 VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQ 174
           V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ
Sbjct: 151 VVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQ 202


>gi|71897767|ref|ZP_00679993.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Ann-1]
 gi|71732322|gb|EAO34376.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Xylella fastidiosa
           Ann-1]
          Length = 184

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            S +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ESPLLQKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|71906589|ref|YP_284176.1| NADH dehydrogenase subunit B [Dechloromonas aromatica RCB]
 gi|123627979|sp|Q47HH5|NUOB_DECAR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|71846210|gb|AAZ45706.1| NADH dehydrogenase subunit B [Dechloromonas aromatica RCB]
          Length = 158

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ + RTGSL  MTFGLACCAVEM+ A + RYDL+RFG   R SPRQ
Sbjct: 6   VLQEGFVTTTADKLINYMRTGSLWPMTFGLACCAVEMIHAGVSRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTLTNKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLTNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYGI+ LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALIYGIIQLQNKIRRTNTI 156


>gi|221199657|ref|ZP_03572701.1| NADH-quinone oxidoreductase, B subunit [Burkholderia multivorans
           CGD2M]
 gi|221205443|ref|ZP_03578458.1| NADH-quinone oxidoreductase, B subunit [Burkholderia multivorans
           CGD2]
 gi|221174281|gb|EEE06713.1| NADH-quinone oxidoreductase, B subunit [Burkholderia multivorans
           CGD2]
 gi|221180942|gb|EEE13345.1| NADH-quinone oxidoreductase, B subunit [Burkholderia multivorans
           CGD2M]
          Length = 153

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQSDV
Sbjct: 3   EGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDV 62

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+Y
Sbjct: 63  MIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVY 122

Query: 156 VPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 123 VPGCPPTAEALVYGVIQLQAKIRRTNTI 150


>gi|224088884|ref|XP_002308574.1| predicted protein [Populus trichocarpa]
 gi|118481270|gb|ABK92582.1| unknown [Populus trichocarpa]
 gi|222854550|gb|EEE92097.1| predicted protein [Populus trichocarpa]
          Length = 213

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 122/172 (70%), Positives = 135/172 (78%), Gaps = 8/172 (4%)

Query: 16  SCSLEKVDADFSRI----SSEIT----HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           S S E   A ++R     SS +T       F+++ VD L+ WARTGS+  MTFGLACCAV
Sbjct: 32  SLSPEPTPAPYTRAPPPSSSSLTGLSKPAEFVISKVDSLMNWARTGSIWPMTFGLACCAV 91

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMM     RYDL+RFG   R SPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+VISMG
Sbjct: 92  EMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMG 151

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI R
Sbjct: 152 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKIHR 203


>gi|3342734|gb|AAC27669.1| NUKM_HUMAN, partial CDS [Homo sapiens]
          Length = 158

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 7   YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 67  VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 126

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQ+KI+R
Sbjct: 127 GCPPTAEALLYGILQLQRKIKR 148


>gi|91782613|ref|YP_557819.1| NADH dehydrogenase subunit B [Burkholderia xenovorans LB400]
 gi|170696398|ref|ZP_02887527.1| NADH-quinone oxidoreductase, B subunit [Burkholderia graminis
           C4D1M]
 gi|186476763|ref|YP_001858233.1| NADH dehydrogenase subunit B [Burkholderia phymatum STM815]
 gi|187923341|ref|YP_001894983.1| NADH dehydrogenase subunit B [Burkholderia phytofirmans PsJN]
 gi|209518514|ref|ZP_03267335.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. H160]
 gi|295676038|ref|YP_003604562.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. CCGE1002]
 gi|296160630|ref|ZP_06843445.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. Ch1-1]
 gi|307730339|ref|YP_003907563.1| NADH-quinone oxidoreductase subunit B [Burkholderia sp. CCGE1003]
 gi|323525437|ref|YP_004227590.1| NADH-quinone oxidoreductase subunit B [Burkholderia sp. CCGE1001]
 gi|123358972|sp|Q142H2|NUOB_BURXL RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528024|sp|B2JDM7|NUOB_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528025|sp|B2T2E8|NUOB_BURPP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|91686567|gb|ABE29767.1| NADH dehydrogenase subunit B [Burkholderia xenovorans LB400]
 gi|170138726|gb|EDT06925.1| NADH-quinone oxidoreductase, B subunit [Burkholderia graminis
           C4D1M]
 gi|184193222|gb|ACC71187.1| NADH-quinone oxidoreductase, B subunit [Burkholderia phymatum
           STM815]
 gi|187714535|gb|ACD15759.1| NADH-quinone oxidoreductase, B subunit [Burkholderia phytofirmans
           PsJN]
 gi|209501059|gb|EEA01094.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. H160]
 gi|295435881|gb|ADG15051.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. CCGE1002]
 gi|295889156|gb|EFG68959.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. Ch1-1]
 gi|307584874|gb|ADN58272.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. CCGE1003]
 gi|323382439|gb|ADX54530.1| NADH-quinone oxidoreductase, B subunit [Burkholderia sp. CCGE1001]
          Length = 159

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALVYGVIQLQAKIRRTNTI 156


>gi|67642191|ref|ZP_00440951.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Burkholderia mallei GB8 horse 4]
 gi|217420025|ref|ZP_03451531.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           576]
 gi|226195363|ref|ZP_03790952.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237811583|ref|YP_002896034.1| NADH-quinone oxidoreductase, b subunit [Burkholderia pseudomallei
           MSHR346]
 gi|242316907|ref|ZP_04815923.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1106b]
 gi|217397329|gb|EEC37345.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           576]
 gi|225932565|gb|EEH28563.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506251|gb|ACQ98569.1| NADH-quinone oxidoreductase, b subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238523287|gb|EEP86726.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Burkholderia mallei GB8 horse 4]
 gi|242140146|gb|EES26548.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1106b]
          Length = 153

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQSDV
Sbjct: 3   EGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDV 62

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+Y
Sbjct: 63  MIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVY 122

Query: 156 VPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 123 VPGCPPTAEALVYGVIQLQAKIRRTSTI 150


>gi|297811291|ref|XP_002873529.1| hypothetical protein ARALYDRAFT_488014 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319366|gb|EFH49788.1| hypothetical protein ARALYDRAFT_488014 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 211

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WARTGS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 67  FVISKVDDLMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 186

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 187 GCPPTAEALLYGLLQLQKKINR 208


>gi|88812975|ref|ZP_01128218.1| NADH dehydrogenase beta subunit [Nitrococcus mobilis Nb-231]
 gi|88789753|gb|EAR20877.1| NADH dehydrogenase beta subunit [Nitrococcus mobilis Nb-231]
          Length = 158

 Score =  244 bits (624), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +G + TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLERGVVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM +P++VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRRVYDQMADPKWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL++GI+ LQKKIRR   +
Sbjct: 126 DVYVPGCPPTAEALLFGIIQLQKKIRRTNTI 156


>gi|219130938|ref|XP_002185609.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217402949|gb|EEC42907.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 166

 Score =  244 bits (623), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + ++ VD LV WAR GSL  MTFGLACCAVEMM A+  RYD+ERFG   RASPRQSDVMI
Sbjct: 15  YAISRVDDLVNWARKGSLWPMTFGLACCAVEMMHAAASRYDMERFGMVFRASPRQSDVMI 74

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 75  VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 134

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+YG++ LQKK++
Sbjct: 135 GCPPTAEALLYGLIQLQKKVK 155


>gi|332023286|gb|EGI63540.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial [Acromyrmex echinatior]
          Length = 224

 Score =  244 bits (623), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 125/143 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +   D L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDV+I
Sbjct: 73  YALARADDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVII 132

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRR+YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 133 VAGTLTNKMAPALRRIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 192

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YG+L LQKKI+R+
Sbjct: 193 GCPPTAEALLYGVLQLQKKIKRM 215


>gi|225704208|gb|ACO07950.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Oncorhynchus mykiss]
          Length = 218

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 125/142 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASP Q+DVMI
Sbjct: 67  YVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPGQADVMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 186

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG L LQKKI+R
Sbjct: 187 GCPPTAEALLYGTLQLQKKIKR 208


>gi|331212725|ref|XP_003307632.1| NADH-ubiquinone oxidoreductase subunit [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309298035|gb|EFP74626.1| NADH-ubiquinone oxidoreductase subunit [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 261

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 128/143 (89%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++++D++V WAR GS+  MTFGLACCAVEMM  +  RYD +RFG   RASPRQSDVMI
Sbjct: 110 YVISTIDKIVNWARQGSIWPMTFGLACCAVEMMHMAAARYDQDRFGIIFRASPRQSDVMI 169

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 170 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 229

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YG+L LQ+K+RR 
Sbjct: 230 GCPPTAEALMYGLLQLQRKMRRT 252


>gi|323452394|gb|EGB08268.1| NADH dehydrogenase subunit 10 [Aureococcus anophagefferens]
          Length = 162

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 127/141 (90%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+VT VD+LV WAR GS+  MTFGLACCAVEMM ++  RYD+ERFG   RASPRQSDVMI
Sbjct: 11  FMVTKVDELVNWARKGSIWPMTFGLACCAVEMMHSATARYDMERFGMVFRASPRQSDVMI 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSY+VVRG DRIVPVDIYVP
Sbjct: 71  VAGTLTNKMAPALRKVYDQMPEPRWVLSMGSCANGGGYYHYSYAVVRGVDRIVPVDIYVP 130

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+YG++ LQKK++
Sbjct: 131 GCPPTAEALLYGLIQLQKKVK 151


>gi|94309873|ref|YP_583083.1| NADH dehydrogenase subunit B [Cupriavidus metallidurans CH34]
 gi|113867071|ref|YP_725560.1| NADH dehydrogenase subunit B [Ralstonia eutropha H16]
 gi|194289160|ref|YP_002005067.1| NADH dehydrogenase subunit b [Cupriavidus taiwanensis LMG 19424]
 gi|122947021|sp|Q0KCS9|NUOB_RALEH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527987|sp|B3R3W8|NUOB_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528006|sp|Q1LPW2|NUOB_RALME RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|93353725|gb|ABF07814.1| NADH dehydrogenase chain B [Cupriavidus metallidurans CH34]
 gi|113525847|emb|CAJ92192.1| NADH dehydrogenase chain B [Ralstonia eutropha H16]
 gi|193222995|emb|CAQ69000.1| NADH:ubiquinone oxidoreductase complex I, chain B [Cupriavidus
           taiwanensis LMG 19424]
          Length = 160

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDMDRFGVIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYG++ LQ KI+R   +
Sbjct: 126 DIYVPGCPPTAEALIYGVIQLQNKIKRTNTI 156


>gi|21243431|ref|NP_643013.1| NADH dehydrogenase subunit B [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108984|gb|AAM37549.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 191

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 36  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 95

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 96  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 155

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 156 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 189


>gi|186920122|ref|YP_001874776.1| NADH dehydrogenase subunit 10 [Hemiselmis andersenii]
 gi|186461068|gb|ACC78230.1| NADH dehydrogenase subunit 10 [Hemiselmis andersenii]
          Length = 182

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ +D L+ WAR GSL  MTFGLACCAVEMM A   RYD +RFG   RASPRQSDVMI
Sbjct: 31  FVISKLDDLLNWARRGSLWPMTFGLACCAVEMMHAGASRYDFDRFGIIFRASPRQSDVMI 90

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVP
Sbjct: 91  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVP 150

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNV 183
           GCPPTAEAL+YGI+ LQKKI++  N+
Sbjct: 151 GCPPTAEALLYGIVQLQKKIKQNKNL 176


>gi|78485163|ref|YP_391088.1| NADH dehydrogenase subunit B [Thiomicrospira crunogena XCL-2]
 gi|123555687|sp|Q31HF9|NUOB_THICR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78363449|gb|ABB41414.1| NADH dehydrogenase I chain B [Thiomicrospira crunogena XCL-2]
          Length = 158

 Score =  244 bits (623), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +G + TS D+L+ WARTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGVVTTSADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|148361101|ref|YP_001252308.1| NADH dehydrogenase I subunit B [Legionella pneumophila str. Corby]
 gi|218527993|sp|A5IHW2|NUOB_LEGPC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|148282874|gb|ABQ56962.1| NADH dehydrogenase I, B subunit [Legionella pneumophila str. Corby]
          Length = 158

 Score =  244 bits (622), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (86%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           +E+  K F +T+V++LV WAR+GS+  MTFGLACCAVEMM     RYDL+RFG   R SP
Sbjct: 4   AELEKKVFELTTVEKLVGWARSGSMWPMTFGLACCAVEMMHVGAARYDLDRFGIIFRPSP 63

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 64  RQSDVMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 123

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           PVD+YVPGCPPTAEAL+YGI+ LQ KIRR
Sbjct: 124 PVDVYVPGCPPTAEALLYGIIQLQNKIRR 152


>gi|330817791|ref|YP_004361496.1| NADH dehydrogenase subunit B [Burkholderia gladioli BSR3]
 gi|327370184|gb|AEA61540.1| NADH dehydrogenase subunit B [Burkholderia gladioli BSR3]
          Length = 159

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVY+QM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRRVYEQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALVYGVIQLQAKIRRTSTI 156


>gi|190575277|ref|YP_001973122.1| NADH dehydrogenase subunit B [Stenotrophomonas maltophilia K279a]
 gi|194366603|ref|YP_002029213.1| NADH dehydrogenase subunit B [Stenotrophomonas maltophilia R551-3]
 gi|254524125|ref|ZP_05136180.1| NADH-ubiquinone oxidoreductase Nqo6 subunit [Stenotrophomonas sp.
           SKA14]
 gi|218528009|sp|B4SQT5|NUOB_STRM5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528010|sp|B2FNX8|NUOB_STRMK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|190013199|emb|CAQ46832.1| putative NADH dehydrogenase I chain B [Stenotrophomonas maltophilia
           K279a]
 gi|194349407|gb|ACF52530.1| NADH-quinone oxidoreductase, B subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|219721716|gb|EED40241.1| NADH-ubiquinone oxidoreductase Nqo6 subunit [Stenotrophomonas sp.
           SKA14]
          Length = 184

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KGF+ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  DNPLLEKGFVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDR+
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRV 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|21231959|ref|NP_637876.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767914|ref|YP_242676.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991030|ref|YP_001903040.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113690|gb|AAM41800.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66573246|gb|AAY48656.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167732790|emb|CAP50984.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas campestris
           pv. campestris]
          Length = 191

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 36  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGVVFRPS 95

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 96  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 155

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 156 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 189


>gi|168050412|ref|XP_001777653.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162670996|gb|EDQ57555.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 174

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 5/159 (3%)

Query: 30  SSEITHKG-----FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +S  T KG     F+++ VD L+ WARTGS+  MTFGLACCAVEMM     RYDL+RFG 
Sbjct: 10  TSSTTSKGGPGAEFVLSKVDALMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGI 69

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             R SPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVR
Sbjct: 70  IFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVR 129

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           GCDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI R  +V
Sbjct: 130 GCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRKDV 168


>gi|58582858|ref|YP_201874.1| NADH dehydrogenase subunit B [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624723|ref|YP_452095.1| NADH dehydrogenase subunit B [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166712613|ref|ZP_02243820.1| NADH dehydrogenase subunit B [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|58427452|gb|AAW76489.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84368663|dbj|BAE69821.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 191

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 36  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 95

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 96  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 155

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 156 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 189


>gi|330794647|ref|XP_003285389.1| NADH dehydrogenase [Dictyostelium purpureum]
 gi|325084659|gb|EGC38082.1| NADH dehydrogenase [Dictyostelium purpureum]
          Length = 178

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 127/145 (87%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++ +D LV WARTGSL  MTFGLACCAVEMMQ    RYD++RFG  PRASPRQSD +IV
Sbjct: 28  VISKLDGLVNWARTGSLWPMTFGLACCAVEMMQGYAARYDMDRFGVIPRASPRQSDCIIV 87

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLTNKMA ALR+VYDQMP PRYV+SMGSCANGGGYYHYSYSVVRGCDRI+PVD+Y+PG
Sbjct: 88  AGTLTNKMAPALRKVYDQMPNPRYVVSMGSCANGGGYYHYSYSVVRGCDRIIPVDVYMPG 147

Query: 159 CPPTAEALIYGILLLQKKIRRVGNV 183
           CPPTAEA +YGIL LQKK+RR  N+
Sbjct: 148 CPPTAEAFVYGILQLQKKMRREQNL 172


>gi|134095030|ref|YP_001100105.1| NADH dehydrogenase subunit B [Herminiimonas arsenicoxydans]
 gi|218527991|sp|A4G643|NUOB_HERAR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|133738933|emb|CAL61980.1| NADH-quinone oxidoreductase subunit B (NADH dehydrogenase I subunit
           B) (NDH-1 subunit B) [Herminiimonas arsenicoxydans]
          Length = 158

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGS+  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLNEGFVTTTADKLINWTRTGSMWPMTFGLACCAVEMMHAGASRYDMDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIMQLQNKIRRTNTI 156


>gi|238028142|ref|YP_002912373.1| NADH dehydrogenase subunit B [Burkholderia glumae BGR1]
 gi|237877336|gb|ACR29669.1| NADH-quinone oxidoreductase, B subunit [Burkholderia glumae BGR1]
          Length = 159

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D+L+ W RTGSL  +TFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADKLINWTRTGSLWPVTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALRRVYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALVYGVIQLQAKIRRTSTI 156


>gi|218528065|sp|Q4UWB7|NUOB_XANC8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528066|sp|B0RR99|NUOB_XANCB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528067|sp|Q8P7T3|NUOB_XANCP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 184

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|188577695|ref|YP_001914624.1| NADH dehydrogenase subunit B [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|238065244|sp|B2SVL8|NUOB_XANOP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|188522147|gb|ACD60092.1| NADH-ubiquinone oxidoreductase 20 kda subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 182

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 27  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 86

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 87  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 146

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 147 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 180


>gi|78048408|ref|YP_364583.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294624677|ref|ZP_06703347.1| NADH dehydrogenase beta subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666776|ref|ZP_06732010.1| NADH dehydrogenase beta subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325924676|ref|ZP_08186114.1| NADH dehydrogenase subunit B [Xanthomonas perforans 91-118]
 gi|123584672|sp|Q3BRN0|NUOB_XANC5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065262|sp|Q8PJ41|NUOB_XANAC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78036838|emb|CAJ24531.1| NADH-ubiquinone oxidoreductase NQO6 subunit [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|292601033|gb|EFF45100.1| NADH dehydrogenase beta subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603437|gb|EFF46854.1| NADH dehydrogenase beta subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325544882|gb|EGD16227.1| NADH dehydrogenase subunit B [Xanthomonas perforans 91-118]
          Length = 184

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|148284880|ref|YP_001248970.1| NADH dehydrogenase subunit B [Orientia tsutsugamushi str. Boryong]
 gi|189183819|ref|YP_001937604.1| NADH dehydrogenase subunit B [Orientia tsutsugamushi str. Ikeda]
 gi|218528000|sp|A5CES0|NUOB_ORITB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528001|sp|B3CSG9|NUOB_ORITI RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146740319|emb|CAM80723.1| NADH dehydrogenase I chain B [Orientia tsutsugamushi str. Boryong]
 gi|189180590|dbj|BAG40370.1| NADH dehydrogenase I chain B [Orientia tsutsugamushi str. Ikeda]
          Length = 171

 Score =  244 bits (622), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 139/166 (83%), Gaps = 1/166 (0%)

Query: 20  EKVDADFSRISSE-ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           E   +D + I ++ ++++GF++ +++ LV+WART SL  MTFGLACCA+EMMQ +  RYD
Sbjct: 3   ENTFSDTTSIYNQNLSNQGFILANLENLVSWARTRSLWPMTFGLACCAIEMMQTAGSRYD 62

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           ++R+G   R SPRQ+DVMIVAGTLTNKMA ALRRVYDQM EP++VISMGSCANGGGYYHY
Sbjct: 63  MDRYGMLFRPSPRQADVMIVAGTLTNKMAPALRRVYDQMTEPKWVISMGSCANGGGYYHY 122

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SYSVVRGCD+IVPVDIYVPGCPPT EAL+YGIL LQKKI R   VK
Sbjct: 123 SYSVVRGCDKIVPVDIYVPGCPPTPEALLYGILQLQKKINRTQQVK 168


>gi|325915540|ref|ZP_08177851.1| NADH dehydrogenase subunit B [Xanthomonas vesicatoria ATCC 35937]
 gi|325538256|gb|EGD09941.1| NADH dehydrogenase subunit B [Xanthomonas vesicatoria ATCC 35937]
          Length = 182

 Score =  244 bits (622), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 27  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 86

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 87  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 146

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 147 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 180


>gi|300311096|ref|YP_003775188.1| NADH dehydrogenase I subunit B [Herbaspirillum seropedicae SmR1]
 gi|300073881|gb|ADJ63280.1| NADH dehydrogenase I (Chain B) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 158

 Score =  244 bits (622), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ TS+D+++ W RTGSL  MTFGLACCAVEMM     RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFVTTSLDKVINWTRTGSLWPMTFGLACCAVEMMHVGASRYDLDRFGAVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGVIQLQNKIKRTNTI 156


>gi|289665174|ref|ZP_06486755.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667379|ref|ZP_06488454.1| NADH dehydrogenase subunit B [Xanthomonas campestris pv. musacearum
           NCPPB4381]
 gi|238065260|sp|Q5GXT2|NUOB_XANOR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065261|sp|Q2P0V6|NUOB_XANOM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 184

 Score =  243 bits (621), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGASRLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|325921410|ref|ZP_08183267.1| NADH dehydrogenase subunit B [Xanthomonas gardneri ATCC 19865]
 gi|325548168|gb|EGD19165.1| NADH dehydrogenase subunit B [Xanthomonas gardneri ATCC 19865]
          Length = 184

 Score =  243 bits (621), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVDIYVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDIYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|73666917|ref|YP_302933.1| NADH dehydrogenase subunit B [Ehrlichia canis str. Jake]
 gi|72394058|gb|AAZ68335.1| NADH dehydrogenase subunit B [Ehrlichia canis str. Jake]
          Length = 185

 Score =  243 bits (621), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/150 (76%), Positives = 127/150 (84%), Gaps = 4/150 (2%)

Query: 34  THKGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT     +D +  WAR+ SL  MTFGLACCAVEMM  +  RYDL+R+G   RAS
Sbjct: 21  NHQGFMVTQFSDLIDYISNWARSNSLWPMTFGLACCAVEMMHTAASRYDLDRYGIMFRAS 80

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 81  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 140

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVDIYVPGCPPTAEAL+YGIL LQ+KI R
Sbjct: 141 VPVDIYVPGCPPTAEALLYGILCLQQKINR 170


>gi|114052144|ref|NP_001040456.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 [Bombyx mori]
 gi|95102968|gb|ABF51425.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 [Bombyx mori]
          Length = 210

 Score =  243 bits (621), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 127/145 (87%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           V  +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++R+G   RASPRQSDVMIVA
Sbjct: 61  VARLDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQSDVMIVA 120

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC
Sbjct: 121 GTLTNKMAPALRKVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 180

Query: 160 PPTAEALIYGILLLQKKIRRVGNVK 184
           PPTAEAL+YG+L LQKKI+R+  ++
Sbjct: 181 PPTAEALLYGVLQLQKKIKRMKTIQ 205


>gi|296136705|ref|YP_003643947.1| hypothetical protein Tint_2267 [Thiomonas intermedia K12]
 gi|294340860|emb|CAZ89255.1| NADH-quinone oxidoreductase subunit 6 (NADH dehydrogenase I chain
           6) (NDH-1 subunit 6) [Thiomonas sp. 3As]
 gi|295796827|gb|ADG31617.1| hypothetical protein Tint_2267 [Thiomonas intermedia K12]
          Length = 158

 Score =  243 bits (621), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLQEGFITTSADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQNKIRRTETI 156


>gi|291613539|ref|YP_003523696.1| NADH-quinone oxidoreductase, B subunit [Sideroxydans lithotrophicus
           ES-1]
 gi|291583651|gb|ADE11309.1| NADH-quinone oxidoreductase, B subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 159

 Score =  243 bits (621), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (85%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPR 91
           +  KGF+ TS D ++ + RTGSL  MTFGLACCAVEMM A++PRYDL+RFG  A R SPR
Sbjct: 6   VLEKGFITTSADTVINYVRTGSLWPMTFGLACCAVEMMHAALPRYDLDRFGAGAFRPSPR 65

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 66  QSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 125

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VDIYVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 VDIYVPGCPPTAEALLYGIIQLQNKIKRTNTI 157


>gi|195033324|ref|XP_001988662.1| GH11286 [Drosophila grimshawi]
 gi|193904662|gb|EDW03529.1| GH11286 [Drosophila grimshawi]
          Length = 209

 Score =  243 bits (621), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 113/147 (76%), Positives = 129/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + VT +D L+ W R GS+  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+D+MI
Sbjct: 58  WTVTRLDDLLNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQTDLMI 117

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 118 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 177

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R+  ++
Sbjct: 178 GCPPTAEALMYGILQLQKKIKRMRTLQ 204


>gi|145256397|ref|XP_001401369.1| NADH-ubiquinone oxidoreductase subunit [Aspergillus niger CBS
           513.88]
 gi|134058270|emb|CAK38461.1| unnamed protein product [Aspergillus niger]
          Length = 232

 Score =  243 bits (620), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 118/177 (66%), Positives = 138/177 (77%), Gaps = 2/177 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T + Q+  SGQ+  +  KV  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 45  TAIEQRGQSGQALTASGKVRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 104

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 105 LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 164

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +V+SMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 165 WVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 221


>gi|124266597|ref|YP_001020601.1| NADH dehydrogenase subunit B [Methylibium petroleiphilum PM1]
 gi|218527995|sp|A2SFM7|NUOB_METPP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|124259372|gb|ABM94366.1| NADH dehydrogenase [Methylibium petroleiphilum PM1]
          Length = 158

 Score =  243 bits (620), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS D+L+ W++TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLKEGFITTSADKLINWSKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGIL LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGILQLQAKIRRENTI 156


>gi|325983288|ref|YP_004295690.1| NADH-quinone oxidoreductase, B subunit [Nitrosomonas sp. AL212]
 gi|325532807|gb|ADZ27528.1| NADH-quinone oxidoreductase, B subunit [Nitrosomonas sp. AL212]
          Length = 158

 Score =  243 bits (620), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 113/149 (75%), Positives = 125/149 (83%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            KGF+ TS+D ++ W RTGS+  MTFGLACCAVEMM+    RYDL+RFG   R SPRQSD
Sbjct: 8   EKGFITTSLDSIINWGRTGSMWPMTFGLACCAVEMMETGASRYDLDRFGIVFRPSPRQSD 67

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDI
Sbjct: 68  VMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 127

Query: 155 YVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           YVPGCPPTAEAL+YGI+ LQ KI R   +
Sbjct: 128 YVPGCPPTAEALLYGIIQLQNKINRTNTI 156


>gi|239816482|ref|YP_002945392.1| NADH dehydrogenase subunit B [Variovorax paradoxus S110]
 gi|259514693|sp|C5CT19|NUOB_VARPS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|239803059|gb|ACS20126.1| NADH-quinone oxidoreductase, B subunit [Variovorax paradoxus S110]
          Length = 159

 Score =  243 bits (620), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D +V WA+TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VMKEGFVTTTYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ+KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGVIQLQQKIRRTNTI 156


>gi|319779199|ref|YP_004130112.1| NADH-ubiquinone oxidoreductase chain B [Taylorella equigenitalis
           MCE9]
 gi|317109223|gb|ADU91969.1| NADH-ubiquinone oxidoreductase chain B [Taylorella equigenitalis
           MCE9]
          Length = 159

 Score =  243 bits (620), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +S    +KGFLVTS D ++ W RTGS+  +TFGLACCAVEMM A   RYDL++FG   R 
Sbjct: 1   MSDTSNNKGFLVTSTDSVLHWLRTGSMWPVTFGLACCAVEMMHAGAARYDLDQFGIIFRP 60

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSD+MIVAGTLTNKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSY+VVRGCDR
Sbjct: 61  SPRQSDIMIVAGTLTNKMAPALRKVYDQMAEPRWVVSMGSCANGGGYYHYSYAVVRGCDR 120

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           IVPVDIYVPGCPPTAEALIYG+L LQ K+RR
Sbjct: 121 IVPVDIYVPGCPPTAEALIYGMLQLQNKMRR 151


>gi|58584500|ref|YP_198073.1| NADH dehydrogenase subunit B [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75497991|sp|Q5GT43|NUOB_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|58418816|gb|AAW70831.1| NADH:ubiquinone oxidoreductase chain B [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 168

 Score =  243 bits (620), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 8/165 (4%)

Query: 23  DADFSRISSEITHKGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           + D++R   E    GFLVT     +D ++ WAR+GSL  MTFGLACCAVEMM  +  RYD
Sbjct: 8   NDDWNRYKKE----GFLVTKFGSLIDYVINWARSGSLWPMTFGLACCAVEMMHTASSRYD 63

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+R+G   RASPRQ+DVMIVAGTLTNKMA+ALR+VYDQM +P+YV+SMGSCANGGGYYHY
Sbjct: 64  LDRYGIMFRASPRQADVMIVAGTLTNKMAAALRKVYDQMADPKYVVSMGSCANGGGYYHY 123

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           SYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ KI+R  N+
Sbjct: 124 SYSVVRGCDRIVPVDIYVPGCPPTAEALLYGMLCLQNKIKRTQNI 168


>gi|319794667|ref|YP_004156307.1| NADH-quinone oxidoreductase, b subunit [Variovorax paradoxus EPS]
 gi|315597130|gb|ADU38196.1| NADH-quinone oxidoreductase, B subunit [Variovorax paradoxus EPS]
          Length = 159

 Score =  243 bits (620), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ D +V WA+TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG++ LQ+KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGVIQLQQKIRRTNTI 156


>gi|285017793|ref|YP_003375504.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenaseI chain b)
           (ndh-1, chain b) (nuo2) oxidoreductase [Xanthomonas
           albilineans GPE PC73]
 gi|283473011|emb|CBA15516.1| probable nadh-quinone oxidoreductase chain b (nadh dehydrogenaseI
           chain b) (ndh-1, chain b) (nuo2). oxidoreductase protein
           [Xanthomonas albilineans]
          Length = 184

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            + +  KG++ TSVD L+ WARTGS+  MTFGLACCAVEMM A   R DL+R+G   R S
Sbjct: 29  ENPLLEKGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGVVFRPS 88

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 89  PRQSDVMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRI 148

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPVD+YVPGCPPTAEAL+YGIL LQKKI R   +
Sbjct: 149 VPVDVYVPGCPPTAEALVYGILQLQKKIWRTQTI 182


>gi|145589233|ref|YP_001155830.1| NADH-quinone oxidoreductase, B subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|171463527|ref|YP_001797640.1| NADH-quinone oxidoreductase, B subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|218528004|sp|B1XUJ9|NUOB_POLNS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218528005|sp|A4SXQ2|NUOB_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|145047639|gb|ABP34266.1| NADH dehydrogenase subunit B [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|171193065|gb|ACB44026.1| NADH-quinone oxidoreductase, B subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 160

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (82%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ T+ DQL+ W R GSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLKEGFVTTTADQLINWTRNGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYH SYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHNSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYGI+ LQ KI R   +
Sbjct: 126 DIYVPGCPPTAEALIYGIIQLQSKIARTSTI 156


>gi|2499328|sp|Q43844|NDUS7_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa subunit,
           mitochondrial; AltName: Full=Complex I-20 kDa;
           Short=CI-20kD; Flags: Precursor
 gi|1235607|emb|CAA65451.1| NADH-ubiquinone oxidoreductase [Solanum tuberosum]
          Length = 213

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSDVMI
Sbjct: 62  YVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHAGAARYDFDRFGIIFRPSPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQKKI R
Sbjct: 182 GCPPTAEALLYGILQLQKKINR 203


>gi|328874905|gb|EGG23270.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Dictyostelium
           fasciculatum]
          Length = 179

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%)

Query: 11  ISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           ++ Q+   L K+ A   + +   +    +++ +D LV WARTGS   MTFGLACCAVEMM
Sbjct: 1   MASQAGQHLSKLLASSFKAAPPSSVPEIVISKLDGLVNWARTGSFWPMTFGLACCAVEMM 60

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
                RYD++RFG  PRASPRQSD +IVAGTLTNKMA ALR+VYDQMP PRYVISMGSCA
Sbjct: 61  HGYAARYDMDRFGVIPRASPRQSDCIIVAGTLTNKMAPALRKVYDQMPNPRYVISMGSCA 120

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           NGGGYYHYSYSVVRGCDRI+PVD+Y+PGCPPTAEA +YGIL LQKKI+R
Sbjct: 121 NGGGYYHYSYSVVRGCDRIIPVDVYIPGCPPTAEAFVYGILQLQKKIQR 169


>gi|281202313|gb|EFA76518.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Polysphondylium
           pallidum PN500]
          Length = 178

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/167 (68%), Positives = 132/167 (79%)

Query: 13  GQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQA 72
            Q+   L K+ A   + +   +    +++ +D LV WARTGSL  MTFGLACCAVEMM  
Sbjct: 2   AQAGQHLSKLLASSFKAAPPSSVPEIVISKLDGLVNWARTGSLWPMTFGLACCAVEMMHG 61

Query: 73  SMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANG 132
              RYDL+RFG  PRASPRQSD +IVAGTLTNKMA ALR+VYDQMP PRYVISMGSCANG
Sbjct: 62  YAARYDLDRFGIIPRASPRQSDCIIVAGTLTNKMAPALRKVYDQMPLPRYVISMGSCANG 121

Query: 133 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GGYYHYSYSVVRGCDRI+PVD+Y+PGCPPTAEA +YG+L LQKKI R
Sbjct: 122 GGYYHYSYSVVRGCDRIIPVDVYIPGCPPTAEAFVYGVLQLQKKINR 168


>gi|125772981|ref|XP_001357749.1| GA15185 [Drosophila pseudoobscura pseudoobscura]
 gi|54637481|gb|EAL26883.1| GA15185 [Drosophila pseudoobscura pseudoobscura]
          Length = 211

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 60  WTLARLDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGMVFRASPRQTDVMI 119

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 120 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 179

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKK+RR+  ++
Sbjct: 180 GCPPTAEALLYGLLQLQKKVRRMRTLQ 206


>gi|77745495|gb|ABB02646.1| NADH-ubiquinone oxidoreductase subunit-like [Solanum tuberosum]
          Length = 213

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSDVMI
Sbjct: 62  YVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHAGAARYDFDRFGIIFRPSPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YGIL LQKKI R
Sbjct: 182 GCPPTAEALLYGILQLQKKINR 203


>gi|212528728|ref|XP_002144521.1| NADH-ubiquinone oxidoreductase subunit B, putative [Penicillium
           marneffei ATCC 18224]
 gi|210073919|gb|EEA28006.1| NADH-ubiquinone oxidoreductase subunit B, putative [Penicillium
           marneffei ATCC 18224]
          Length = 225

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (76%), Gaps = 2/180 (1%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWM 58
           M +T + +++ S  S  +  KV  +    S E       + +T++DQ+  WAR  SL  M
Sbjct: 35  MPVTAIERQLESSSSLTASGKVRREVPLPSQEKKEGAMQYALTTLDQIANWARQSSLWPM 94

Query: 59  TFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMP 118
           TFGLACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP
Sbjct: 95  TFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMP 154

Query: 119 EPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 155 DPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTSEALMYGIFQLQKKMR 214


>gi|119501352|ref|XP_001267433.1| NADH-ubiquinone oxidoreductase subunit B, putative [Neosartorya
           fischeri NRRL 181]
 gi|119415598|gb|EAW25536.1| NADH-ubiquinone oxidoreductase subunit B, putative [Neosartorya
           fischeri NRRL 181]
          Length = 228

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/177 (66%), Positives = 137/177 (77%), Gaps = 2/177 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T + ++  SGQ   +  KV  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 41  TALERQAQSGQPLTASGKVRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 100

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 101 LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 160

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 161 WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 217


>gi|112434059|gb|ABI18374.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
          Length = 172

 Score =  242 bits (618), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 128/153 (83%), Gaps = 4/153 (2%)

Query: 34  THKGFLVTSVDQLV----TWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT    L+    +WAR+ SL  MTFGLACCAVEMM  +  RYDL+R+G   RAS
Sbjct: 18  NHRGFMVTKFSDLINYVSSWARSNSLWPMTFGLACCAVEMMHTAASRYDLDRYGVMFRAS 77

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 78  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 137

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VPVDIYVPGCPPTAEAL+YGIL LQ+KI R  +
Sbjct: 138 VPVDIYVPGCPPTAEALLYGILCLQQKINRTAS 170


>gi|195158809|ref|XP_002020277.1| GL13892 [Drosophila persimilis]
 gi|194117046|gb|EDW39089.1| GL13892 [Drosophila persimilis]
          Length = 205

 Score =  242 bits (618), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 54  WTLARLDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGMVFRASPRQTDVMI 113

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 114 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 173

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKK+RR+  ++
Sbjct: 174 GCPPTAEALLYGLLQLQKKVRRMRTLQ 200


>gi|114330926|ref|YP_747148.1| NADH dehydrogenase subunit B [Nitrosomonas eutropha C91]
 gi|122314158|sp|Q0AHJ9|NUOB_NITEC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|114307940|gb|ABI59183.1| NADH dehydrogenase subunit B [Nitrosomonas eutropha C91]
          Length = 158

 Score =  242 bits (618), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           KGF+ T++D L+ W RTGS+  MTFGLACCAVEMMQ    RYDL+RFG   R SPRQSDV
Sbjct: 9   KGFVTTNLDSLINWGRTGSMWPMTFGLACCAVEMMQTGASRYDLDRFGIVFRPSPRQSDV 68

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY
Sbjct: 69  MIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 128

Query: 156 VPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VPGCPPTAEAL+YGI+ LQ KI R   +
Sbjct: 129 VPGCPPTAEALLYGIIQLQNKIWRTNTI 156


>gi|70994922|ref|XP_752238.1| NADH-ubiquinone oxidoreductase subunit B [Aspergillus fumigatus
           Af293]
 gi|66849872|gb|EAL90200.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           fumigatus Af293]
 gi|159124846|gb|EDP49963.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           fumigatus A1163]
          Length = 223

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/177 (66%), Positives = 136/177 (76%), Gaps = 2/177 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T +  +  SGQ   +  KV  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 36  TALEHQAQSGQPLTASGKVRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 95

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 96  LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 155

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 156 WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 212


>gi|332526748|ref|ZP_08402850.1| NADH dehydrogenase subunit B [Rubrivivax benzoatilyticus JA2]
 gi|332111151|gb|EGJ11183.1| NADH dehydrogenase subunit B [Rubrivivax benzoatilyticus JA2]
          Length = 158

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TSVD+L+ W++TGSL  MTFGLACCA+EMM A   RYD++RFG   R SPRQ
Sbjct: 6   VIKEGFVTTSVDKLINWSKTGSLWPMTFGLACCAIEMMHAGAARYDMDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIMQLQSKIRRENTI 156


>gi|115400845|ref|XP_001216011.1| NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial
           precursor [Aspergillus terreus NIH2624]
 gi|114191677|gb|EAU33377.1| NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial
           precursor [Aspergillus terreus NIH2624]
          Length = 307

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 138/179 (77%), Gaps = 2/179 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T + ++  +GQS  +  KV  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 120 TALERQGQTGQSLTASGKVRKEVPLASQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 179

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 180 LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 239

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           +V+SMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R  
Sbjct: 240 WVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMRHT 298


>gi|190571252|ref|YP_001975610.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018650|ref|ZP_03334458.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|218528013|sp|B3CM42|NUOB_WOLPP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|190357524|emb|CAQ54961.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995601|gb|EEB56241.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 167

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 8/165 (4%)

Query: 23  DADFSRISSEITHKGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           + D++R   E    GFL+T     +D ++ WAR+GSL  MTFGLACCAVEMM  +  RYD
Sbjct: 7   NGDWNRYKKE----GFLITKFGDLIDYIMNWARSGSLWPMTFGLACCAVEMMHTASSRYD 62

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+R+G   RASPRQ+DVMIVAGTLTNKMA+ALR+VYDQM +P+YV+SMGSCANGGGYYHY
Sbjct: 63  LDRYGIIFRASPRQADVMIVAGTLTNKMAAALRKVYDQMADPKYVVSMGSCANGGGYYHY 122

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           SYSVVRGCDRIVPVD+YVPGCPPTAEAL+YG+L LQ KI+R  N+
Sbjct: 123 SYSVVRGCDRIVPVDVYVPGCPPTAEALLYGMLCLQNKIKRTKNI 167


>gi|224824822|ref|ZP_03697929.1| NADH-quinone oxidoreductase, B subunit [Lutiella nitroferrum 2002]
 gi|224603315|gb|EEG09491.1| NADH-quinone oxidoreductase, B subunit [Lutiella nitroferrum 2002]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  KGF+ T+ D+L+ + RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   ILEKGFITTTADKLINYTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|116782796|gb|ABK22662.1| unknown [Picea sitchensis]
          Length = 205

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ +D LV WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 54  YVISKIDALVNWARKGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 113

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 114 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 173

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 174 GCPPTAEALLYGLLQLQKKIHR 195


>gi|121998543|ref|YP_001003330.1| NADH-quinone oxidoreductase subunit B [Halorhodospira halophila
           SL1]
 gi|238065156|sp|A1WXW6|NUOB_HALHL RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|121589948|gb|ABM62528.1| NADH dehydrogenase subunit B [Halorhodospira halophila SL1]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 126/151 (83%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +G++ TS D+L+ WARTGSL  MTFGLACCAVEMM  +  RYD++R G   R SPRQ
Sbjct: 6   ILERGYVTTSADKLINWARTGSLWPMTFGLACCAVEMMHTAAGRYDMDRNGLIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQMPEP++VISMGSCANGGGYYHYSYSV RGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMPEPKWVISMGSCANGGGYYHYSYSVTRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL YGIL LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALYYGILQLQNKIRRTNTI 156


>gi|169774064|ref|XP_001821500.1| NADH-ubiquinone oxidoreductase subunit [Aspergillus oryzae RIB40]
 gi|238508860|ref|XP_002385611.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           flavus NRRL3357]
 gi|83769362|dbj|BAE59498.1| unnamed protein product [Aspergillus oryzae]
 gi|220688358|gb|EED44712.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           flavus NRRL3357]
          Length = 228

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 136/179 (75%), Gaps = 2/179 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T +  K  SGQ   +  K+  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 41  TALEHKGHSGQPLTASGKIRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 100

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 101 LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 160

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           +V+SMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R  
Sbjct: 161 WVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMRHT 219


>gi|242088593|ref|XP_002440129.1| hypothetical protein SORBIDRAFT_09g026580 [Sorghum bicolor]
 gi|241945414|gb|EES18559.1| hypothetical protein SORBIDRAFT_09g026580 [Sorghum bicolor]
          Length = 202

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 115/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 51  FVVSKVDDLMNWARRGSIWPMTFGLACCAVEMMHAGASRYDFDRFGLIFRPSPRQSDCMI 110

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRRVYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 111 VAGTLTNKMAPALRRVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 170

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 171 GCPPTAEALLYGVLQLQKKINR 192


>gi|226939457|ref|YP_002794530.1| NuoB2 [Laribacter hongkongensis HLHK9]
 gi|254767794|sp|C1DCA4|NUOB_LARHH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|226714383|gb|ACO73521.1| NuoB2 [Laribacter hongkongensis HLHK9]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D+++ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFITTSADKVLNWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YGI+ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKR 152


>gi|160871863|ref|ZP_02061995.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Rickettsiella grylli]
 gi|159120662|gb|EDP46000.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Rickettsiella grylli]
          Length = 160

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           I S +  +GF  TS D+L+ WAR+GSL  M+FGLACCAVEMM ++  RYDL+RFG   R 
Sbjct: 3   IESLLQQQGFFTTSFDKLLAWARSGSLWPMSFGLACCAVEMMHSAASRYDLDRFGVVFRP 62

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQSDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHY+YSVVRGCDR
Sbjct: 63  SPRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYAYSVVRGCDR 122

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           IVPVD+YVPGCPPTAEAL+YG++ LQ KI++
Sbjct: 123 IVPVDVYVPGCPPTAEALVYGVIQLQNKIKK 153


>gi|303316328|ref|XP_003068166.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240107847|gb|EER26021.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320037899|gb|EFW19835.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Coccidioides
           posadasii str. Silveira]
          Length = 227

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 133/170 (78%), Gaps = 3/170 (1%)

Query: 14  QSSCSLEKVDADFSRISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           QSS +  K D     + S+   +G   F +T++DQ+  WAR  SL  MTFGLACCAVEMM
Sbjct: 49  QSSMTQTKKDRREVPLPSQQKKEGAMQFALTTLDQVANWARQSSLWPMTFGLACCAVEMM 108

Query: 71  QASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCA 130
             S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCA
Sbjct: 109 HLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCA 168

Query: 131 NGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           NGGGYYHYSYSV RGCDRIVPVDIYVPGCPPT+EAL+YGI  LQKK+R  
Sbjct: 169 NGGGYYHYSYSVTRGCDRIVPVDIYVPGCPPTSEALMYGIFQLQKKMRHT 218


>gi|195385751|ref|XP_002051568.1| GJ16291 [Drosophila virilis]
 gi|194148025|gb|EDW63723.1| GJ16291 [Drosophila virilis]
          Length = 209

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 127/145 (87%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VT +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+IVA
Sbjct: 60  VTRLDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQTDVIIVA 119

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC
Sbjct: 120 GTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 179

Query: 160 PPTAEALIYGILLLQKKIRRVGNVK 184
           PPTAEAL+Y IL LQKKI+R+  ++
Sbjct: 180 PPTAEALLYAILQLQKKIKRMRTLQ 204


>gi|77166022|ref|YP_344547.1| NADH dehydrogenase subunit B [Nitrosococcus oceani ATCC 19707]
 gi|254436391|ref|ZP_05049897.1| NADH-quinone oxidoreductase, B subunit subfamily [Nitrosococcus
           oceani AFC27]
 gi|300113266|ref|YP_003759841.1| NADH-quinone oxidoreductase subunit B [Nitrosococcus watsonii
           C-113]
 gi|123593538|sp|Q3J829|NUOB2_NITOC RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|76884336|gb|ABA59017.1| NADH dehydrogenase subunit B [Nitrosococcus oceani ATCC 19707]
 gi|207088081|gb|EDZ65354.1| NADH-quinone oxidoreductase, B subunit subfamily [Nitrosococcus
           oceani AFC27]
 gi|299539203|gb|ADJ27520.1| NADH-quinone oxidoreductase, B subunit [Nitrosococcus watsonii
           C-113]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/147 (76%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +G + T+ D+L+ WARTGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLERGVVTTTADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDMDRFGVIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           DIYVPGCPPTAEAL+YGI+ LQ KI+R
Sbjct: 126 DIYVPGCPPTAEALLYGIIQLQNKIKR 152


>gi|1171866|sp|P42027|NDUS7_BRAOL RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa subunit,
           mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; Flags: Precursor
 gi|562282|emb|CAA57725.1| PSST subunit of NADH: ubiquinone oxidoreductase [Brassica oleracea]
          Length = 215

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 64  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 123

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 124 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 183

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 184 GCPPTAEALLYGLLQLQKKINR 205


>gi|195626816|gb|ACG35238.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Zea mays]
          Length = 200

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 49  FVVSKVDDLMNWARKGSIWPMTFGLACCAVEMMHAGASRYDFDRFGVIFRPSPRQSDCMI 108

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 109 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 168

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 169 GCPPTAEALLYGVLQLQKKINR 190


>gi|212721050|ref|NP_001131270.1| hypothetical protein LOC100192583 [Zea mays]
 gi|194691040|gb|ACF79604.1| unknown [Zea mays]
 gi|195641534|gb|ACG40235.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Zea mays]
          Length = 202

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 51  FVVSKVDDLMNWARKGSIWPMTFGLACCAVEMMHAGASRYDFDRFGVIFRPSPRQSDCMI 110

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 111 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 170

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 171 GCPPTAEALLYGVLQLQKKINR 192


>gi|332285016|ref|YP_004416927.1| NADH dehydrogenase subunit B [Pusillimonas sp. T7-7]
 gi|330428969|gb|AEC20303.1| NADH dehydrogenase subunit B [Pusillimonas sp. T7-7]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ TS D+ + WA+TGSL  MTFGLACCAVEMM A   RYDL++FG   R SPRQ
Sbjct: 6   IMKEGFITTSADKFLNWAKTGSLWPMTFGLACCAVEMMHAGAARYDLDQFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L +Q KIR    +
Sbjct: 126 DVYVPGCPPTAEALVYGLLQMQNKIRLTNTI 156


>gi|226499630|ref|NP_001151765.1| LOC100285400 [Zea mays]
 gi|194708402|gb|ACF88285.1| unknown [Zea mays]
 gi|195621542|gb|ACG32601.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Zea mays]
 gi|195649579|gb|ACG44257.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Zea mays]
          Length = 200

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 49  FVVSKVDDLMNWARKGSIWPMTFGLACCAVEMMHAGASRYDFDRFGVIFRPSPRQSDCMI 108

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 109 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 168

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 169 GCPPTAEALLYGVLQLQKKINR 190


>gi|34496397|ref|NP_900612.1| NADH dehydrogenase subunit B [Chromobacterium violaceum ATCC 12472]
 gi|81656636|sp|Q7NZI0|NUOB1_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|34102250|gb|AAQ58616.1| NADH-ubiquinone oxidoreductase, chain B [Chromobacterium violaceum
           ATCC 12472]
          Length = 158

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  KGF+ T+ D+L+ + RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   ILEKGFVTTTADKLINYTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|6007781|gb|AAF01037.1| NADH ubiquinone oxidoreductase PSST subunit [Lupinus luteus]
          Length = 213

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 62  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 181

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 182 GCPPTAEALLYGLLQLQKKINR 203


>gi|225429464|ref|XP_002277483.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 209

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 58  FVISKVDDLLNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 117

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 118 VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 177

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 178 GCPPTAEALLYGLLQLQKKINR 199


>gi|242058541|ref|XP_002458416.1| hypothetical protein SORBIDRAFT_03g033090 [Sorghum bicolor]
 gi|241930391|gb|EES03536.1| hypothetical protein SORBIDRAFT_03g033090 [Sorghum bicolor]
          Length = 200

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 49  FVVSKVDDLMNWARKGSIWPMTFGLACCAVEMMHAGASRYDFDRFGVIFRPSPRQSDCMI 108

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 109 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 168

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 169 GCPPTAEALLYGVLQLQKKINR 190


>gi|171058186|ref|YP_001790535.1| NADH dehydrogenase subunit B [Leptothrix cholodnii SP-6]
 gi|218527994|sp|B1Y828|NUOB_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|170775631|gb|ACB33770.1| NADH-quinone oxidoreductase, B subunit [Leptothrix cholodnii SP-6]
          Length = 158

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TSVD L+ W++TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VLKEGFVTTSVDTLINWSKTGSLWPMTFGLACCAVEMMHAGASRYDIDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDR+VPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGIL LQ KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGILQLQAKIRRENTI 156


>gi|147818797|emb|CAN67285.1| hypothetical protein VITISV_021597 [Vitis vinifera]
          Length = 209

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 58  FVISKVDDLLNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 117

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 118 VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 177

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 178 GCPPTAEALLYGLLQLQKKINR 199


>gi|217970157|ref|YP_002355391.1| NADH dehydrogenase subunit B [Thauera sp. MZ1T]
 gi|217507484|gb|ACK54495.1| NADH-quinone oxidoreductase, B subunit [Thauera sp. MZ1T]
          Length = 158

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS+D ++ W RTGSL  MTFGLACCAVEM+ A   RYDL+RFG   R SPRQ
Sbjct: 6   VFREGFVTTSLDAVINWTRTGSLWPMTFGLACCAVEMIHAGCSRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYGIL LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALIYGILQLQNKIKRTNTI 156


>gi|113170492|ref|YP_717283.1| ndhK [Ostreococcus tauri]
 gi|112806899|emb|CAL36405.1| unnamed protein product [Ostreococcus tauri]
          Length = 166

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WAR GSL  MTFGLACCAVEMM     RYDL+RFG   R SPRQSDVMI
Sbjct: 15  YIISKVDGLINWARQGSLWPMTFGLACCAVEMMHTGAARYDLDRFGMIFRPSPRQSDVMI 74

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 75  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 134

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI +
Sbjct: 135 GCPPTAEALLYGLLQLQKKISQ 156


>gi|195429519|ref|XP_002062806.1| GK19502 [Drosophila willistoni]
 gi|194158891|gb|EDW73792.1| GK19502 [Drosophila willistoni]
          Length = 213

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 129/151 (85%)

Query: 34  THKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQS 93
           T   + V  +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+
Sbjct: 58  TWGEWTVARLDDLINWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQT 117

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD 153
           DV+IVAGTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVD
Sbjct: 118 DVIIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVD 177

Query: 154 IYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           IYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 178 IYVPGCPPTAEALMYGILQLQKKVKRMKTLQ 208


>gi|163855988|ref|YP_001630286.1| NADH dehydrogenase subunit B [Bordetella petrii DSM 12804]
 gi|163259716|emb|CAP42017.1| NADH-ubiquinone oxidoreductase, 20 kDa subunit, chain B [Bordetella
           petrii]
          Length = 178

 Score =  241 bits (615), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/151 (72%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ TS D+ + WA+TGS+  MTFGLACCAVEMM A   RYDL++FG   R SPRQ
Sbjct: 26  ILKQGFITTSADKFLNWAKTGSMWPMTFGLACCAVEMMHAGAARYDLDQFGIIFRPSPRQ 85

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 86  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 145

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L +Q KIR    +
Sbjct: 146 DVYVPGCPPTAEALVYGLLQMQNKIRLTNTI 176


>gi|226372608|gb|ACO51929.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Rana catesbeiana]
          Length = 217

 Score =  241 bits (615), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/172 (71%), Positives = 138/172 (80%), Gaps = 3/172 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGL 62
           T  N+  IS  +S   +K  A  +  SS  + KG F+VT +D LV+WAR  SL  MTFGL
Sbjct: 33  TADNENSIS--ASLVRQKSGAVPATKSSVPSGKGEFIVTKLDDLVSWARRSSLWPMTFGL 90

Query: 63  ACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRY 122
           ACCAVEMM  + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQMPEPRY
Sbjct: 91  ACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRY 150

Query: 123 VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQ 174
           V+SMGSCANGGGYYHYSYSVVRGCD IVPVDIYVPGCPPTAEAL+YGIL LQ
Sbjct: 151 VVSMGSCANGGGYYHYSYSVVRGCDGIVPVDIYVPGCPPTAEALLYGILQLQ 202


>gi|121593378|ref|YP_985274.1| NADH dehydrogenase subunit B [Acidovorax sp. JS42]
 gi|222110087|ref|YP_002552351.1| NADH dehydrogenase subunit b [Acidovorax ebreus TPSY]
 gi|218527972|sp|A1W4M3|NUOB_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065124|sp|B9MEL5|NUOB_DIAST RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|120605458|gb|ABM41198.1| NADH dehydrogenase subunit B [Acidovorax sp. JS42]
 gi|221729531|gb|ACM32351.1| NADH-quinone oxidoreductase, B subunit [Acidovorax ebreus TPSY]
          Length = 159

 Score =  241 bits (615), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A+  RYDL RFG    RASPR
Sbjct: 5   VMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDLGRFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTHTI 156


>gi|112434037|gb|ABI18363.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
          Length = 171

 Score =  241 bits (615), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 128/152 (84%), Gaps = 4/152 (2%)

Query: 34  THKGFLVTSVDQLVT----WARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT +  L++    WAR+ SL  MTFGLACCAVEMM  +  +YDL+R+G   RAS
Sbjct: 18  NHRGFMVTKLSDLMSYVSSWARSNSLWPMTFGLACCAVEMMHTAASKYDLDRYGIMFRAS 77

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 78  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 137

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           VPVDIYVPGCPPTAEAL+YGIL LQ+KI R  
Sbjct: 138 VPVDIYVPGCPPTAEALLYGILCLQQKINRTA 169


>gi|57239036|ref|YP_180172.1| NADH dehydrogenase subunit B [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578978|ref|YP_197190.1| NADH dehydrogenase subunit B [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617036|ref|YP_196235.1| NADH dehydrogenase subunit B [Ehrlichia ruminantium str. Gardel]
 gi|75432798|sp|Q5FHF7|NUOB_EHRRG RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81557325|sp|Q5HBM2|NUOB_EHRRW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|57161115|emb|CAH58026.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416648|emb|CAI27761.1| NADH-ubiquinone oxidoreductase chain B [Ehrlichia ruminantium str.
           Gardel]
 gi|58417604|emb|CAI26808.1| NADH-ubiquinone oxidoreductase chain B [Ehrlichia ruminantium str.
           Welgevonden]
 gi|112434039|gb|ABI18364.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434041|gb|ABI18365.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434043|gb|ABI18366.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434045|gb|ABI18367.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434047|gb|ABI18368.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434049|gb|ABI18369.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434051|gb|ABI18370.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434053|gb|ABI18371.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434055|gb|ABI18372.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
 gi|112434057|gb|ABI18373.1| NADH-quinone oxidoreductase chain B [Ehrlichia ruminantium]
          Length = 172

 Score =  241 bits (615), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 128/152 (84%), Gaps = 4/152 (2%)

Query: 34  THKGFLVTSVDQLVT----WARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT +  L++    WAR+ SL  MTFGLACCAVEMM  +  +YDL+R+G   RAS
Sbjct: 18  NHRGFMVTKLSDLMSYVSSWARSNSLWPMTFGLACCAVEMMHTAASKYDLDRYGIMFRAS 77

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 78  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 137

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           VPVDIYVPGCPPTAEAL+YGIL LQ+KI R  
Sbjct: 138 VPVDIYVPGCPPTAEALLYGILCLQQKINRTA 169


>gi|293603920|ref|ZP_06686335.1| NADH-quinone oxidoreductase subunit B [Achromobacter piechaudii
           ATCC 43553]
 gi|311104659|ref|YP_003977512.1| NADH-quinone oxidoreductase subunit B [Achromobacter xylosoxidans
           A8]
 gi|218528077|sp|A9II02|NUOB_BORPD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|292817757|gb|EFF76823.1| NADH-quinone oxidoreductase subunit B [Achromobacter piechaudii
           ATCC 43553]
 gi|310759348|gb|ADP14797.1| NADH-quinone oxidoreductase, B subunit [Achromobacter xylosoxidans
           A8]
 gi|317401989|gb|EFV82589.1| NADH-ubiquinone oxidoreductase [Achromobacter xylosoxidans C54]
          Length = 158

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/151 (72%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ TS D+ + WA+TGS+  MTFGLACCAVEMM A   RYDL++FG   R SPRQ
Sbjct: 6   ILKQGFITTSADKFLNWAKTGSMWPMTFGLACCAVEMMHAGAARYDLDQFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L +Q KIR    +
Sbjct: 126 DVYVPGCPPTAEALVYGLLQMQNKIRLTNTI 156


>gi|121706424|ref|XP_001271474.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           clavatus NRRL 1]
 gi|119399622|gb|EAW10048.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           clavatus NRRL 1]
          Length = 225

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/177 (66%), Positives = 135/177 (76%), Gaps = 2/177 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T +  +  SGQ      KV  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 38  TALEHRSQSGQPLTVSGKVRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 97

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 98  LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 157

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 158 WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 214


>gi|297538955|ref|YP_003674724.1| NADH-quinone oxidoreductase subunit B [Methylotenera sp. 301]
 gi|297258302|gb|ADI30147.1| NADH-quinone oxidoreductase, B subunit [Methylotenera sp. 301]
          Length = 158

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  KGF+ T++D ++ + RTGS+  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   ILEKGFVTTTLDTVINYTRTGSMWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRGSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|91789115|ref|YP_550067.1| NADH dehydrogenase subunit B [Polaromonas sp. JS666]
 gi|123164659|sp|Q127X3|NUOB_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|91698340|gb|ABE45169.1| NADH dehydrogenase subunit B [Polaromonas sp. JS666]
          Length = 159

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VFNEGFMTTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDMDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKM  ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMGPALRKVYDQMSEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ+KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQQKIRRTNTI 156


>gi|326489346|dbj|BAK01656.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326511367|dbj|BAJ87697.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 201

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 50  FVVSKVDDLMNWARRGSIWPMTFGLACCAVEMMHAGAARYDFDRFGVIFRPSPRQSDCMI 109

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 110 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 169

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 170 GCPPTAEALLYGVLQLQKKINR 191


>gi|253998384|ref|YP_003050447.1| NADH dehydrogenase subunit B [Methylovorus sp. SIP3-4]
 gi|313200460|ref|YP_004039118.1| NADH-quinone oxidoreductase subunit B [Methylovorus sp. MP688]
 gi|253985063|gb|ACT49920.1| NADH-quinone oxidoreductase, B subunit [Methylovorus sp. SIP3-4]
 gi|312439776|gb|ADQ83882.1| NADH-quinone oxidoreductase, B subunit [Methylovorus sp. MP688]
          Length = 158

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D ++ + RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTTLDTVINYTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|9652190|gb|AAF91434.1| NADH-ubiquinone oxidoreductase subunit PSST [Lupinus luteus]
          Length = 192

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 41  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 100

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 101 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 160

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 161 GCPPTAEALLYGLLQLQKKINR 182


>gi|91776412|ref|YP_546168.1| NADH-quinone oxidoreductase, B subunit [Methylobacillus flagellatus
           KT]
 gi|123380391|sp|Q1GZL0|NUOB_METFK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|91710399|gb|ABE50327.1| NADH dehydrogenase subunit B [Methylobacillus flagellatus KT]
          Length = 158

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D ++ + RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTTLDTVINYTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|88658003|ref|YP_507585.1| NADH dehydrogenase subunit B [Ehrlichia chaffeensis str. Arkansas]
 gi|123493072|sp|Q2GG48|NUOB_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|88599460|gb|ABD44929.1| NADH dehydrogenase I, B subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 179

 Score =  241 bits (614), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 125/150 (83%), Gaps = 4/150 (2%)

Query: 34  THKGFLVTSVDQLVT----WARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT    L+     WAR+ SL  MTFGLACCAVEMM  +  RYDL+R+G   RAS
Sbjct: 18  NHQGFMVTQFSDLINYISNWARSNSLWPMTFGLACCAVEMMHTAASRYDLDRYGVMFRAS 77

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 78  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 137

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVDIYVPGCPPTAEAL+YGI  LQ+KI R
Sbjct: 138 VPVDIYVPGCPPTAEALLYGIFCLQQKINR 167


>gi|121604331|ref|YP_981660.1| NADH dehydrogenase subunit B [Polaromonas naphthalenivorans CJ2]
 gi|218528003|sp|A1VM61|NUOB_POLNA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|120593300|gb|ABM36739.1| NADH dehydrogenase subunit B [Polaromonas naphthalenivorans CJ2]
          Length = 159

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A   RYD++RFG   R SPRQ
Sbjct: 6   VFKEGFVTTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKM  ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMGPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ+KIRR   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQQKIRRTNTI 156


>gi|253996972|ref|YP_003049036.1| NADH dehydrogenase subunit B [Methylotenera mobilis JLW8]
 gi|253983651|gb|ACT48509.1| NADH-quinone oxidoreductase, B subunit [Methylotenera mobilis JLW8]
          Length = 158

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D ++ + RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFVTTTLDTVINYTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLVNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|156048917|ref|XP_001590425.1| NADH-ubiquinone oxidoreductase [Sclerotinia sclerotiorum 1980]
 gi|154692564|gb|EDN92302.1| NADH-ubiquinone oxidoreductase [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 235

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 84  YALTTLDQIANWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 143

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+V+SMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 144 VAGTLTNKMAPALRQVYDQMPDPRWVVSMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 203

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQKK+R
Sbjct: 204 GCPPTSEALMYGIFQLQKKMR 224


>gi|217075608|gb|ACJ86164.1| unknown [Medicago truncatula]
          Length = 198

 Score =  240 bits (613), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WARTGS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 59  YVISKVDNLMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 118

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 119 VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 178

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPTAEAL+YG+L LQKKI
Sbjct: 179 GCPPTAEALLYGLLQLQKKI 198


>gi|302879341|ref|YP_003847905.1| NADH-quinone oxidoreductase, B subunit [Gallionella
           capsiferriformans ES-2]
 gi|302582130|gb|ADL56141.1| NADH-quinone oxidoreductase, B subunit [Gallionella
           capsiferriformans ES-2]
          Length = 160

 Score =  240 bits (613), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 113/151 (74%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  KG + T++D ++ + RTGSL  MTFGLACCAVEMMQA   RYDL+RFG   R SPRQ
Sbjct: 6   ILEKGVVTTTLDTIINYTRTGSLWPMTFGLACCAVEMMQAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMIVAGTLCNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YG++ LQ KI+R   +
Sbjct: 126 DIYVPGCPPTAEALLYGLIQLQNKIKRTNTI 156


>gi|327301805|ref|XP_003235595.1| NADH:ubiquinone oxidoreductase 19.3kD subunit [Trichophyton rubrum
           CBS 118892]
 gi|326462947|gb|EGD88400.1| NADH:ubiquinone oxidoreductase 19.3kD subunit [Trichophyton rubrum
           CBS 118892]
          Length = 227

 Score =  240 bits (613), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 76  YALTTLDQVANWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 135

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 136 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 195

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 196 GCPPTSEALMYGIFQLQRKMR 216


>gi|42520927|ref|NP_966842.1| NADH dehydrogenase subunit B [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58698296|ref|ZP_00373213.1| NADH-quinone oxidoreductase, B subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630974|ref|YP_002727765.1| NADH dehydrogenase I, B subunit [Wolbachia sp. wRi]
 gi|225631316|ref|ZP_03787991.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|81652220|sp|Q73G42|NUOB_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767799|sp|C0R4Y2|NUOB_WOLWR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|42410668|gb|AAS14776.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|58535169|gb|EAL59251.1| NADH-quinone oxidoreductase, B subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225590991|gb|EEH12198.1| NADH dehydrogenase I, B subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225592955|gb|ACN95974.1| NADH dehydrogenase I, B subunit [Wolbachia sp. wRi]
          Length = 168

 Score =  240 bits (613), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 133/164 (81%), Gaps = 8/164 (4%)

Query: 23  DADFSRISSEITHKGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           + D+ R   E    GFLVT      D ++ WAR+GSL  MTFGLACCAVEMM  +  RYD
Sbjct: 8   NDDWGRYKKE----GFLVTKFGDLTDYVMNWARSGSLWPMTFGLACCAVEMMHTASSRYD 63

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+R+G   RASPRQSDVMIVAGTLTNKMA+ALR+VYDQM +P+YVISMGSCANGGGYYHY
Sbjct: 64  LDRYGIMFRASPRQSDVMIVAGTLTNKMAAALRKVYDQMADPKYVISMGSCANGGGYYHY 123

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           SYSVVRGCDRIVPVD+YVPGCPPTAEAL+YG+L LQ KI+R  N
Sbjct: 124 SYSVVRGCDRIVPVDVYVPGCPPTAEALLYGMLCLQNKIKRTRN 167


>gi|18461218|dbj|BAB84415.1| putative NADH2 dehydrogenase (ubiquinone) chain PSST precursor
           [Oryza sativa Japonica Group]
 gi|125527525|gb|EAY75639.1| hypothetical protein OsI_03544 [Oryza sativa Indica Group]
 gi|222619176|gb|EEE55308.1| hypothetical protein OsJ_03280 [Oryza sativa Japonica Group]
          Length = 199

 Score =  240 bits (613), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 113/142 (79%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM A   RYD +RFG   R SPRQSD MI
Sbjct: 48  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHAGASRYDFDRFGVIFRPSPRQSDCMI 107

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 108 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 167

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 168 GCPPTAEALLYGVLQLQKKINR 189


>gi|296828066|ref|XP_002851269.1| NADH dehydrogenase iron-sulfur protein 7 [Arthroderma otae CBS
           113480]
 gi|238838823|gb|EEQ28485.1| NADH dehydrogenase iron-sulfur protein 7 [Arthroderma otae CBS
           113480]
          Length = 227

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 111/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 76  YALTTLDQVANWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 135

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 136 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 195

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 196 GCPPTSEALMYGIFQLQRKMR 216


>gi|257095318|ref|YP_003168959.1| NADH dehydrogenase subunit B [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047842|gb|ACV37030.1| NADH-quinone oxidoreductase, B subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 158

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ T+ D+L+ + RTGSL  M+FGLACCA+EM+ A   RYDL+RFG   R SPRQ
Sbjct: 6   ILQEGFVTTTADKLINYVRTGSLWPMSFGLACCAIEMIHAGCSRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVM+VAGTLTNKMA A+R+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDVMVVAGTLTNKMAPAMRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEALIYG++ LQ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALIYGLIQLQNKIRRTNTI 156


>gi|315056963|ref|XP_003177856.1| NADH dehydrogenase iron-sulfur protein 7 [Arthroderma gypseum CBS
           118893]
 gi|311339702|gb|EFQ98904.1| NADH dehydrogenase iron-sulfur protein 7 [Arthroderma gypseum CBS
           118893]
          Length = 227

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 111/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 76  YALTTLDQVANWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 135

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 136 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 195

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 196 GCPPTSEALMYGIFQLQRKMR 216


>gi|120609951|ref|YP_969629.1| NADH dehydrogenase subunit B [Acidovorax citrulli AAC00-1]
 gi|326316100|ref|YP_004233772.1| NAD(P)H-quinone oxidoreductase subunit K [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|218527970|sp|A1TLL7|NUOB_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|120588415|gb|ABM31855.1| NADH dehydrogenase subunit B [Acidovorax citrulli AAC00-1]
 gi|323372936|gb|ADX45205.1| NAD(P)H-quinone oxidoreductase subunit K [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 159

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 115/152 (75%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   VMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIGRFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLMIVAGTLCNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTHTI 156


>gi|328854118|gb|EGG03252.1| hypothetical protein MELLADRAFT_78587 [Melampsora larici-populina
           98AG31]
          Length = 258

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 110/155 (70%), Positives = 132/155 (85%), Gaps = 2/155 (1%)

Query: 27  SRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +++S E    G  ++++++D++V W R GS+  MTFGLACCAVEMM  +  RYD +R G 
Sbjct: 94  NQLSLETPRNGAEYVLSTIDKIVNWGRQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGV 153

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVR
Sbjct: 154 VFRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVR 213

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GCDRIVPVD+YVPGCPPTAEAL+YG+L LQ+K+RR
Sbjct: 214 GCDRIVPVDLYVPGCPPTAEALLYGMLQLQRKMRR 248


>gi|259482901|tpe|CBF77819.1| TPA: NADH-ubiquinone oxidoreductase subunit B, putative
           (AFU_orthologue; AFUA_4G05860) [Aspergillus nidulans
           FGSC A4]
          Length = 228

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 138/177 (77%), Gaps = 2/177 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T + ++  +GQS  +  +V  +    S E       +++T++DQ+  WAR  SL  MTFG
Sbjct: 41  TALERQGNAGQSLTASGQVRREVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFG 100

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR
Sbjct: 101 LACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR 160

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 161 WVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 217


>gi|226292374|gb|EEH47794.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Paracoccidioides
           brasiliensis Pb18]
          Length = 228

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 123/143 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 77  FALTTLDQVTNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 137 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R+ 
Sbjct: 197 GCPPTSEALMYGIFQLQKKMRQT 219


>gi|187477542|ref|YP_785566.1| NADH dehydrogenase subunit B [Bordetella avium 197N]
 gi|123513819|sp|Q2KV17|NUOB_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|115422128|emb|CAJ48652.1| NADH dehydrogenase I chain B [Bordetella avium 197N]
          Length = 158

 Score =  240 bits (612), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ TS D+ + WA+TGS+  MTFGLACCAVEMM A   RYDL++FG   R SPRQ
Sbjct: 6   ILKQGFITTSADKFINWAKTGSMWPMTFGLACCAVEMMHAGAARYDLDQFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKM  ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMGPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L +Q KIR    +
Sbjct: 126 DVYVPGCPPTAEALVYGLLQMQNKIRLTNTI 156


>gi|225680692|gb|EEH18976.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 228

 Score =  240 bits (612), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 123/143 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 77  FALTTLDQVTNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 137 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R+ 
Sbjct: 197 GCPPTSEALMYGIFQLQKKMRQT 219


>gi|242765651|ref|XP_002341018.1| NADH-ubiquinone oxidoreductase subunit B, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218724214|gb|EED23631.1| NADH-ubiquinone oxidoreductase subunit B, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 226

 Score =  240 bits (612), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 111/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 75  YALTTLDQIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 134

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 135 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 194

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQKK+R
Sbjct: 195 GCPPTSEALMYGIFQLQKKMR 215


>gi|241763289|ref|ZP_04761346.1| NADH-quinone oxidoreductase, B subunit [Acidovorax delafieldii 2AN]
 gi|241367564|gb|EER61851.1| NADH-quinone oxidoreductase, B subunit [Acidovorax delafieldii 2AN]
          Length = 159

 Score =  240 bits (612), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   VMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIGRFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLMIVAGTLCNKMAPALRKVYDQMSEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTNTI 156


>gi|170069760|ref|XP_001869339.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial [Culex
           quinquefasciatus]
 gi|167865642|gb|EDS29025.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial [Culex
           quinquefasciatus]
          Length = 212

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D ++ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+I
Sbjct: 61  WTVARLDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVII 120

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 121 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 180

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 181 GCPPTAEALLYGILQLQKKVKRMKTLQ 207


>gi|68171628|ref|ZP_00544995.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|67998949|gb|EAM85633.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Ehrlichia
           chaffeensis str. Sapulpa]
          Length = 182

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 125/150 (83%), Gaps = 4/150 (2%)

Query: 34  THKGFLVTSVDQLVT----WARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            H+GF+VT    L+     WAR+ SL  MTFGLACCAVEMM  +  RYDL+R+G   RAS
Sbjct: 18  NHQGFMVTQFSDLINYISNWARSNSLWPMTFGLACCAVEMMHTAASRYDLDRYGVMFRAS 77

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DVMIVAGTLTNKMA ALR+VYDQM EPRYVISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 78  PRQADVMIVAGTLTNKMAPALRKVYDQMTEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 137

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVDI+VPGCPPTAEAL+YGI  LQ+KI R
Sbjct: 138 VPVDIFVPGCPPTAEALLYGIFCLQQKINR 167


>gi|295673086|ref|XP_002797089.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb01]
 gi|226282461|gb|EEH38027.1| NADH dehydrogenase iron-sulfur protein [Paracoccidioides
           brasiliensis Pb01]
          Length = 228

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 122/143 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 77  FALTTLDQVTNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 137 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R  
Sbjct: 197 GCPPTSEALMYGIFQLQKKMRHT 219


>gi|312211788|emb|CBX91872.1| hypothetical protein [Leptosphaeria maculans]
          Length = 233

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 122/143 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 82  YALTTLDQVANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 141

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 142 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 201

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YGI  LQKK+R  
Sbjct: 202 GCPPTAEALMYGIFQLQKKMRHT 224


>gi|195117025|ref|XP_002003051.1| GI24498 [Drosophila mojavensis]
 gi|193913626|gb|EDW12493.1| GI24498 [Drosophila mojavensis]
          Length = 205

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (76%), Gaps = 4/180 (2%)

Query: 7   NQKIISGQSSCSL--EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLAC 64
            QK +     C +   K  + F R         + VT +D L+ W R GS+  MTFGLAC
Sbjct: 23  KQKTMHNVDKCGMPARKGYSPFGRKQPRWGE--WAVTRLDDLLNWGRKGSVWPMTFGLAC 80

Query: 65  CAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVI 124
           CAVEMM  + PRYD++RFG   RASPRQ+D++IVAGTLTNKMA ALR++YDQMPEPR+VI
Sbjct: 81  CAVEMMHIAGPRYDMDRFGVVFRASPRQTDLIIVAGTLTNKMAPALRKIYDQMPEPRWVI 140

Query: 125 SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YGIL LQKKI+R+  ++
Sbjct: 141 SMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALLYGILQLQKKIKRMRTLQ 200


>gi|194763060|ref|XP_001963652.1| GF19983 [Drosophila ananassae]
 gi|190629311|gb|EDV44728.1| GF19983 [Drosophila ananassae]
          Length = 217

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 144/196 (73%), Gaps = 14/196 (7%)

Query: 3   LTTVNQKIISGQSSCSLEKVDA-DFSRISSEITHKGFL-------------VTSVDQLVT 48
           + T N  + S  +S  +   +    ++ S EI  KG+              +  +D L+ 
Sbjct: 17  IATKNLPLTSALNSIWVRNQNTLTIAKTSEEIPKKGYSPFGNKQASAAEWSLARLDDLLN 76

Query: 49  WARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMAS 108
           W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTLTNKMA 
Sbjct: 77  WGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAP 136

Query: 109 ALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIY 168
           ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+Y
Sbjct: 137 ALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMY 196

Query: 169 GILLLQKKIRRVGNVK 184
           G+L LQKK++R+  ++
Sbjct: 197 GVLQLQKKVKRMKTLQ 212


>gi|149927542|ref|ZP_01915796.1| NADH dehydrogenase subunit B [Limnobacter sp. MED105]
 gi|149823815|gb|EDM83041.1| NADH dehydrogenase subunit B [Limnobacter sp. MED105]
          Length = 158

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 110/151 (72%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + ++GF+ T+ D+L+ W RTGSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLNEGFITTTADKLINWGRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L LQ KI+    +
Sbjct: 126 DVYVPGCPPTAEALMYGLLQLQNKIKTTSTI 156


>gi|34498210|ref|NP_902425.1| NADH dehydrogenase subunit B [Chromobacterium violaceum ATCC 12472]
 gi|81655254|sp|Q7NUE5|NUOB2_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|34104063|gb|AAQ60423.1| NADH-ubiquinone oxidoreductase, chain B [Chromobacterium violaceum
           ATCC 12472]
          Length = 171

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           S  +   GFL+T++D L   A++GSL +++FGLACCAVEMM A+  RYD++RFG+ PRA+
Sbjct: 3   SPSLEKDGFLLTTLDGLFGRAQSGSLWYLSFGLACCAVEMMHAAAARYDMDRFGWIPRAT 62

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAGTLTNKMA A+R+VYDQM EPRYV+SMGSCANGGGYYHYSY+VVRGCDRI
Sbjct: 63  PRQADLMIVAGTLTNKMAPAMRKVYDQMSEPRYVLSMGSCANGGGYYHYSYAVVRGCDRI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVD+YVPGCPPTAEAL+YG++ LQ KIRR
Sbjct: 123 VPVDVYVPGCPPTAEALLYGLMQLQAKIRR 152


>gi|332528752|ref|ZP_08404729.1| NADH dehydrogenase subunit B [Hylemonella gracilis ATCC 19624]
 gi|332041818|gb|EGI78167.1| NADH dehydrogenase subunit B [Hylemonella gracilis ATCC 19624]
          Length = 159

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   VLKEGFVTTSYDTVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIARFGSEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLMIVAGTLCNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+K+RR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKVRRTQTI 156


>gi|299751278|ref|XP_002911618.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Coprinopsis cinerea
           okayama7#130]
 gi|298409301|gb|EFI28124.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 223

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 111/172 (64%), Positives = 136/172 (79%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           +   S Q   ++ K  ++   + +      ++++++D++  WAR GS+  MTFGLACCAV
Sbjct: 42  ESATSTQPYTAIAKQGSNQLSLETPQNKAEYVLSTLDKVANWARQGSMWPMTFGLACCAV 101

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMM  +  RYD +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMG
Sbjct: 102 EMMHMAAARYDQDRLGVVFRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMG 161

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+K+RR
Sbjct: 162 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGMLQLQRKMRR 213


>gi|254468178|ref|ZP_05081584.1| NADH-quinone oxidoreductase, b subunit [beta proteobacterium KB13]
 gi|207086988|gb|EDZ64271.1| NADH-quinone oxidoreductase, b subunit [beta proteobacterium KB13]
          Length = 158

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D L+ + RT S+  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   LLEKGFITTNLDTLINYTRTNSMWPMTFGLACCAVEMMHAGASRYDLDRFGMVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLVNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL++G+L LQKKI+R   +
Sbjct: 126 DVYVPGCPPTAEALMFGLLQLQKKIKRTNTI 156


>gi|157117673|ref|XP_001658881.1| NADH-plastoquinone oxidoreductase [Aedes aegypti]
 gi|108875970|gb|EAT40195.1| NADH-plastoquinone oxidoreductase [Aedes aegypti]
          Length = 215

 Score =  239 bits (611), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D ++ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+I
Sbjct: 64  WTVARLDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVII 123

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 124 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 183

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 184 GCPPTAEALLYGILQLQKKVKRMKTLQ 210


>gi|291231230|ref|XP_002735571.1| PREDICTED: NADH dehydrogenase iron-sulfur protein 7,
           mitochondrial-like [Saccoglossus kowalevskii]
          Length = 220

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT +D L  WAR  S+  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSD MI
Sbjct: 69  YVVTGLDHLANWARRSSIWPMTFGLACCAVEMMHMAAPRYDMDRFGIVFRASPRQSDCMI 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRG DR+VPVDIYVP
Sbjct: 129 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGVDRVVPVDIYVP 188

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG L LQKKI+R
Sbjct: 189 GCPPTAEALLYGFLQLQKKIKR 210


>gi|66512193|ref|XP_392437.2| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 7, mitochondrial [Apis mellifera]
          Length = 223

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/173 (63%), Positives = 136/173 (78%)

Query: 12  SGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQ 71
           + +SS   +     +S   +      + V  +D ++ W R GS+  +TFGLACCAVEMM 
Sbjct: 46  TSESSLPEKAKKIPYSPFQNTNNLAEYAVARLDDILNWGRKGSIWPLTFGLACCAVEMMH 105

Query: 72  ASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN 131
            + PRYD++R+G   RASPRQ+DV+IVAGTLTNKMA ALR++YDQMPEPR+VISMGSCAN
Sbjct: 106 IAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCAN 165

Query: 132 GGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YGIL LQKKI+R+  ++
Sbjct: 166 GGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKIKRMKTLQ 218


>gi|321466001|gb|EFX76999.1| hypothetical protein DAPPUDRAFT_54753 [Daphnia pulex]
          Length = 167

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+I
Sbjct: 16  YAVARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVII 75

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 76  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 135

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 136 GCPPTAEALMYGILQLQKKVKRMKTIQ 162


>gi|255943669|ref|XP_002562602.1| Pc20g00390 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587337|emb|CAP85368.1| Pc20g00390 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 230

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 79  YALTTLDQIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 138

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVP
Sbjct: 139 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVP 198

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQKK+R
Sbjct: 199 GCPPTSEALMYGIFQLQKKMR 219


>gi|56478177|ref|YP_159766.1| NADH dehydrogenase subunit B [Aromatoleum aromaticum EbN1]
 gi|81356986|sp|Q5P1E9|NUOB_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|56314220|emb|CAI08865.1| NADH dehydrogenase I, chain B [Aromatoleum aromaticum EbN1]
          Length = 158

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS+D ++ W RTGSL  MTFGLACCAVEM+ A   RYDL+RFG   R SPRQ
Sbjct: 6   VFREGFVTTSLDAVINWTRTGSLWPMTFGLACCAVEMIHAGCARYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|320586540|gb|EFW99210.1| NADH-ubiquinone oxidoreductase subunit [Grosmannia clavigera
           kw1407]
          Length = 243

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++D +  W R GS   MTFGLACCAVEMM  S PRYD +RFG   RASPRQSDVMI
Sbjct: 92  YALTTLDIIANWGRQGSFWPMTFGLACCAVEMMHLSTPRYDQDRFGIIFRASPRQSDVMI 151

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVP
Sbjct: 152 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVP 211

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 212 GCPPTSEALMYGIFQLQRKMR 232


>gi|169604652|ref|XP_001795747.1| hypothetical protein SNOG_05340 [Phaeosphaeria nodorum SN15]
 gi|160706616|gb|EAT87731.2| hypothetical protein SNOG_05340 [Phaeosphaeria nodorum SN15]
          Length = 229

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 122/143 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 78  YALTTLDQMANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 137

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 138 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 197

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YGI  LQKK+R  
Sbjct: 198 GCPPTAEALMYGIFQLQKKMRHT 220


>gi|225559531|gb|EEH07814.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus G186AR]
          Length = 228

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 123/143 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 77  YALTTLDQVTNWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 137 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R  
Sbjct: 197 GCPPTSEALMYGIFQLQKKMRHT 219


>gi|46137521|ref|XP_390452.1| hypothetical protein FG10276.1 [Gibberella zeae PH-1]
          Length = 222

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/155 (72%), Positives = 129/155 (83%), Gaps = 3/155 (1%)

Query: 29  ISSEITHKGFL---VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + SEI  KG L   +T++D +  WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 59  LPSEIPPKGALQYALTTLDAVTNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 118

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVRG
Sbjct: 119 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYAVVRG 178

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           CDR+VPVD+YVPGCPPT+EAL+YGI  LQ+K+R+ 
Sbjct: 179 CDRVVPVDVYVPGCPPTSEALMYGIFQLQRKMRQT 213


>gi|260223141|emb|CBA33408.1| NADH-quinone oxidoreductase subunit B [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 158

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (85%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           + ++GF+ TS D +V WA+TGS+  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 4   VLNEGFVTTSYDSVVNWAKTGSIWPMTFGLACCAVEMMHAAAARYDISRFGSEVFRASPR 63

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 64  QSDLMIVAGTLCNKMAPALRKVYDQMSEPRWVLSMGSCANGGGYYHYSYSVVRGCDRIVP 123

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEAL+YGIL LQ+KIRR   +
Sbjct: 124 VDVYVPGCPPTAEALLYGILQLQQKIRRTQTI 155


>gi|119897688|ref|YP_932901.1| NADH dehydrogenase subunit B [Azoarcus sp. BH72]
 gi|218527941|sp|A1K5A9|NUOB1_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|119670101|emb|CAL94014.1| putative NADH-ubiquinone oxidoreductase chain B [Azoarcus sp. BH72]
          Length = 158

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  +GF+ TS+D ++ W RTGSL  MTFGLACCAVEM+ A   RYDL+RFG   R SPRQ
Sbjct: 6   VFREGFVTTSLDAVINWTRTGSLWPMTFGLACCAVEMIHAGCSRYDLDRFGVVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YGI+ LQ KI+R   +
Sbjct: 126 DVYVPGCPPTAEALLYGIIQLQNKIKRTNTI 156


>gi|167588033|ref|ZP_02380421.1| NADH dehydrogenase subunit B [Burkholderia ubonensis Bu]
          Length = 167

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           S  +   GF+VTS++ ++  ART SL +MTFGLACCAVEMM A+  RYD++RFG  PRAS
Sbjct: 5   SFTLEKDGFVVTSLEAVMAAARTNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRAS 64

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ D+MIV+GTLTNKMA A+R+VYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 65  PRQCDLMIVSGTLTNKMAPAMRKVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRI 124

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+YVPGCPPTAEALIYG++ LQ+KI
Sbjct: 125 VPVDVYVPGCPPTAEALIYGLMQLQRKI 152


>gi|33592008|ref|NP_879652.1| NADH dehydrogenase subunit B [Bordetella pertussis Tohama I]
 gi|33597910|ref|NP_885553.1| NADH dehydrogenase subunit B [Bordetella parapertussis 12822]
 gi|33602815|ref|NP_890375.1| NADH dehydrogenase subunit B [Bordetella bronchiseptica RB50]
 gi|81425363|sp|Q7VZQ4|NUOB_BORPE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81426432|sp|Q7W5A8|NUOB_BORPA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81429887|sp|Q7WCU0|NUOB_BORBR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|33571652|emb|CAE41145.1| NADH-ubiquinone oxidoreductase, 20 kDa subunit [Bordetella
           pertussis Tohama I]
 gi|33574339|emb|CAE38675.1| NADH-ubiquinone oxidoreductase, 20 kDa subunit [Bordetella
           parapertussis]
 gi|33577257|emb|CAE35814.1| NADH-ubiquinone oxidoreductase, 20 kDa subunit [Bordetella
           bronchiseptica RB50]
 gi|332381424|gb|AEE66271.1| NADH dehydrogenase subunit B [Bordetella pertussis CS]
          Length = 158

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I  +GF+ TS D+ + WA+TGS+  MTFGLACCAVEMM A   RYDL++FG   R SPRQ
Sbjct: 6   ILKQGFITTSADKFLNWAKTGSMWPMTFGLACCAVEMMHAGAARYDLDQFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKM  ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMGPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEAL+YG+L +Q KIR    +
Sbjct: 126 DVYVPGCPPTAEALVYGLLQMQNKIRLTNTI 156


>gi|225024124|ref|ZP_03713316.1| hypothetical protein EIKCOROL_00992 [Eikenella corrodens ATCC
           23834]
 gi|294669093|ref|ZP_06734179.1| NADH dehydrogenase, B subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|224943149|gb|EEG24358.1| hypothetical protein EIKCOROL_00992 [Eikenella corrodens ATCC
           23834]
 gi|291309085|gb|EFE50328.1| NADH dehydrogenase, B subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 159

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I +KGF+  S D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   ILNKGFITASADTVLNYVRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDR+VPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEALIYG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALIYGLIQLQGKIKR 152


>gi|319761763|ref|YP_004125700.1| NADH-quinone oxidoreductase, b subunit [Alicycliphilus
           denitrificans BC]
 gi|330826543|ref|YP_004389846.1| NADH-quinone oxidoreductase subunit B [Alicycliphilus denitrificans
           K601]
 gi|317116324|gb|ADU98812.1| NADH-quinone oxidoreductase, B subunit [Alicycliphilus
           denitrificans BC]
 gi|329311915|gb|AEB86330.1| NADH-quinone oxidoreductase, B subunit [Alicycliphilus
           denitrificans K601]
          Length = 159

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  +TFGLACCAVEMM A+  RYDL RFG    RASPR
Sbjct: 5   VMKEGFVTTSYDAVVNWAKTGSLWPVTFGLACCAVEMMHAAAARYDLARFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDR+VP
Sbjct: 65  QSDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRVVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTHTI 156


>gi|240272844|gb|EER36371.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus H143]
 gi|325088617|gb|EGC41927.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus H88]
          Length = 228

 Score =  239 bits (610), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 123/143 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 77  YALTTLDQVTNWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 137 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R  
Sbjct: 197 GCPPTSEALMYGIFQLQKKMRHT 219


>gi|160900611|ref|YP_001566193.1| NADH dehydrogenase subunit B [Delftia acidovorans SPH-1]
 gi|218527988|sp|A9BNB3|NUOB_DELAS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|160366195|gb|ABX37808.1| NADH-quinone oxidoreductase, B subunit [Delftia acidovorans SPH-1]
          Length = 159

 Score =  239 bits (609), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   VMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIGRFGSEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA A+R+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLMIVAGTLCNKMAPAMRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTHTI 156


>gi|218767068|ref|YP_002341580.1| NADH dehydrogenase subunit B [Neisseria meningitidis Z2491]
 gi|218527997|sp|A1INN9|NUOB_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|121051076|emb|CAM07346.1| NADH dehydrogenase I chain B [Neisseria meningitidis Z2491]
          Length = 160

 Score =  239 bits (609), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/151 (72%), Positives = 129/151 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMASALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMASALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 126 DVYVPGCPPTAEALIYGLIQLQQKIKRTSTI 156


>gi|58381050|ref|XP_310968.2| AGAP000170-PA [Anopheles gambiae str. PEST]
 gi|55243649|gb|EAA06474.3| AGAP000170-PA [Anopheles gambiae str. PEST]
          Length = 207

 Score =  239 bits (609), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 107/147 (72%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D ++ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+I
Sbjct: 56  WTVARLDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVII 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 116 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 175

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKK++R+  ++
Sbjct: 176 GCPPTAEALLYGVLQLQKKVKRMKTLQ 202


>gi|217424871|ref|ZP_03456368.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 576]
 gi|217392327|gb|EEC32352.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 576]
          Length = 264

 Score =  239 bits (609), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 105 LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 164

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 165 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 224

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 225 DVYVPGCPPTAEALVYGLMQLQRKV 249


>gi|329118899|ref|ZP_08247594.1| NADH-quinone oxidoreductase subunit B [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464927|gb|EGF11217.1| NADH-quinone oxidoreductase subunit B [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 159

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/147 (75%), Positives = 128/147 (87%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLNKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDR+VPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCDRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQGKIKR 152


>gi|194765258|ref|XP_001964744.1| GF23350 [Drosophila ananassae]
 gi|190615016|gb|EDV30540.1| GF23350 [Drosophila ananassae]
          Length = 211

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 129/154 (83%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
            + T   + V  +D L+ W R GS+  MTFGLACCAVEMM  + PRYD++R+G   RASP
Sbjct: 53  DQKTWAEWTVARLDDLLNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRYGVVFRASP 112

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+D MIVAGTLTNKMA A+R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 113 RQADCMIVAGTLTNKMAPAMRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 172

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVDIYVPGCPPTAEAL+YGIL LQKKI+R+  ++
Sbjct: 173 PVDIYVPGCPPTAEALMYGILQLQKKIKRMRTIQ 206


>gi|195024283|ref|XP_001985843.1| GH21035 [Drosophila grimshawi]
 gi|193901843|gb|EDW00710.1| GH21035 [Drosophila grimshawi]
          Length = 226

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 126/142 (88%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTL
Sbjct: 80  LDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTL 139

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPT
Sbjct: 140 TNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT 199

Query: 163 AEALIYGILLLQKKIRRVGNVK 184
           AEAL+YG+L LQKK++R+  ++
Sbjct: 200 AEALLYGVLQLQKKVKRMKTLQ 221


>gi|226348821|gb|ACO50725.1| NADH dehydrogenase subunit 10 [Micromonas pusilla CCMP1545]
          Length = 158

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/145 (76%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WAR GSL  MTFGLACCAVEMM     RYDL+RFG   R SPRQSDVMI
Sbjct: 7   YILSKVDALLNWARKGSLWPMTFGLACCAVEMMHTGAARYDLDRFGMIFRPSPRQSDVMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEP++VISMGSCANGGGYYHYSY+VVRGCDRIVPVD+YVP
Sbjct: 67  VAGTLTNKMAPALRKVYDQMPEPKWVISMGSCANGGGYYHYSYAVVRGCDRIVPVDVYVP 126

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL+YG+L LQKKI    N
Sbjct: 127 GCPPTAEALLYGLLQLQKKIHTQTN 151


>gi|222475044|ref|YP_002563459.1| NADH dehydrogenase I chain B (nuoB) [Anaplasma marginale str.
           Florida]
 gi|238065053|sp|B9KI91|NUOB_ANAMF RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|222419180|gb|ACM49203.1| NADH dehydrogenase I chain B (nuoB) [Anaplasma marginale str.
           Florida]
          Length = 190

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 5/151 (3%)

Query: 36  KGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           +GF+VT     VD +V W+R+GSL  MTFGLACCAVEMM  +  RYDL+R+G   RASPR
Sbjct: 35  RGFVVTKFSDLVDSVVRWSRSGSLWPMTFGLACCAVEMMHTAASRYDLDRYGVMFRASPR 94

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           Q+DVMIVAGTLTNKMA ALRRVYDQM EP+YVISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 95  QADVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSCANGGGYYHYSYSVVRGCDRIVP 154

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VDIYVPGCPPTAEAL+YGIL LQ+KI R GN
Sbjct: 155 VDIYVPGCPPTAEALLYGILCLQQKIIR-GN 184


>gi|124382496|ref|YP_001024763.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10229]
 gi|126447059|ref|YP_001079101.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10247]
 gi|124290516|gb|ABM99785.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10229]
 gi|126239913|gb|ABO03025.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei NCTC
           10247]
          Length = 322

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 163 LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 222

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 223 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 282

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 283 DVYVPGCPPTAEALVYGLMQLQRKV 307


>gi|255550832|ref|XP_002516464.1| NADH-plastoquinone oxidoreductase, putative [Ricinus communis]
 gi|223544284|gb|EEF45805.1| NADH-plastoquinone oxidoreductase, putative [Ricinus communis]
          Length = 215

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 64  YVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 123

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 124 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 183

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQK+I R
Sbjct: 184 GCPPTAEALLYGLLQLQKRINR 205


>gi|126454466|ref|YP_001067829.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1106a]
 gi|126228108|gb|ABN91648.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1106a]
          Length = 262

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 103 LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 162

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 163 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 222

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 223 DVYVPGCPPTAEALVYGLMQLQRKV 247


>gi|121597251|ref|YP_990264.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei SAVP1]
 gi|254355774|ref|ZP_04972053.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei
           2002721280]
 gi|121225049|gb|ABM48580.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei SAVP1]
 gi|148024745|gb|EDK82928.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei
           2002721280]
          Length = 293

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 134 LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 193

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 194 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 253

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 254 DVYVPGCPPTAEALVYGLMQLQRKV 278


>gi|195479097|ref|XP_002100761.1| GE15999 [Drosophila yakuba]
 gi|194188285|gb|EDX01869.1| GE15999 [Drosophila yakuba]
          Length = 221

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (87%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +  +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVA
Sbjct: 72  LARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVA 131

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGC
Sbjct: 132 GTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGC 191

Query: 160 PPTAEALIYGILLLQKKIRRVGNVK 184
           PPTAEAL+YG+L LQKK++R+  ++
Sbjct: 192 PPTAEALMYGVLQLQKKVKRMKTLQ 216


>gi|194765240|ref|XP_001964735.1| GF23344 [Drosophila ananassae]
 gi|190615007|gb|EDV30531.1| GF23344 [Drosophila ananassae]
          Length = 212

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/172 (66%), Positives = 137/172 (79%), Gaps = 3/172 (1%)

Query: 14  QSSCSLEKVDADFSRISSEITHKG-FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQA 72
           + +  LEK  A +S      +  G + V  +D LV W+R GS+  MTFGLACCAVEMM  
Sbjct: 38  EKNFGLEK--AKYSPFGGNQSSTGEWAVARLDDLVNWSRKGSIWPMTFGLACCAVEMMHF 95

Query: 73  SMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANG 132
           + PRYD++R+G   R SPRQ+D MIVAGTLTNKMA ALR+VYD+MP+PR+VISMGSCANG
Sbjct: 96  AAPRYDMDRYGVLFRESPRQADCMIVAGTLTNKMAPALRKVYDEMPDPRWVISMGSCANG 155

Query: 133 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI+R+  V+
Sbjct: 156 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGVLQLQKKIKRIKTVQ 207


>gi|195567032|ref|XP_002107079.1| GD15767 [Drosophila simulans]
 gi|194204476|gb|EDX18052.1| GD15767 [Drosophila simulans]
          Length = 221

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (75%), Gaps = 6/189 (3%)

Query: 2   GLTTVNQKIISGQSSCSLEKVDADFSRI------SSEITHKGFLVTSVDQLVTWARTGSL 55
            L  +N  ++  Q +  + +V  +  +       + + +   + +  +D L+ W R GS+
Sbjct: 28  ALPALNMVLVRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSI 87

Query: 56  MWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYD 115
             +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTLTNKMA ALR+VYD
Sbjct: 88  WPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYD 147

Query: 116 QMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQK 175
           QMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YG+L LQK
Sbjct: 148 QMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQK 207

Query: 176 KIRRVGNVK 184
           K++R+  ++
Sbjct: 208 KVKRMKTLQ 216


>gi|224284596|gb|ACN40031.1| unknown [Picea sitchensis]
          Length = 205

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++++ +D LV WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 54  YVISKIDALVNWARKGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 113

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGG YYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 114 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGRYYHYSYSVVRGCDRIVPVDIYVP 173

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 174 GCPPTAEALLYGLLQLQKKIHR 195


>gi|195357046|ref|XP_002044925.1| GM11675 [Drosophila sechellia]
 gi|194124267|gb|EDW46310.1| GM11675 [Drosophila sechellia]
          Length = 221

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (75%), Gaps = 6/189 (3%)

Query: 2   GLTTVNQKIISGQSSCSLEKVDADFSRI------SSEITHKGFLVTSVDQLVTWARTGSL 55
            L  +N  ++  Q +  + +V  +  +       + + +   + +  +D L+ W R GS+
Sbjct: 28  ALPALNMVLVRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSI 87

Query: 56  MWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYD 115
             +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTLTNKMA ALR+VYD
Sbjct: 88  WPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYD 147

Query: 116 QMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQK 175
           QMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YG+L LQK
Sbjct: 148 QMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQK 207

Query: 176 KIRRVGNVK 184
           K++R+  ++
Sbjct: 208 KVKRMKTLQ 216


>gi|158291431|ref|XP_312939.3| AGAP003231-PA [Anopheles gambiae str. PEST]
 gi|157017771|gb|EAA08348.4| AGAP003231-PA [Anopheles gambiae str. PEST]
          Length = 220

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D L+ W R GS+    FGLACCA+EMMQA+ PRYD++RFG   RASPRQ+D +I
Sbjct: 69  WTVARLDDLLNWGRKGSMWPTMFGLACCAMEMMQAAAPRYDIDRFGVLFRASPRQTDFII 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 129 VAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 188

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEALIYG+L LQKK++R+  V+
Sbjct: 189 GCPPTAEALIYGVLQLQKKVKRMKTVQ 215


>gi|18859983|ref|NP_573097.1| CG9172, isoform A [Drosophila melanogaster]
 gi|24642371|ref|NP_727921.1| CG9172, isoform B [Drosophila melanogaster]
 gi|7293168|gb|AAF48552.1| CG9172, isoform A [Drosophila melanogaster]
 gi|16769444|gb|AAL28941.1| LD31474p [Drosophila melanogaster]
 gi|22832322|gb|AAN09378.1| CG9172, isoform B [Drosophila melanogaster]
 gi|220944268|gb|ACL84677.1| CG9172-PA [synthetic construct]
 gi|220954204|gb|ACL89645.1| CG9172-PA [synthetic construct]
          Length = 221

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (75%), Gaps = 6/189 (3%)

Query: 2   GLTTVNQKIISGQSSCSLEKVDADFSRI------SSEITHKGFLVTSVDQLVTWARTGSL 55
            L  +N  ++  Q +  + +V  +  +       + + +   + +  +D L+ W R GS+
Sbjct: 28  ALPALNLALVRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSI 87

Query: 56  MWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYD 115
             +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTLTNKMA ALR+VYD
Sbjct: 88  WPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYD 147

Query: 116 QMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQK 175
           QMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YG+L LQK
Sbjct: 148 QMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQK 207

Query: 176 KIRRVGNVK 184
           K++R+  ++
Sbjct: 208 KVKRMKTLQ 216


>gi|48843827|gb|AAT47086.1| putative NADH-ubiquinone oxidoreductase 20 kDa subunit [Oryza
           sativa Japonica Group]
 gi|125553102|gb|EAY98811.1| hypothetical protein OsI_20756 [Oryza sativa Indica Group]
 gi|215769469|dbj|BAH01698.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 204

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 122/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYD +RFG   R SPRQSD MI
Sbjct: 53  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGASRYDFDRFGVIFRPSPRQSDCMI 112

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 113 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 172

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 173 GCPPTAEALLYGVLQLQKKINR 194


>gi|126442009|ref|YP_001060575.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 668]
 gi|126221502|gb|ABN85008.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 668]
          Length = 297

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 138 LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 197

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 198 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 257

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 258 DVYVPGCPPTAEALVYGLMQLQRKV 282


>gi|194894035|ref|XP_001977994.1| GG19352 [Drosophila erecta]
 gi|190649643|gb|EDV46921.1| GG19352 [Drosophila erecta]
          Length = 221

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (87%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +  +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVA
Sbjct: 72  LARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVA 131

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGC
Sbjct: 132 GTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGC 191

Query: 160 PPTAEALIYGILLLQKKIRRVGNVK 184
           PPTAEAL+YG+L LQKK++R+  ++
Sbjct: 192 PPTAEALMYGVLQLQKKVKRMKTLQ 216


>gi|114864804|gb|ABI83769.1| NADH-ubiquinone oxidoreductase [Anopheles funestus]
          Length = 207

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 127/146 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D ++ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+I
Sbjct: 56  WTVARLDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVII 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 116 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 175

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNV 183
           GCPPTAEAL+YG+L LQKK++R+  +
Sbjct: 176 GCPPTAEALLYGVLQLQKKVKRMKTL 201


>gi|312383258|gb|EFR28415.1| hypothetical protein AND_03673 [Anopheles darlingi]
          Length = 210

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/147 (72%), Positives = 128/147 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V  +D ++ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+DV+I
Sbjct: 59  WTVARLDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVII 118

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 119 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 178

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKK++R+  ++
Sbjct: 179 GCPPTAEALLYGVLQLQKKVKRMKTLQ 205


>gi|121609761|ref|YP_997568.1| NADH dehydrogenase subunit B [Verminephrobacter eiseniae EF01-2]
 gi|218528011|sp|A1WLP3|NUOB_VEREI RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|121554401|gb|ABM58550.1| NADH-quinone oxidoreductase, B subunit [Verminephrobacter eiseniae
           EF01-2]
          Length = 159

 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 1/150 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
             +  +GF+ TS D +V WA+TGSL  MTFGLACCAVEM+ ++  RYDL RFG    RAS
Sbjct: 3   ENVMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMIHSAAARYDLARFGAEVFRAS 62

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 63  PRQADLMIVAGTLCNKMAPALRKVYDQMSEPRWVLSMGSCANGGGYYHYSYSVVRGCDRI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVD+YVPGCPPTAEALIYGIL LQ+KIRR
Sbjct: 123 VPVDVYVPGCPPTAEALIYGILQLQQKIRR 152


>gi|328769253|gb|EGF79297.1| hypothetical protein BATDEDRAFT_12186 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 170

 Score =  238 bits (607), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/147 (74%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F++TS+D LV W RT S+  +TFGLACCAVEMM  + PRYD +R G   RASPRQ+DV+I
Sbjct: 19  FVLTSLDSLVNWNRTSSIWPLTFGLACCAVEMMHMATPRYDQDRLGIVFRASPRQADVLI 78

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR++YDQMP PR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 79  VAGTLTNKMAPALRKIYDQMPSPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 138

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPT+EAL+YG+L LQKK+RR   VK
Sbjct: 139 GCPPTSEALLYGVLQLQKKMRRERVVK 165


>gi|307109384|gb|EFN57622.1| hypothetical protein CHLNCDRAFT_21383 [Chlorella variabilis]
          Length = 160

 Score =  238 bits (607), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 123/147 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VDQLV WAR  S+  MTFGLACCAVEMM     RYD +RFG   R SPRQSD MI
Sbjct: 9   FVVSKVDQLVNWARRSSIWPMTFGLACCAVEMMHTGAARYDFDRFGIIFRPSPRQSDCMI 68

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+V+SMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVP
Sbjct: 69  VAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVP 128

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKKI R    +
Sbjct: 129 GCPPTAEALLYGMLQLQKKIGRTKKTQ 155


>gi|56416679|ref|YP_153753.1| NADH dehydrogenase subunit B [Anaplasma marginale str. St. Maries]
 gi|269958902|ref|YP_003328691.1| NADH dehydrogenase subunit B [Anaplasma centrale str. Israel]
 gi|81359162|sp|Q5PB32|NUOB_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|56387911|gb|AAV86498.1| NADH dehydrogenase I chain B [Anaplasma marginale str. St. Maries]
 gi|269848733|gb|ACZ49377.1| NADH dehydrogenase subunit B [Anaplasma centrale str. Israel]
          Length = 175

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 5/151 (3%)

Query: 36  KGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           +GF+VT     VD +V W+R+GSL  MTFGLACCAVEMM  +  RYDL+R+G   RASPR
Sbjct: 20  RGFVVTKFSDLVDSVVRWSRSGSLWPMTFGLACCAVEMMHTAASRYDLDRYGVMFRASPR 79

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           Q+DVMIVAGTLTNKMA ALRRVYDQM EP+YVISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 80  QADVMIVAGTLTNKMAPALRRVYDQMAEPKYVISMGSCANGGGYYHYSYSVVRGCDRIVP 139

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VDIYVPGCPPTAEAL+YGIL LQ+KI R GN
Sbjct: 140 VDIYVPGCPPTAEALLYGILCLQQKIIR-GN 169


>gi|225718368|gb|ACO15030.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Caligus clemensi]
          Length = 211

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/177 (65%), Positives = 137/177 (77%), Gaps = 9/177 (5%)

Query: 8   QKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAV 67
           +K ISGQ S           R+  +     ++V  +D L+ W R  SL  +TFGLACCAV
Sbjct: 39  EKDISGQYSPF---------RVDIKKNKAEYVVARLDDLINWGRKTSLWPLTFGLACCAV 89

Query: 68  EMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMG 127
           EMM  + PRYD++R+G   RASPRQ+DV++VAGTLTNKMA A R+VYDQM EPR+VISMG
Sbjct: 90  EMMHIAAPRYDMDRYGVVFRASPRQADVILVAGTLTNKMAPAFRKVYDQMLEPRWVISMG 149

Query: 128 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQKKI+R+ NV+
Sbjct: 150 SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGILQLQKKIKRMKNVQ 206


>gi|114777362|ref|ZP_01452359.1| NADH dehydrogenase subunit B [Mariprofundus ferrooxydans PV-1]
 gi|114552144|gb|EAU54646.1| NADH dehydrogenase subunit B [Mariprofundus ferrooxydans PV-1]
          Length = 158

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 111/151 (73%), Positives = 125/151 (82%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T+ D+L+  AR GSL  MTFGLACCAVEMM A   RYDL+RFG   R SPRQ
Sbjct: 6   VLEKGFITTTADKLINGARAGSLWPMTFGLACCAVEMMHAGASRYDLDRFGIVFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDVM+VAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHYSYSV RGCDRIVPV
Sbjct: 66  SDVMVVAGTLCNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+YG + LQ+KI+R   +
Sbjct: 126 DIYVPGCPPTAEALLYGFIQLQEKIKRTNTI 156


>gi|297604806|ref|NP_001056143.2| Os05g0533700 [Oryza sativa Japonica Group]
 gi|255676519|dbj|BAF18057.2| Os05g0533700 [Oryza sativa Japonica Group]
          Length = 154

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 122/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYD +RFG   R SPRQSD MI
Sbjct: 3   FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGASRYDFDRFGVIFRPSPRQSDCMI 62

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 63  VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 122

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 123 GCPPTAEALLYGVLQLQKKINR 144


>gi|195457088|ref|XP_002075420.1| GK17823 [Drosophila willistoni]
 gi|194171505|gb|EDW86406.1| GK17823 [Drosophila willistoni]
          Length = 229

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 126/142 (88%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTL
Sbjct: 83  LDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTL 142

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPT
Sbjct: 143 TNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT 202

Query: 163 AEALIYGILLLQKKIRRVGNVK 184
           AEAL+YG+L LQKK++R+  ++
Sbjct: 203 AEALMYGVLQLQKKVKRMKTLQ 224


>gi|145612619|ref|XP_001412223.1| mitochondrial NADH-ubiquinone oxidoreductase 20 kD subunit
           [Magnaporthe oryzae 70-15]
 gi|145019756|gb|EDK03984.1| mitochondrial NADH-ubiquinone oxidoreductase 20 kD subunit
           [Magnaporthe oryzae 70-15]
          Length = 222

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/172 (66%), Positives = 134/172 (77%), Gaps = 3/172 (1%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCA 66
           + + QSS  L + +     + S+   KG   + +T++D +  W R  SL  MTFGLACCA
Sbjct: 40  VPAAQSSTGLARPERKEVPLPSQEGTKGVVQYALTTLDIIANWGRQSSLWPMTFGLACCA 99

Query: 67  VEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISM 126
           VEMM  S PRYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISM
Sbjct: 100 VEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWVISM 159

Query: 127 GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           GSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 160 GSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQRKMR 211


>gi|330913880|ref|XP_003296406.1| hypothetical protein PTT_06502 [Pyrenophora teres f. teres 0-1]
 gi|311331451|gb|EFQ95498.1| hypothetical protein PTT_06502 [Pyrenophora teres f. teres 0-1]
          Length = 230

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/155 (72%), Positives = 127/155 (81%), Gaps = 3/155 (1%)

Query: 29  ISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + S+   KG   + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 67  LPSQEGKKGAMQYALTTLDQVANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 126

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RG
Sbjct: 127 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRG 186

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           CDRIVPVDIYVPGCPPTAEAL+YG+  LQKK+R  
Sbjct: 187 CDRIVPVDIYVPGCPPTAEALMYGVFQLQKKMRHT 221


>gi|332375552|gb|AEE62917.1| unknown [Dendroctonus ponderosae]
          Length = 227

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 107/147 (72%), Positives = 126/147 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D +I
Sbjct: 76  YALARLDDLLNWGRKGSVWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADCII 135

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 136 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 195

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKKI+R   V+
Sbjct: 196 GCPPTAEALMYGVLQLQKKIKRYNTVQ 222


>gi|261197135|ref|XP_002624970.1| NADH-ubiquinone oxidoreductase subunit B [Ajellomyces dermatitidis
           SLH14081]
 gi|239595600|gb|EEQ78181.1| NADH-ubiquinone oxidoreductase subunit B [Ajellomyces dermatitidis
           SLH14081]
 gi|239606495|gb|EEQ83482.1| NADH-ubiquinone oxidoreductase subunit B [Ajellomyces dermatitidis
           ER-3]
 gi|327356325|gb|EGE85182.1| NADH-ubiquinone oxidoreductase subunit B [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 223

 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 111/143 (77%), Positives = 122/143 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 72  FALTTLDQVTNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 131

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 132 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 191

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPT+EAL+YGI  LQKK+R  
Sbjct: 192 GCPPTSEALMYGIFQLQKKMRHT 214


>gi|116201555|ref|XP_001226589.1| hypothetical protein CHGG_08662 [Chaetomium globosum CBS 148.51]
 gi|88177180|gb|EAQ84648.1| hypothetical protein CHGG_08662 [Chaetomium globosum CBS 148.51]
          Length = 223

 Score =  238 bits (606), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 115/163 (70%), Positives = 131/163 (80%), Gaps = 3/163 (1%)

Query: 19  LEKVDADFSRISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMP 75
           L K D     + S+   KG   + +T++D +  WAR GSL  MTFGLACCAVEMM  S P
Sbjct: 50  LAKPDRKEVPLPSQEPTKGLVQYALTTLDIMTNWARQGSLWPMTFGLACCAVEMMHLSAP 109

Query: 76  RYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGY 135
           RYD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGY
Sbjct: 110 RYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGY 169

Query: 136 YHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           YHYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 170 YHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQRKMR 212


>gi|195123641|ref|XP_002006312.1| GI18637 [Drosophila mojavensis]
 gi|193911380|gb|EDW10247.1| GI18637 [Drosophila mojavensis]
          Length = 223

 Score =  237 bits (605), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 126/142 (88%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTL
Sbjct: 77  LDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTL 136

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPT
Sbjct: 137 TNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT 196

Query: 163 AEALIYGILLLQKKIRRVGNVK 184
           AEAL+YG+L LQKK++R+  ++
Sbjct: 197 AEALMYGVLQLQKKVKRMKTLQ 218


>gi|167841106|ref|ZP_02467790.1| NADH dehydrogenase subunit B [Burkholderia thailandensis MSMB43]
          Length = 167

 Score =  237 bits (605), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 8   LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 67

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 68  CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 127

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           DIYVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 128 DIYVPGCPPTAEALVYGLMQLQRKV 152


>gi|307611657|emb|CBX01348.1| NADH dehydrogenase I chain B [Legionella pneumophila 130b]
          Length = 146

 Score =  237 bits (605), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (88%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T+V++LV WAR+GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSDVMIVA
Sbjct: 1   MTTVEKLVGWARSGSMWPMTFGLACCAVEMMHVGAARYDLDRFGIIFRPSPRQSDVMIVA 60

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTL NKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVPGC
Sbjct: 61  GTLCNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGC 120

Query: 160 PPTAEALIYGILLLQKKIRR 179
           PPTAEAL+YGI+ LQ KIRR
Sbjct: 121 PPTAEALLYGIIQLQNKIRR 140


>gi|170092259|ref|XP_001877351.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647210|gb|EDR11454.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 191

 Score =  237 bits (605), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 2/154 (1%)

Query: 28  RISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           ++S E    G  ++++++D++  WAR GS+  MTFGLACCAVEMM  +  RYD +R G  
Sbjct: 28  QLSLEQPQNGAEYVLSTLDKVTNWARQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGVV 87

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRG
Sbjct: 88  FRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRG 147

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           CDRIVPVDIYVPGCPPTAEAL+YG+L LQ+K+RR
Sbjct: 148 CDRIVPVDIYVPGCPPTAEALLYGMLQLQRKMRR 181


>gi|195381615|ref|XP_002049543.1| GJ21650 [Drosophila virilis]
 gi|194144340|gb|EDW60736.1| GJ21650 [Drosophila virilis]
          Length = 223

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 126/142 (88%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTL
Sbjct: 77  LDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTL 136

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPPT
Sbjct: 137 TNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT 196

Query: 163 AEALIYGILLLQKKIRRVGNVK 184
           AEAL+YG+L LQKK++R+  ++
Sbjct: 197 AEALLYGVLQLQKKVKRMRTLQ 218


>gi|322694377|gb|EFY86208.1| mitochondrial NADH-ubiquinone oxidoreductase 20 kD subunit
           [Metarhizium acridum CQMa 102]
          Length = 367

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/153 (73%), Positives = 127/153 (83%), Gaps = 3/153 (1%)

Query: 29  ISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + SE   KG   + +T++D +  WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 204 LPSEEGTKGVVQYALTTLDVIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 263

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRG
Sbjct: 264 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRG 323

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           CDRIVPVDIYVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 324 CDRIVPVDIYVPGCPPTSEALMYGIFQLQRKMR 356


>gi|290562629|gb|ADD38710.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 211

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ W R  SL  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV++
Sbjct: 60  YVVARLDDLINWGRKTSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIL 119

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA A R+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 120 VAGTLTNKMAPAFRKVYDQMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 179

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R+ NV+
Sbjct: 180 GCPPTAEALMYGILQLQKKIKRMKNVQ 206


>gi|255067282|ref|ZP_05319137.1| NADH dehydrogenase, B subunit [Neisseria sicca ATCC 29256]
 gi|261364348|ref|ZP_05977231.1| NADH dehydrogenase, B subunit [Neisseria mucosa ATCC 25996]
 gi|261378539|ref|ZP_05983112.1| NADH dehydrogenase, B subunit [Neisseria cinerea ATCC 14685]
 gi|255048433|gb|EET43897.1| NADH dehydrogenase, B subunit [Neisseria sicca ATCC 29256]
 gi|269145089|gb|EEZ71507.1| NADH dehydrogenase, B subunit [Neisseria cinerea ATCC 14685]
 gi|288567612|gb|EFC89172.1| NADH dehydrogenase, B subunit [Neisseria mucosa ATCC 25996]
          Length = 160

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 126 DVYVPGCPPTAEALIYGLMQLQQKIKRTSTI 156


>gi|126002095|ref|XP_001352261.1| GA21592 [Drosophila pseudoobscura pseudoobscura]
 gi|195175510|ref|XP_002028490.1| GL16625 [Drosophila persimilis]
 gi|54640648|gb|EAL29409.1| GA21592 [Drosophila pseudoobscura pseudoobscura]
 gi|194103687|gb|EDW25730.1| GL16625 [Drosophila persimilis]
          Length = 220

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (87%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +  +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVA
Sbjct: 71  LARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVA 130

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGC
Sbjct: 131 GTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGC 190

Query: 160 PPTAEALIYGILLLQKKIRRVGNVK 184
           PPTAEAL+YG+L LQKK++R+  ++
Sbjct: 191 PPTAEALMYGVLQLQKKVKRMKTLQ 215


>gi|255956935|ref|XP_002569220.1| Pc21g22510 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590931|emb|CAP97148.1| Pc21g22510 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 222

 Score =  237 bits (604), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++TS+D +  WAR GSL  ++FGLACCAVEMM  SMPRYD +R G   RASPRQSDVMI
Sbjct: 71  YVLTSLDGIANWARQGSLWPLSFGLACCAVEMMHLSMPRYDQDRLGIIFRASPRQSDVMI 130

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRG DR++PVDIY+P
Sbjct: 131 VAGTVTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGVDRLIPVDIYLP 190

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YGI  LQKK+RR 
Sbjct: 191 GCPPTAEALMYGIFQLQKKMRRT 213


>gi|189196624|ref|XP_001934650.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187980529|gb|EDU47155.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 209

 Score =  237 bits (604), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/155 (72%), Positives = 127/155 (81%), Gaps = 3/155 (1%)

Query: 29  ISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + S+   KG   + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 46  LPSQEGKKGAMQYALTTLDQVANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 105

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RG
Sbjct: 106 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRG 165

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           CDRIVPVDIYVPGCPPTAEAL+YG+  LQKK+R  
Sbjct: 166 CDRIVPVDIYVPGCPPTAEALMYGVFQLQKKMRHT 200


>gi|85085876|ref|XP_957592.1| NADH:ubiquinone oxidoreductase 19.3kD subunit [Neurospora crassa
           OR74A]
 gi|6647651|sp|O47950|NDUS7_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 19.3 kDa subunit,
           mitochondrial; AltName: Full=Complex I-19.3kD;
           Short=CI-19.3kD; Flags: Precursor
 gi|2764632|emb|CAA04802.1| 19.3kD iron-sulfur subunit of mitochondrial complex I [Neurospora
           crassa]
 gi|28918685|gb|EAA28356.1| NADH:ubiquinone oxidoreductase 19.3kD subunit [Neurospora crassa
           OR74A]
 gi|40882330|emb|CAF06152.1| NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial
           precursor [Neurospora crassa]
          Length = 226

 Score =  236 bits (603), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++D +V WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 75  YALTTLDSIVNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 134

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 135 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 194

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 195 GCPPTSEALMYGIFQLQRKMR 215


>gi|29654738|ref|NP_820430.1| NADH dehydrogenase subunit B [Coxiella burnetii RSA 493]
 gi|153207226|ref|ZP_01945990.1| NADH dehydrogenase (ubiquinone), B subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706106|ref|YP_001423957.1| NADH dehydrogenase subunit B [Coxiella burnetii Dugway 5J108-111]
 gi|161830495|ref|YP_001597292.1| NADH dehydrogenase subunit B [Coxiella burnetii RSA 331]
 gi|165918784|ref|ZP_02218870.1| NADH dehydrogenase (ubiquinone), B subunit [Coxiella burnetii RSA
           334]
 gi|212212183|ref|YP_002303119.1| NADH dehydrogenase subunit B [Coxiella burnetii CbuG_Q212]
 gi|212218213|ref|YP_002305000.1| NADH dehydrogenase subunit B [Coxiella burnetii CbuK_Q154]
 gi|81628735|sp|Q83BQ6|NUOB_COXBU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527985|sp|A9KBK5|NUOB_COXBN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527986|sp|A9N8X2|NUOB_COXBR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238055289|sp|B6J695|NUOB_COXB1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238055290|sp|B6IZ46|NUOB_COXB2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|29542006|gb|AAO90944.1| NADH-quinone oxidoreductase chain B [Coxiella burnetii RSA 493]
 gi|120576714|gb|EAX33338.1| NADH dehydrogenase (ubiquinone), B subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355392|gb|ABS76854.1| NADH-quinone oxidoreductase chain B [Coxiella burnetii Dugway
           5J108-111]
 gi|161762362|gb|ABX78004.1| NADH dehydrogenase (ubiquinone), B subunit [Coxiella burnetii RSA
           331]
 gi|165917508|gb|EDR36112.1| NADH dehydrogenase (ubiquinone), B subunit [Coxiella burnetii RSA
           334]
 gi|212010593|gb|ACJ17974.1| NADH-quinone oxidoreductase chain B [Coxiella burnetii CbuG_Q212]
 gi|212012475|gb|ACJ19855.1| NADH-quinone oxidoreductase chain B [Coxiella burnetii CbuK_Q154]
          Length = 161

 Score =  236 bits (603), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 114/147 (77%), Positives = 128/147 (87%), Gaps = 1/147 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +T +GFL+TS+D L+ WAR+GSL  MTFGLACCAVEMMQ +  RYDL+RFG    R SPR
Sbjct: 5   LTKEGFLLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQCASSRYDLDRFGAGLFRPSPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSDVMIVAGTL NKMA ALR+VYDQM EPR+VISMGSCANGGGYYHY+YSVVRGCDRIVP
Sbjct: 65  QSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYAYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIR 178
           VD+YVPGCPPTAEAL YGI+ L+ KIR
Sbjct: 125 VDVYVPGCPPTAEALFYGIMQLRNKIR 151


>gi|15676166|ref|NP_273298.1| NADH dehydrogenase subunit B [Neisseria meningitidis MC58]
 gi|121634114|ref|YP_974359.1| NADH dehydrogenase subunit B [Neisseria meningitidis FAM18]
 gi|194099646|ref|YP_002002777.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae NCCP11945]
 gi|225077017|ref|ZP_03720216.1| hypothetical protein NEIFLAOT_02069 [Neisseria flavescens
           NRL30031/H210]
 gi|239999843|ref|ZP_04719767.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae 35/02]
 gi|240015002|ref|ZP_04721915.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae DGI18]
 gi|240081589|ref|ZP_04726132.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae FA19]
 gi|240113871|ref|ZP_04728361.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae MS11]
 gi|240116602|ref|ZP_04730664.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae PID18]
 gi|240118826|ref|ZP_04732888.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae PID1]
 gi|240122071|ref|ZP_04735033.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae PID24-1]
 gi|240124365|ref|ZP_04737321.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae PID332]
 gi|240126577|ref|ZP_04739463.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|241760743|ref|ZP_04758835.1| NADH-quinone oxidoreductase, b subunit [Neisseria flavescens SK114]
 gi|254494626|ref|ZP_05107797.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae 1291]
 gi|254805716|ref|YP_003083937.1| NADH dehydrogenase I chain B [Neisseria meningitidis alpha14]
 gi|260439637|ref|ZP_05793453.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae DGI2]
 gi|261379579|ref|ZP_05984152.1| NADH dehydrogenase, B subunit [Neisseria subflava NJ9703]
 gi|261400470|ref|ZP_05986595.1| NADH dehydrogenase, B subunit [Neisseria lactamica ATCC 23970]
 gi|268595653|ref|ZP_06129820.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268597685|ref|ZP_06131852.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae FA19]
 gi|268599937|ref|ZP_06134104.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae MS11]
 gi|268602271|ref|ZP_06136438.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID18]
 gi|268604537|ref|ZP_06138704.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID1]
 gi|268682992|ref|ZP_06149854.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID332]
 gi|268685157|ref|ZP_06152019.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae SK-92-679]
 gi|296313746|ref|ZP_06863687.1| NADH dehydrogenase, B subunit [Neisseria polysaccharea ATCC 43768]
 gi|304389067|ref|ZP_07371111.1| NADH-quinone oxidoreductase subunit B [Neisseria meningitidis ATCC
           13091]
 gi|313669285|ref|YP_004049569.1| NADH dehydrogenase I chain B [Neisseria lactamica ST-640]
 gi|319638815|ref|ZP_07993573.1| NADH dehydrogenase subunit I B [Neisseria mucosa C102]
 gi|81785111|sp|Q9K1C2|NUOB_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527996|sp|B4RPI3|NUOB_NEIG2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218527998|sp|A1KRS3|NUOB_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|7225464|gb|AAF40696.1| NADH dehydrogenase I, B subunit [Neisseria meningitidis MC58]
 gi|120865820|emb|CAM09552.1| NADH dehydrogenase I chain B [Neisseria meningitidis FAM18]
 gi|193934936|gb|ACF30760.1| NADH dehydrogenase I, B subunit [Neisseria gonorrhoeae NCCP11945]
 gi|224951574|gb|EEG32783.1| hypothetical protein NEIFLAOT_02069 [Neisseria flavescens
           NRL30031/H210]
 gi|226513666|gb|EEH63011.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae 1291]
 gi|241318924|gb|EER55450.1| NADH-quinone oxidoreductase, b subunit [Neisseria flavescens SK114]
 gi|254669258|emb|CBA08154.1| NADH dehydrogenase I chain B [Neisseria meningitidis alpha14]
 gi|261391774|emb|CAX49229.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B;
           NDH-1, chain B) [Neisseria meningitidis 8013]
 gi|268549042|gb|EEZ44460.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268551473|gb|EEZ46492.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae FA19]
 gi|268584068|gb|EEZ48744.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae MS11]
 gi|268586402|gb|EEZ51078.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID18]
 gi|268588668|gb|EEZ53344.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID1]
 gi|268623276|gb|EEZ55676.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae PID332]
 gi|268625441|gb|EEZ57841.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae SK-92-679]
 gi|269209729|gb|EEZ76184.1| NADH dehydrogenase, B subunit [Neisseria lactamica ATCC 23970]
 gi|284798053|gb|EFC53400.1| NADH dehydrogenase, B subunit [Neisseria subflava NJ9703]
 gi|296839669|gb|EFH23607.1| NADH dehydrogenase, B subunit [Neisseria polysaccharea ATCC 43768]
 gi|304336940|gb|EFM03130.1| NADH-quinone oxidoreductase subunit B [Neisseria meningitidis ATCC
           13091]
 gi|308388462|gb|ADO30782.1| NADH dehydrogenase I chain B [Neisseria meningitidis alpha710]
 gi|309379802|emb|CBX21578.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006747|emb|CBN88217.1| NADH dehydrogenase I chain B [Neisseria lactamica 020-06]
 gi|316985170|gb|EFV64122.1| NADH-quinone oxidoreductase, B subunit [Neisseria meningitidis
           H44/76]
 gi|317165131|gb|ADV08672.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae TCDC-NG08107]
 gi|317399719|gb|EFV80382.1| NADH dehydrogenase subunit I B [Neisseria mucosa C102]
 gi|319411275|emb|CBY91682.1| NADH-quinone oxidoreductase chain B (NADH dehydrogenase I, chain B;
           NDH-1, chain B) [Neisseria meningitidis WUE 2594]
 gi|325129040|gb|EGC51890.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           N1568]
 gi|325130970|gb|EGC53697.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           OX99.30304]
 gi|325131612|gb|EGC54319.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M6190]
 gi|325135045|gb|EGC57673.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M13399]
 gi|325137069|gb|EGC59665.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M0579]
 gi|325139133|gb|EGC61679.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           ES14902]
 gi|325141078|gb|EGC63581.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           CU385]
 gi|325143083|gb|EGC65430.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           961-5945]
 gi|325143153|gb|EGC65499.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           961-5945]
 gi|325145306|gb|EGC67584.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M01-240013]
 gi|325197528|gb|ADY92984.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           G2136]
 gi|325199445|gb|ADY94900.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           H44/76]
 gi|325202929|gb|ADY98383.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M01-240149]
 gi|325203359|gb|ADY98812.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M01-240355]
 gi|325205327|gb|ADZ00780.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           M04-240196]
 gi|325207273|gb|ADZ02725.1| NADH:ubiquinone dehydrogenase, B subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 160

 Score =  236 bits (603), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 126 DVYVPGCPPTAEALIYGLIQLQQKIKRTSTI 156


>gi|58267664|ref|XP_570988.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57227222|gb|AAW43681.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 250

 Score =  236 bits (603), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 111/155 (71%), Positives = 131/155 (84%), Gaps = 2/155 (1%)

Query: 27  SRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +++S E    G  ++++++D++V W R GS+  MTFGLACCAVEMM  +  RYD +R G 
Sbjct: 86  NQLSLETPRNGAEYVLSTLDKIVNWGRQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGV 145

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVR
Sbjct: 146 VFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVR 205

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GCDRIVPVDIYVPGCPPTAEAL+YG+L L +K+RR
Sbjct: 206 GCDRIVPVDIYVPGCPPTAEALLYGMLQLMRKMRR 240


>gi|134112065|ref|XP_775568.1| hypothetical protein CNBE2820 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258227|gb|EAL20921.1| hypothetical protein CNBE2820 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 250

 Score =  236 bits (603), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 111/155 (71%), Positives = 131/155 (84%), Gaps = 2/155 (1%)

Query: 27  SRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +++S E    G  ++++++D++V W R GS+  MTFGLACCAVEMM  +  RYD +R G 
Sbjct: 86  NQLSLETPRNGAEYVLSTLDKIVNWGRQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGV 145

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVR
Sbjct: 146 VFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVR 205

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GCDRIVPVDIYVPGCPPTAEAL+YG+L L +K+RR
Sbjct: 206 GCDRIVPVDIYVPGCPPTAEALLYGMLQLMRKMRR 240


>gi|313227729|emb|CBY22878.1| unnamed protein product [Oikopleura dioica]
          Length = 228

 Score =  236 bits (603), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 114/163 (69%), Positives = 130/163 (79%), Gaps = 2/163 (1%)

Query: 21  KVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           K +AD  RI        ++ T +D +  +    SL  MTFGLACCAVEMM  + PRYD++
Sbjct: 38  KREAD--RIKKFDNKVEYVTTKLDDIKNYISANSLWPMTFGLACCAVEMMHFAAPRYDMD 95

Query: 81  RFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSY 140
           RFG   RASPRQSD+MIVAGTL+NKMA ALRRVYDQMP PRYV+SMGSCANGGGYYHYSY
Sbjct: 96  RFGVVFRASPRQSDLMIVAGTLSNKMAPALRRVYDQMPFPRYVLSMGSCANGGGYYHYSY 155

Query: 141 SVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           SVVRG DRIVPVD+YVPGCPP+AEAL+YGILLLQKKI+R  NV
Sbjct: 156 SVVRGVDRIVPVDVYVPGCPPSAEALLYGILLLQKKIKRSANV 198


>gi|53717370|ref|YP_105287.1| NADH dehydrogenase subunit B [Burkholderia mallei ATCC 23344]
 gi|53720672|ref|YP_109658.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei K96243]
 gi|67640239|ref|ZP_00439053.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Burkholderia mallei GB8 horse 4]
 gi|134283174|ref|ZP_01769875.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 305]
 gi|167004154|ref|ZP_02269924.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei PRL-20]
 gi|167721386|ref|ZP_02404622.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei DM98]
 gi|167847462|ref|ZP_02472970.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei B7210]
 gi|167904433|ref|ZP_02491638.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei NCTC 13177]
 gi|242317299|ref|ZP_04816315.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1106b]
 gi|254175821|ref|ZP_04882480.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           10399]
 gi|254198551|ref|ZP_04904972.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei S13]
 gi|254203254|ref|ZP_04909616.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei FMH]
 gi|254208590|ref|ZP_04914939.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei JHU]
 gi|81607694|sp|Q63QG0|NUOB2_BURPS RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|81684518|sp|Q62DE1|NUOB2_BURMA RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|218528073|sp|A1UWB1|NUOB2_BURMS RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|218528074|sp|A3NZQ8|NUOB2_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|218528076|sp|A3NE04|NUOB2_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|218528078|sp|A3MFR5|NUOB2_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|218528079|sp|A2RYJ4|NUOB2_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|52211086|emb|CAH37074.1| putative NADH dehydrogenase [Burkholderia pseudomallei K96243]
 gi|52423340|gb|AAU46910.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           23344]
 gi|134245369|gb|EBA45462.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 305]
 gi|147746299|gb|EDK53377.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei FMH]
 gi|147751277|gb|EDK58345.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei JHU]
 gi|160696864|gb|EDP86834.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei ATCC
           10399]
 gi|169655291|gb|EDS87984.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei S13]
 gi|238520928|gb|EEP84384.1| NADH-quinone oxidoreductase chain b (nadh dehydrogenasei, chain b)
           (ndh-1, chain b) [Burkholderia mallei GB8 horse 4]
 gi|242140538|gb|EES26940.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1106b]
 gi|243060451|gb|EES42637.1| NADH-quinone oxidoreductase, B subunit [Burkholderia mallei PRL-20]
          Length = 167

 Score =  236 bits (602), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/145 (73%), Positives = 126/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 8   LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 67

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPV
Sbjct: 68  CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPV 127

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 128 DVYVPGCPPTAEALVYGLMQLQRKV 152


>gi|289614329|emb|CBI58839.1| unnamed protein product [Sordaria macrospora]
          Length = 230

 Score =  236 bits (602), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 3/153 (1%)

Query: 29  ISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           ++S+   KG   + +T++D +V WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 67  LASQEGTKGAVQYALTTLDSIVNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 126

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRG
Sbjct: 127 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRG 186

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           CDRIVPVD+YVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 187 CDRIVPVDVYVPGCPPTSEALMYGIFQLQRKMR 219


>gi|62263125|gb|AAX78129.1| unknown protein [synthetic construct]
          Length = 193

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/145 (76%), Positives = 123/145 (84%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
           +KGF+  S D L+ W RTGSL  +T GLACCAVEMM A   RYDL+RFG   R SPRQSD
Sbjct: 33  NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQSD 92

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           V+IVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRIVPVDI
Sbjct: 93  VLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 152

Query: 155 YVPGCPPTAEALIYGILLLQKKIRR 179
           YVPGCPPTAEAL+YGI+ LQ KI R
Sbjct: 153 YVPGCPPTAEALVYGIIQLQNKIIR 177


>gi|56707212|ref|YP_169108.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89257089|ref|YP_514451.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           holarctica LVS]
 gi|110669682|ref|YP_666239.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115315446|ref|YP_764169.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118498240|ref|YP_899290.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           novicida U112]
 gi|134301247|ref|YP_001121215.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156503303|ref|YP_001429368.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009481|ref|ZP_02274412.1| NADH-quinone oxidoreductase, b subunit family protein [Francisella
           tularensis subsp. holarctica FSC200]
 gi|187930989|ref|YP_001890973.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194324424|ref|ZP_03058197.1| NADH-quinone oxidoreductase, b subunit family [Francisella
           tularensis subsp. novicida FTE]
 gi|208780267|ref|ZP_03247609.1| NADH-quinone oxidoreductase, b subunit family [Francisella novicida
           FTG]
 gi|224456273|ref|ZP_03664746.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|241667716|ref|ZP_04755294.1| NADH dehydrogenase subunit B [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254368325|ref|ZP_04984343.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           holarctica 257]
 gi|254368966|ref|ZP_04984979.1| NADH-quinone oxidoreductase chain B 1 [Francisella tularensis
           subsp. holarctica FSC022]
 gi|254371428|ref|ZP_04987429.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373581|ref|ZP_04989067.1| NADH dehydrogenase I [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254375048|ref|ZP_04990528.1| hypothetical protein FTDG_01236 [Francisella novicida GA99-3548]
 gi|254874050|ref|ZP_05246760.1| NADH-quinone oxidoreductase chain B 1 [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254876260|ref|ZP_05248970.1| NADH-quinone oxidoreductase subunit B [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|290952990|ref|ZP_06557611.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313810|ref|ZP_06804383.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           holarctica URFT1]
 gi|81598108|sp|Q5NIN4|NUOB_FRATT RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|122324569|sp|Q0BK52|NUOB_FRATO RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|122500210|sp|Q2A1F1|NUOB_FRATH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|123169705|sp|Q14K37|NUOB_FRAT1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065148|sp|A7NEK9|NUOB_FRATF RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065149|sp|A0Q8H1|NUOB_FRATN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065150|sp|A4IVZ3|NUOB_FRATW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767793|sp|B2SEV0|NUOB_FRATM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|54114093|gb|AAV29680.1| NT02FT1737 [synthetic construct]
 gi|56603704|emb|CAG44665.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144920|emb|CAJ80268.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320015|emb|CAL08048.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115130345|gb|ABI83532.1| NADH dehydrogenase (ubiquinone) [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118424146|gb|ABK90536.1| NADH dehydrogenase I, B subunit [Francisella novicida U112]
 gi|134049024|gb|ABO46095.1| NADH dehydrogenase I subunit B [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134254133|gb|EBA53227.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           holarctica 257]
 gi|151569667|gb|EDN35321.1| hypothetical protein FTBG_01489 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151571305|gb|EDN36959.1| NADH dehydrogenase I [Francisella novicida GA99-3549]
 gi|151572766|gb|EDN38420.1| hypothetical protein FTDG_01236 [Francisella novicida GA99-3548]
 gi|156253906|gb|ABU62412.1| NADH-quinone oxidoreductase, subunit B [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|157121887|gb|EDO66057.1| NADH-quinone oxidoreductase chain B 1 [Francisella tularensis
           subsp. holarctica FSC022]
 gi|187711898|gb|ACD30195.1| NADH dehydrogenase I, B subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194321489|gb|EDX18974.1| NADH-quinone oxidoreductase, b subunit family [Francisella
           tularensis subsp. novicida FTE]
 gi|208743916|gb|EDZ90218.1| NADH-quinone oxidoreductase, b subunit family [Francisella novicida
           FTG]
 gi|254840049|gb|EET18485.1| NADH-quinone oxidoreductase chain B 1 [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254842281|gb|EET20695.1| NADH-quinone oxidoreductase subunit B [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|282158320|gb|ADA77711.1| NADH dehydrogenase subunit B [Francisella tularensis subsp.
           tularensis NE061598]
 gi|332184795|gb|AEE27049.1| NADH-ubiquinone oxidoreductase chain B [Francisella cf. novicida
           3523]
 gi|332678976|gb|AEE88105.1| NADH-ubiquinone oxidoreductase chain B [Francisella cf. novicida
           Fx1]
          Length = 158

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/145 (76%), Positives = 123/145 (84%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
           +KGF+  S D L+ W RTGSL  +T GLACCAVEMM A   RYDL+RFG   R SPRQSD
Sbjct: 7   NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQSD 66

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           V+IVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRIVPVDI
Sbjct: 67  VLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 126

Query: 155 YVPGCPPTAEALIYGILLLQKKIRR 179
           YVPGCPPTAEAL+YGI+ LQ KI R
Sbjct: 127 YVPGCPPTAEALVYGIIQLQNKIIR 151


>gi|221068611|ref|ZP_03544716.1| NADH-quinone oxidoreductase, B subunit [Comamonas testosteroni
           KF-1]
 gi|264677199|ref|YP_003277105.1| NADH-quinone oxidoreductase, B subunit [Comamonas testosteroni
           CNB-2]
 gi|299530743|ref|ZP_07044158.1| NADH dehydrogenase subunit B [Comamonas testosteroni S44]
 gi|220713634|gb|EED69002.1| NADH-quinone oxidoreductase, B subunit [Comamonas testosteroni
           KF-1]
 gi|262207711|gb|ACY31809.1| NADH-quinone oxidoreductase, B subunit [Comamonas testosteroni
           CNB-2]
 gi|298721259|gb|EFI62201.1| NADH dehydrogenase subunit B [Comamonas testosteroni S44]
          Length = 159

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/152 (73%), Positives = 128/152 (84%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGS+  MTFGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   VMKEGFVTTSYDTVVNWAKTGSIWPMTFGLACCAVEMMHAAAARYDIGRFGSEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
            SD+MIVAGTL NKMA A+R+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  HSDLMIVAGTLCNKMAPAMRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEALIYGI+ LQ+KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALIYGIIQLQQKIRRTHTI 156


>gi|195341209|ref|XP_002037203.1| GM12792 [Drosophila sechellia]
 gi|194131319|gb|EDW53362.1| GM12792 [Drosophila sechellia]
          Length = 204

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
            ++ T   +    +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RAS
Sbjct: 45  QNQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRAS 104

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+DV+IVAGTLTNKMA A R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI
Sbjct: 105 PRQADVLIVAGTLTNKMAPAFRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRI 164

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           VPVDIYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 165 VPVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQ 199


>gi|302753456|ref|XP_002960152.1| hypothetical protein SELMODRAFT_270168 [Selaginella moellendorffii]
 gi|302804466|ref|XP_002983985.1| hypothetical protein SELMODRAFT_156186 [Selaginella moellendorffii]
 gi|300148337|gb|EFJ14997.1| hypothetical protein SELMODRAFT_156186 [Selaginella moellendorffii]
 gi|300171091|gb|EFJ37691.1| hypothetical protein SELMODRAFT_270168 [Selaginella moellendorffii]
          Length = 200

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/143 (75%), Positives = 123/143 (86%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
            F+++ +D ++ + R GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD M
Sbjct: 48  NFVISKLDSVINYVRAGSIWPMTFGLACCAVEMMHTGAARYDLDRFGMIFRPSPRQSDCM 107

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGTLTNKMA ALRRVYDQMPEPR+V+SMGSCANGGGYYHYSY+VVRGCDRIVPVDIYV
Sbjct: 108 IVAGTLTNKMAPALRRVYDQMPEPRWVVSMGSCANGGGYYHYSYAVVRGCDRIVPVDIYV 167

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPPTAEAL+YG+L LQKKI+R
Sbjct: 168 PGCPPTAEALLYGLLQLQKKIKR 190


>gi|291042878|ref|ZP_06568619.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae DGI2]
 gi|291013312|gb|EFE05278.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae DGI2]
          Length = 197

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 43  VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 102

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 103 ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 162

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 163 DVYVPGCPPTAEALIYGLIQLQQKIKRTSTI 193


>gi|298370383|ref|ZP_06981699.1| NADH dehydrogenase (ubiquinone), B subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298281843|gb|EFI23332.1| NADH dehydrogenase (ubiquinone), B subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 197

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 43  VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 102

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 103 ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 162

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 163 DVYVPGCPPTAEALIYGLMQLQQKIKRTSTI 193


>gi|167627154|ref|YP_001677654.1| NADH dehydrogenase subunit B [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|238065146|sp|B0TWP5|NUOB_FRAP2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|167597155|gb|ABZ87153.1| NADH dehydrogenase (quinone) [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 158

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/145 (75%), Positives = 123/145 (84%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
           +KGF+  S D L+ W RTGSL  +T GLACCAVEMM A   RYDL+RFG   R SPRQSD
Sbjct: 7   NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQSD 66

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           V+IVAGTL NKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDI
Sbjct: 67  VLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDI 126

Query: 155 YVPGCPPTAEALIYGILLLQKKIRR 179
           YVPGCPPTAEAL+YGI+ LQ KI R
Sbjct: 127 YVPGCPPTAEALVYGIIQLQNKIIR 151


>gi|322711383|gb|EFZ02956.1| NADH-ubiquinone oxidoreductase 20 kD subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 316

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/153 (73%), Positives = 127/153 (83%), Gaps = 3/153 (1%)

Query: 29  ISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + SE   KG   + +T++D +  WAR  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 153 LPSEEGTKGVVQYALTTLDVIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 212

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRG
Sbjct: 213 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRG 272

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           CDRIVPVDIYVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 273 CDRIVPVDIYVPGCPPTSEALMYGIFQLQRKMR 305


>gi|59802071|ref|YP_208783.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae FA 1090]
 gi|240017450|ref|ZP_04723990.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae FA6140]
 gi|240129042|ref|ZP_04741703.1| NADH dehydrogenase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|268687420|ref|ZP_06154282.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae SK-93-1035]
 gi|293398111|ref|ZP_06642316.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae F62]
 gi|75355476|sp|Q5F616|NUOB_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|59718966|gb|AAW90371.1| putative NADH dehydrogenase I chain B [Neisseria gonorrhoeae FA
           1090]
 gi|268627704|gb|EEZ60104.1| NADH dehydrogenase subunit I B [Neisseria gonorrhoeae SK-93-1035]
 gi|291611374|gb|EFF40444.1| NADH-quinone oxidoreductase subunit B [Neisseria gonorrhoeae F62]
          Length = 160

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++   RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNHMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           D+YVPGCPPTAEALIYG++ LQ+KI+R   +
Sbjct: 126 DVYVPGCPPTAEALIYGLIQLQQKIKRTSTI 156


>gi|194906298|ref|XP_001981347.1| GG11669 [Drosophila erecta]
 gi|190655985|gb|EDV53217.1| GG11669 [Drosophila erecta]
          Length = 212

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/142 (76%), Positives = 125/142 (88%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D L+ W R GSL  MTFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+IVAGTL
Sbjct: 66  LDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTL 125

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA A R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT
Sbjct: 126 TNKMAPAFRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 185

Query: 163 AEALIYGILLLQKKIRRVGNVK 184
           AEAL+YGIL LQKK++R+  ++
Sbjct: 186 AEALMYGILQLQKKVKRMRTLQ 207


>gi|321259133|ref|XP_003194287.1| hypothetical protein CGB_E3580W [Cryptococcus gattii WM276]
 gi|317460758|gb|ADV22500.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 229

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (84%), Gaps = 2/155 (1%)

Query: 27  SRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +++S E    G  ++++++D++V W R GS+  MTFGLACCAVEMM  +  RYD +R G 
Sbjct: 65  NQLSLETPRNGAEYVLSTLDKIVNWGRQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGV 124

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY+VVR
Sbjct: 125 VFRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYAVVR 184

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GCDRIVPVDIYVPGCPPTAEAL+YG+L L +K+RR
Sbjct: 185 GCDRIVPVDIYVPGCPPTAEALLYGMLQLMRKMRR 219


>gi|88607775|ref|YP_505115.1| NADH dehydrogenase subunit B [Anaplasma phagocytophilum HZ]
 gi|123495312|sp|Q2GKI6|NUOB_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|88598838|gb|ABD44308.1| NADH dehydrogenase I, B subunit [Anaplasma phagocytophilum HZ]
          Length = 174

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 130/151 (86%), Gaps = 4/151 (2%)

Query: 36  KGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           +GF+VT     +++++ WAR+GSL  MTFGLACCAVEMM  +  RYDL+R+G   RASPR
Sbjct: 19  QGFVVTQFSDLIERVLKWARSGSLWPMTFGLACCAVEMMHTAASRYDLDRYGIMFRASPR 78

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           Q+DVMIVAGTLTNKMA ALRRVYDQM +P+YVISMGSCANGGGYYHYSYSVVRGCDR+VP
Sbjct: 79  QADVMIVAGTLTNKMAPALRRVYDQMADPKYVISMGSCANGGGYYHYSYSVVRGCDRVVP 138

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VDIYVPGCPPTAEAL+YG+L LQ+KI R G 
Sbjct: 139 VDIYVPGCPPTAEALLYGLLCLQQKILRNGQ 169


>gi|24651058|ref|NP_651698.1| CG2014 [Drosophila melanogaster]
 gi|7301791|gb|AAF56901.1| CG2014 [Drosophila melanogaster]
          Length = 212

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (83%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           ++ T   +    +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RASP
Sbjct: 54  NQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASP 113

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+DV+IVAGTLTNKMA A R++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 114 RQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 173

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVDIYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 174 PVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQ 207


>gi|195574757|ref|XP_002105350.1| GD21440 [Drosophila simulans]
 gi|194201277|gb|EDX14853.1| GD21440 [Drosophila simulans]
          Length = 212

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/154 (70%), Positives = 129/154 (83%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           ++ T   +    +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RASP
Sbjct: 54  NQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASP 113

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+DV+IVAGTLTNKMA A R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 114 RQADVLIVAGTLTNKMAPAFRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 173

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVDIYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 174 PVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQ 207


>gi|66770743|gb|AAY54683.1| IP08160p [Drosophila melanogaster]
          Length = 213

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (83%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           ++ T   +    +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RASP
Sbjct: 55  NQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASP 114

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+DV+IVAGTLTNKMA A R++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 115 RQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 174

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVDIYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 175 PVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQ 208


>gi|134079540|emb|CAK97016.1| unnamed protein product [Aspergillus niger]
          Length = 219

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 123/142 (86%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ DQ+V WAR GSL  ++FGLACCA+EMM  SMPRYD +R G   RASPRQSDVMIV
Sbjct: 69  VLTTFDQIVNWARQGSLWPLSFGLACCAIEMMHVSMPRYDQDRLGIIFRASPRQSDVMIV 128

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+TNKMA ALR+ YDQMPEPR+VISMGSCANGGGYYHYSYS+VRG DRIVPVD+Y+PG
Sbjct: 129 AGTVTNKMAPALRQCYDQMPEPRWVISMGSCANGGGYYHYSYSIVRGVDRIVPVDVYIPG 188

Query: 159 CPPTAEALIYGILLLQKKIRRV 180
           CPPTAEA +YG+  LQKKI+R 
Sbjct: 189 CPPTAEATLYGVFQLQKKIKRT 210


>gi|310800125|gb|EFQ35018.1| NADH-quinone oxidoreductase [Glomerella graminicola M1.001]
          Length = 201

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +TS+D +  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 50  YALTSLDVITNWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 109

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDR+VPVD+YVP
Sbjct: 110 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRVVPVDVYVP 169

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 170 GCPPTSEALMYGIFQLQRKMR 190


>gi|195503274|ref|XP_002098583.1| GE23857 [Drosophila yakuba]
 gi|194184684|gb|EDW98295.1| GE23857 [Drosophila yakuba]
          Length = 212

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/154 (70%), Positives = 128/154 (83%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
            + T   +    +D L+ W R GSL  +TFGLACCAVEMM  + PRYD++R+G   RASP
Sbjct: 54  DQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASP 113

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+DV+IVAGTLTNKMA A R+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRIV
Sbjct: 114 RQADVLIVAGTLTNKMAPAFRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIV 173

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVDIYVPGCPPTAEAL+YGIL LQKK++R+  ++
Sbjct: 174 PVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQ 207


>gi|268370120|ref|NP_001161241.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial [Nasonia vitripennis]
          Length = 217

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 125/143 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D L+ W R GS+  +TFGLACCAVEMM  + PRYD++RFG   RASPR +DV+I
Sbjct: 66  YAMARLDDLLNWGRKGSMWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRHADVII 125

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 126 VAGTVTNKMAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 185

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YG+L LQKK++R+
Sbjct: 186 GCPPTAEALLYGVLQLQKKVKRM 208


>gi|289741217|gb|ADD19356.1| NADH-ubiquinone oxidoreductase NUFS7/PSST/20 kDa subunit [Glossina
           morsitans morsitans]
          Length = 220

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D L+ W R  S+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+I
Sbjct: 69  WTMARLDDLLNWGRKSSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVII 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 129 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 188

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YG+L LQKK++R+  ++
Sbjct: 189 GCPPTAEALMYGVLQLQKKVKRMKTLQ 215


>gi|302679558|ref|XP_003029461.1| hypothetical protein SCHCODRAFT_69693 [Schizophyllum commune H4-8]
 gi|300103151|gb|EFI94558.1| hypothetical protein SCHCODRAFT_69693 [Schizophyllum commune H4-8]
          Length = 236

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 107/170 (62%), Positives = 133/170 (78%)

Query: 10  IISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +  GQS  ++    ++   + +      +++ + D++  WAR  S+  +TFGLACCAVEM
Sbjct: 57  VEKGQSFRAVVNAQSNQHSLETPQNKAEYVLATFDKIANWARQSSMWPVTFGLACCAVEM 116

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  +  RYD +R G   RASPRQS++MIVAGTLTNKMA ALR+VYDQMPEPR+V+SMGSC
Sbjct: 117 MHMAAARYDQDRLGIIFRASPRQSEIMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSC 176

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+K+RR
Sbjct: 177 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGMLQLQRKMRR 226


>gi|332968234|gb|EGK07311.1| NADH-quinone oxidoreductase subunit B [Kingella kingae ATCC 23330]
          Length = 159

 Score =  234 bits (598), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+  S D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLNKGFVTASADTVLNYVRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQGKIKR 152


>gi|302912562|ref|XP_003050728.1| hypothetical protein NECHADRAFT_60986 [Nectria haematococca mpVI
           77-13-4]
 gi|256731666|gb|EEU45015.1| hypothetical protein NECHADRAFT_60986 [Nectria haematococca mpVI
           77-13-4]
          Length = 223

 Score =  234 bits (598), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 122/141 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++D +  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 72  YALTTLDVIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 131

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+V+SMGSCANGGGYYHYSYSVVRGCDRIVPVD+YVP
Sbjct: 132 VAGTLTNKMAPALRQVYDQMPDPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVP 191

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 192 GCPPTSEALMYGIFQLQRKMR 212


>gi|83951739|ref|ZP_00960471.1| NADH dehydrogenase beta subunit [Roseovarius nubinhibens ISM]
 gi|83836745|gb|EAP76042.1| NADH dehydrogenase beta subunit [Roseovarius nubinhibens ISM]
          Length = 127

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (92%), Gaps = 1/126 (0%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTF + CCAVEMM  +MPRYD ERFGFAPRASPRQSDVMIVAGTLTNKMA ALR+VYDQM
Sbjct: 1   MTF-VCCCAVEMMHVAMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQM 59

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI
Sbjct: 60  PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKI 119

Query: 178 RRVGNV 183
           RR G +
Sbjct: 120 RRTGTI 125


>gi|328705672|ref|XP_001949063.2| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 7, mitochondrial-like isoform 1 [Acyrthosiphon
           pisum]
 gi|328705674|ref|XP_003242871.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 7, mitochondrial-like isoform 2 [Acyrthosiphon
           pisum]
 gi|239788027|dbj|BAH70710.1| ACYPI008241 [Acyrthosiphon pisum]
          Length = 218

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 132/169 (78%)

Query: 12  SGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQ 71
           + Q +   EK    +S          + V  +D ++ W R  SL  +TFGLACCAVEMM 
Sbjct: 41  ASQDTNIEEKPYRPYSPFQKTNNMAEYAVARLDDVLNWGRKHSLWPLTFGLACCAVEMMH 100

Query: 72  ASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN 131
            + PRYD++R+G   RASPRQ+D++IVAGTLTNKMA ALRRVYDQMP+P++VISMGSCAN
Sbjct: 101 IAAPRYDMDRYGVVFRASPRQADLIIVAGTLTNKMAPALRRVYDQMPDPKWVISMGSCAN 160

Query: 132 GGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           GGGYYHYSYSVVRGCDR++PVDIYVPGCPPTAEAL+YGIL LQKKI+R+
Sbjct: 161 GGGYYHYSYSVVRGCDRVIPVDIYVPGCPPTAEALMYGILQLQKKIKRM 209


>gi|71023639|ref|XP_762049.1| hypothetical protein UM05902.1 [Ustilago maydis 521]
 gi|46101614|gb|EAK86847.1| hypothetical protein UM05902.1 [Ustilago maydis 521]
          Length = 228

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 110/155 (70%), Positives = 127/155 (81%), Gaps = 2/155 (1%)

Query: 27  SRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           +++S E    G  ++++S+D++  WAR  S   MTFGLACCAVEMM  +  RYD +R G 
Sbjct: 64  NQLSLETPKNGVEYVLSSMDKMANWARQSSFWPMTFGLACCAVEMMHVATARYDQDRLGV 123

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSD MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVR
Sbjct: 124 VFRASPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVR 183

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           GCDRIVPVD+YVPGCPPTAEAL+YG L L +KIRR
Sbjct: 184 GCDRIVPVDLYVPGCPPTAEALLYGFLQLHRKIRR 218


>gi|149242844|ref|XP_001526472.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146450595|gb|EDK44851.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 224

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 2/179 (1%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFG 61
           T V  K        + +++  DF  +S +       + +TS+D +  WAR  S   +TFG
Sbjct: 37  TPVASKRYVSSKELTPKELPTDFPLMSQKTASSAVDYALTSLDTIANWARKSSFWPVTFG 96

Query: 62  LACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPR 121
           LACCAVEMM  S PRYD +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+P+
Sbjct: 97  LACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPK 156

Query: 122 YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           +VISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+  LQKK+ + 
Sbjct: 157 WVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALMYGVFQLQKKMMKT 215


>gi|91088057|ref|XP_967271.1| PREDICTED: similar to CG9172 CG9172-PA [Tribolium castaneum]
 gi|270012769|gb|EFA09217.1| hypothetical protein TcasGA2_TC006185 [Tribolium castaneum]
          Length = 202

 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (77%)

Query: 18  SLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           S E     +S          + +  +D L+ W R  S+  +TFGLACCAVEMM  + PRY
Sbjct: 31  STEVAPRPYSPFQKTSNLAEYSLARLDDLLNWGRKSSMWPLTFGLACCAVEMMHIAAPRY 90

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D++R+G   RASPRQ+DV+I+AGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYH
Sbjct: 91  DMDRYGVVFRASPRQADVIIIAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYH 150

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           YSYSVVRGCDRI+PVDIYVPGCPPTAEAL+YG+L LQKK++R   ++
Sbjct: 151 YSYSVVRGCDRIIPVDIYVPGCPPTAEALLYGVLQLQKKVKRYNALQ 197


>gi|119897120|ref|YP_932333.1| NADH-quinone oxidoreductase subunit B [Azoarcus sp. BH72]
 gi|218527969|sp|A1K3P1|NUOB2_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|119669533|emb|CAL93446.1| conserved hypothetical NADH-quinone oxidoreductase chain B
           [Azoarcus sp. BH72]
          Length = 159

 Score =  234 bits (596), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 104/143 (72%), Positives = 126/143 (88%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           GFL+T +D L    R+ S+ ++TFGLACCAVEMMQA+  RYD++RFG  PRASPRQ+D++
Sbjct: 10  GFLLTRLDTLCDMVRSNSMWYLTFGLACCAVEMMQAAASRYDMDRFGMIPRASPRQADLI 69

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGTLTNKMA A+R++YDQM EPRYVISMGSCANGGGYYHYSYSV RGCDRI+PVDIY+
Sbjct: 70  IVAGTLTNKMAPAIRKIYDQMAEPRYVISMGSCANGGGYYHYSYSVARGCDRILPVDIYI 129

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPPTAEAL+YG++ LQ K++R
Sbjct: 130 PGCPPTAEALLYGLIQLQNKLKR 152


>gi|171677913|ref|XP_001903907.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937025|emb|CAP61683.1| unnamed protein product [Podospora anserina S mat+]
          Length = 224

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 111/153 (72%), Positives = 127/153 (83%), Gaps = 3/153 (1%)

Query: 29  ISSEITHKGFL---VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           + S+   KGF+   +T++D +  W R  SL  MTFGLACCAVEMM  S PRYD +R G  
Sbjct: 61  LPSQEGTKGFVQYALTTLDIITNWGRQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGII 120

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQSDVMIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRG
Sbjct: 121 FRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRG 180

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           CDR+VPVD+YVPGCPPT+EAL+YGI  LQ+K+R
Sbjct: 181 CDRVVPVDVYVPGCPPTSEALMYGIFQLQRKMR 213


>gi|238023160|ref|ZP_04603586.1| hypothetical protein GCWU000324_03086 [Kingella oralis ATCC 51147]
 gi|237865543|gb|EEP66683.1| hypothetical protein GCWU000324_03086 [Kingella oralis ATCC 51147]
          Length = 159

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+  S D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLNKGFVTASADTVLNYVRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQGKIKR 152


>gi|237748890|ref|ZP_04579370.1| NADH-quinone oxidoreductase subunit B [Oxalobacter formigenes
           OXCC13]
 gi|229380252|gb|EEO30343.1| NADH-quinone oxidoreductase subunit B [Oxalobacter formigenes
           OXCC13]
          Length = 159

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ T++D  + W RTGS+  +TFGLACCA+EMM +SMPRYD++RFG   RASPRQ
Sbjct: 6   LMDKGFVTTTLDTAINWLRTGSVWPVTFGLACCAIEMMHSSMPRYDMDRFGTFFRASPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYH SYSVVRGCD+IVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVVSMGSCANGGGYYHDSYSVVRGCDKIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+Y ++ L+ KI+R   +
Sbjct: 126 DIYVPGCPPTAEALLYALIQLRTKIKRTSTI 156


>gi|301107944|ref|XP_002903054.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
 gi|262098172|gb|EEY56224.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
          Length = 205

 Score =  233 bits (595), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V+ VD LV W R  SL  +TFGLACCAVEMM ++  RYD ER G   RASPRQ+DVMI
Sbjct: 54  YVVSRVDDLVNWGRKSSLWPITFGLACCAVEMMHSAGSRYDFERMGMVFRASPRQTDVMI 113

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRRVYDQMPEPRYV+SMGSCANGGGYYHYSY+VVRG DR++PVDIYVP
Sbjct: 114 VAGTLTNKMAPALRRVYDQMPEPRYVVSMGSCANGGGYYHYSYAVVRGADRVIPVDIYVP 173

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL++G++ LQKK++
Sbjct: 174 GCPPTAEALLFGLMQLQKKVK 194


>gi|301107922|ref|XP_002903043.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
 gi|262098161|gb|EEY56213.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
          Length = 205

 Score =  233 bits (595), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V+ VD LV W R  SL  +TFGLACCAVEMM ++  RYD ER G   RASPRQ+DVMI
Sbjct: 54  YVVSRVDDLVNWGRKSSLWPITFGLACCAVEMMHSAGSRYDFERMGMVFRASPRQTDVMI 113

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRRVYDQMPEPRYV+SMGSCANGGGYYHYSY+VVRG DR++PVDIYVP
Sbjct: 114 VAGTLTNKMAPALRRVYDQMPEPRYVVSMGSCANGGGYYHYSYAVVRGADRVIPVDIYVP 173

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL++G++ LQKK++
Sbjct: 174 GCPPTAEALLFGLMQLQKKVK 194


>gi|325267311|ref|ZP_08133973.1| NADH-quinone oxidoreductase subunit B [Kingella denitrificans ATCC
           33394]
 gi|324981248|gb|EGC16898.1| NADH-quinone oxidoreductase subunit B [Kingella denitrificans ATCC
           33394]
          Length = 159

 Score =  233 bits (595), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+  S D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLNKGFVTASADTVLNYVRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQGKIKR 152


>gi|294788083|ref|ZP_06753327.1| NADH dehydrogenase (ubiquinone), B subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294484376|gb|EFG32059.1| NADH dehydrogenase (ubiquinone), B subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 159

 Score =  233 bits (594), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (85%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+  S D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLNKGFVTASADTVLNYVRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTLTNKMA ALRRVYDQM EPR+V+SMG+CANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  SDLMIVAGTLTNKMAPALRRVYDQMAEPRWVLSMGTCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPPTAEAL+YG++ LQ KI+R
Sbjct: 126 DVYVPGCPPTAEALLYGLIQLQGKIKR 152


>gi|255732844|ref|XP_002551345.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240131086|gb|EER30647.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 212

 Score =  233 bits (594), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 108/162 (66%), Positives = 129/162 (79%), Gaps = 2/162 (1%)

Query: 20  EKVDADFSRISSE--ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           + +  DF  +S +       +++TS+D +  WAR  S   +TFGLACCAVEMM  S PRY
Sbjct: 41  QTLPTDFPLMSEKKATNAADYVLTSLDAIANWARKSSFWPVTFGLACCAVEMMHVSAPRY 100

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+P++VISMGSCANGGGYYH
Sbjct: 101 DQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYH 160

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           YSYSVVRGCDR+VPVDIYVPGCPPTAEAL+YG+  LQKK+ +
Sbjct: 161 YSYSVVRGCDRVVPVDIYVPGCPPTAEALMYGVFQLQKKMMK 202


>gi|317033085|ref|XP_001394844.2| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7 [Aspergillus
           niger CBS 513.88]
          Length = 155

 Score =  233 bits (594), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ DQ+V WAR GSL  ++FGLACCA+EMM  SMPRYD +R G   RASPRQSDVMIV
Sbjct: 5   VLTTFDQIVNWARQGSLWPLSFGLACCAIEMMHVSMPRYDQDRLGIIFRASPRQSDVMIV 64

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+TNKMA ALR+ YDQMPEPR+VISMGSCANGGGYYHYSYS+VRG DRIVPVD+Y+PG
Sbjct: 65  AGTVTNKMAPALRQCYDQMPEPRWVISMGSCANGGGYYHYSYSIVRGVDRIVPVDVYIPG 124

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPPTAEA +YG+  LQKKI+R
Sbjct: 125 CPPTAEATLYGVFQLQKKIKR 145


>gi|89900287|ref|YP_522758.1| NADH dehydrogenase subunit B [Rhodoferax ferrireducens T118]
 gi|122479525|sp|Q21YC6|NUOB_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|89345024|gb|ABD69227.1| NADH-quinone oxidoreductase, B subunit [Rhodoferax ferrireducens
           T118]
          Length = 159

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 126/152 (82%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           I  +GF+ TS D ++ WA+TGSL  M+FGLACCAVEMM A+  RYD+ RFG    RASPR
Sbjct: 5   ILKEGFITTSYDSVMNWAKTGSLWPMSFGLACCAVEMMHAANARYDISRFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD++IVAGTL NKMA A R+VYDQM EPR VISMGSCANGGGYYHYSYSVVRGCDRIVP
Sbjct: 65  QSDLIIVAGTLCNKMAPAFRKVYDQMSEPRRVISMGSCANGGGYYHYSYSVVRGCDRIVP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           VD+YVPGCPPTAEAL+YGI+ LQ KIRR   +
Sbjct: 125 VDVYVPGCPPTAEALLYGIIQLQHKIRRTQTI 156


>gi|225712904|gb|ACO12298.1| NADH dehydrogenase iron-sulfur protein 7, mitochondrial precursor
           [Lepeophtheirus salmonis]
          Length = 211

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ W R  SL  +TFGLA CAVEMM  + PRYD++R+G   RASPRQ+DV++
Sbjct: 60  YVVARLDDLINWGRKTSLWPLTFGLAYCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIL 119

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA A R+VYDQM EPR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 120 VAGTLTNKMAPAFRKVYDQMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 179

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKKI+R+ NV+
Sbjct: 180 GCPPTAEALMYGILQLQKKIKRMKNVQ 206


>gi|241953755|ref|XP_002419599.1| NADH-ubiquinone oxidoreductase subunit, putative [Candida
           dubliniensis CD36]
 gi|223642939|emb|CAX43194.1| NADH-ubiquinone oxidoreductase subunit, putative [Candida
           dubliniensis CD36]
          Length = 218

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 127/157 (80%), Gaps = 2/157 (1%)

Query: 25  DFSRISSE--ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DF  +S +       +++TS+D +  WAR  S   +TFGLACCAVEMM  S PRYD +R 
Sbjct: 52  DFPLMSEKKATNAADYVLTSLDMIANWARKSSFWPVTFGLACCAVEMMHVSAPRYDQDRL 111

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+P++VISMGSCANGGGYYHYSYSV
Sbjct: 112 GIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSV 171

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VRGCDR++PVDIYVPGCPPTAEAL+YG+  LQKK+ +
Sbjct: 172 VRGCDRVIPVDIYVPGCPPTAEALMYGVFQLQKKMMK 208


>gi|126275592|ref|XP_001386878.1| NADH-ubiquinone oxidoreductase [Scheffersomyces stipitis CBS 6054]
 gi|126212747|gb|EAZ62855.1| NADH-ubiquinone oxidoreductase [Pichia stipitis CBS 6054]
          Length = 207

 Score =  232 bits (592), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 128/162 (79%), Gaps = 2/162 (1%)

Query: 20  EKVDADFSRISSEITHK--GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           + +  DF  +S +       + +TS+D +  WAR  S   +TFGLACCAVEMM  S PRY
Sbjct: 36  KALPTDFPLMSEKTASSPIDYALTSLDSIANWARKSSFWPVTFGLACCAVEMMHVSTPRY 95

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D +R G   RASPRQSD+MIVAGT+TNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYH
Sbjct: 96  DQDRLGIIFRASPRQSDIMIVAGTVTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYH 155

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           YSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+  LQKK+ +
Sbjct: 156 YSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGVFQLQKKMMK 197


>gi|6689660|emb|CAB65525.1| subunit NUKM of protein NADH:Ubiquinone Oxidoreductase (Complex I)
           [Yarrowia lipolytica]
          Length = 210

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 130/169 (76%), Gaps = 2/169 (1%)

Query: 12  SGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +G    S   +  DF   S +  +    + +T++D +  WAR GS   +TFGLACCAVEM
Sbjct: 31  AGTPRVSSSSMPTDFPLPSQQKPNSAVDYTLTTLDAVANWARQGSFWPVTFGLACCAVEM 90

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  S PRYD +R G   RASPRQSD+MIVAGTLTNKMA  LR+VYDQMPEPR+VISMGSC
Sbjct: 91  MHVSAPRYDQDRLGIIFRASPRQSDIMIVAGTLTNKMAPVLRQVYDQMPEPRWVISMGSC 150

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           ANGGGYYH+SYSVVRGCDRIVPVD+YVPGCPPT+EAL+YG+  LQ+K+R
Sbjct: 151 ANGGGYYHFSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGVFQLQRKMR 199


>gi|68472189|ref|XP_719890.1| potential mitochondrial Complex I, NUKM_20kd subunit [Candida
           albicans SC5314]
 gi|68472424|ref|XP_719773.1| potential mitochondrial Complex I, NUKM_20kd subunit [Candida
           albicans SC5314]
 gi|46441605|gb|EAL00901.1| potential mitochondrial Complex I, NUKM_20kd subunit [Candida
           albicans SC5314]
 gi|46441731|gb|EAL01026.1| potential mitochondrial Complex I, NUKM_20kd subunit [Candida
           albicans SC5314]
          Length = 223

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/163 (65%), Positives = 129/163 (79%), Gaps = 2/163 (1%)

Query: 20  EKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           + +  DF  +S +       +++TS+D +  WAR  S   +TFGLACCAVEMM  S PRY
Sbjct: 52  QTLPTDFPLMSEKKATNAADYVLTSLDMIANWARKSSFWPVTFGLACCAVEMMHVSAPRY 111

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+P++VISMGSCANGGGYYH
Sbjct: 112 DQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYH 171

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           YSYSVVRGCDR++PVDIYVPGCPPTAEAL+YG+  LQKK+ + 
Sbjct: 172 YSYSVVRGCDRVIPVDIYVPGCPPTAEALMYGVFQLQKKMMKT 214


>gi|238881092|gb|EEQ44730.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Candida albicans
           WO-1]
          Length = 226

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/163 (65%), Positives = 129/163 (79%), Gaps = 2/163 (1%)

Query: 20  EKVDADFSRISSE--ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           + +  DF  +S +       +++TS+D +  WAR  S   +TFGLACCAVEMM  S PRY
Sbjct: 55  QTLPTDFPLMSEKKATNAADYVLTSLDMIANWARKSSFWPVTFGLACCAVEMMHVSAPRY 114

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           D +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMP+P++VISMGSCANGGGYYH
Sbjct: 115 DQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYH 174

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           YSYSVVRGCDR++PVDIYVPGCPPTAEAL+YG+  LQKK+ + 
Sbjct: 175 YSYSVVRGCDRVIPVDIYVPGCPPTAEALMYGVFQLQKKMMKT 217


>gi|119172964|ref|XP_001239009.1| NADH-ubiquinone oxidoreductase subunit [Coccidioides immitis RS]
          Length = 213

 Score =  231 bits (590), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/176 (62%), Positives = 137/176 (77%), Gaps = 4/176 (2%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLA 63
           T + ++  S  S  +L+ V  D  +  + + H    +T+ D LV WAR GSL  ++FGLA
Sbjct: 32  TYIQRQPSSTWSGNALKPVKHDAEK-GAPLQH---FLTTTDNLVNWARQGSLWPLSFGLA 87

Query: 64  CCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYV 123
           CC VEMM ASMPRYD +R G   RASPRQ+DVM+VAGT+TNKMA ALR +YDQMP+P++V
Sbjct: 88  CCGVEMMSASMPRYDQDRLGIIFRASPRQADVMLVAGTVTNKMAPALRLLYDQMPDPKWV 147

Query: 124 ISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           ISMGSCANGGGYYHYSYSV+RG DRI+PVDIYVPGCPPT EAL+YG+ LLQK++R+
Sbjct: 148 ISMGSCANGGGYYHYSYSVLRGVDRIIPVDIYVPGCPPTPEALLYGVFLLQKRMRK 203


>gi|316969245|gb|EFV53373.1| NADH dehydrogenase I, B subunit [Trichinella spiralis]
          Length = 803

 Score =  231 bits (588), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 105/155 (67%), Positives = 127/155 (81%), Gaps = 5/155 (3%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F++++S      + +   D L+ WAR GSL  +TFGLACCA+EMM  + PRYD++RFG  
Sbjct: 356 FTKVNSA---AEYALARADDLINWARRGSLWPLTFGLACCAIEMMHFAAPRYDMDRFGIV 412

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRV--YDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
            RASPRQ+D MI+AGT+TNKMA ALRRV  YDQMP+P++VISMGSCANGGGYYHYSYSVV
Sbjct: 413 FRASPRQADCMIIAGTVTNKMAPALRRVNIYDQMPDPKWVISMGSCANGGGYYHYSYSVV 472

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RGCDRI+PVDIYVPGCPP+AEAL+Y  L LQKKI+
Sbjct: 473 RGCDRIIPVDIYVPGCPPSAEALLYAFLQLQKKIK 507


>gi|302904283|ref|XP_003049034.1| hypothetical protein NECHADRAFT_82494 [Nectria haematococca mpVI
           77-13-4]
 gi|256729969|gb|EEU43321.1| hypothetical protein NECHADRAFT_82494 [Nectria haematococca mpVI
           77-13-4]
          Length = 206

 Score =  231 bits (588), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 121/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V S+D +  WAR GSL  MTFGLACCAVEMM  + PRYD +RFGF  RASPR +D+MI
Sbjct: 55  YAVASLDIIANWARQGSLWPMTFGLACCAVEMMHIAGPRYDQDRFGFMFRASPRHADIMI 114

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQM +PR+VISMGSCANGGGYYHYSYSVVRG DRIVPVDIYVP
Sbjct: 115 VAGTVTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDIYVP 174

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPT EALIYG+  LQ+KIRR
Sbjct: 175 GCPPTCEALIYGMFQLQRKIRR 196


>gi|83775539|dbj|BAE65659.1| unnamed protein product [Aspergillus oryzae]
          Length = 172

 Score =  230 bits (586), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/156 (69%), Positives = 127/156 (81%), Gaps = 4/156 (2%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           A F+ ++SEI    F  T++DQLV WAR  SL  ++FGLACCAVEMMQ SMPRYD +R G
Sbjct: 11  ASFTELASEI----FSRTTIDQLVNWARQSSLWPLSFGLACCAVEMMQVSMPRYDQDRLG 66

Query: 84  FAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
              RASPRQSDVM+VAGT+TNKM  ALR+ YDQMP+P++VISMGSCANGGGYYHYSYSVV
Sbjct: 67  IIFRASPRQSDVMVVAGTVTNKMGPALRQCYDQMPDPKWVISMGSCANGGGYYHYSYSVV 126

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RG DRIVPVD+Y+PGCPPT EA + GI  LQKK+R 
Sbjct: 127 RGVDRIVPVDVYIPGCPPTPEAFLCGIFQLQKKMRH 162


>gi|320036960|gb|EFW18898.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Coccidioides
           posadasii str. Silveira]
          Length = 213

 Score =  230 bits (586), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 137/177 (77%), Gaps = 4/177 (2%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLA 63
           T + ++  S  +  +L+ V  D  +  + + H    +T+ D LV WAR GSL  ++FGLA
Sbjct: 32  TYIQRQPSSTWNGNALKPVKPDAEK-GAPLQH---FLTTTDNLVNWARQGSLWPLSFGLA 87

Query: 64  CCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYV 123
           CC +EMM ASMPRYD +R G   RASPRQ+DVM+VAGT+TNKMA ALR +YDQMP+P++V
Sbjct: 88  CCGLEMMSASMPRYDQDRLGIIFRASPRQADVMLVAGTVTNKMAPALRLLYDQMPDPKWV 147

Query: 124 ISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           ISMGSCANGGGYYHYSYSV+RG DRI+PVDIYVPGCPPT EAL+YG+ LLQK++R+ 
Sbjct: 148 ISMGSCANGGGYYHYSYSVLRGVDRIIPVDIYVPGCPPTPEALLYGVFLLQKRMRKT 204


>gi|303324039|ref|XP_003072007.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240111717|gb|EER29862.1| NADH-ubiquinone oxidoreductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
          Length = 213

 Score =  230 bits (586), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 137/177 (77%), Gaps = 4/177 (2%)

Query: 4   TTVNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLA 63
           T + ++  S  +  +L+ V  D  +  + + H    +T+ D LV WAR GSL  ++FGLA
Sbjct: 32  TYIQRQPSSTWNGNALKPVKPDAEK-GAPLQH---FLTTTDNLVNWARQGSLWPLSFGLA 87

Query: 64  CCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYV 123
           CC +EMM ASMPRYD +R G   RASPRQ+DVM+VAGT+TNKMA ALR +YDQMP+P++V
Sbjct: 88  CCGLEMMSASMPRYDQDRLGIIFRASPRQADVMLVAGTVTNKMAPALRLLYDQMPDPKWV 147

Query: 124 ISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           ISMGSCANGGGYYHYSYSV+RG DRI+PVDIYVPGCPPT EAL+YG+ LLQK++R+ 
Sbjct: 148 ISMGSCANGGGYYHYSYSVLRGVDRIIPVDIYVPGCPPTPEALLYGVFLLQKRMRKT 204


>gi|301107924|ref|XP_002903044.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
 gi|262098162|gb|EEY56214.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
          Length = 213

 Score =  230 bits (586), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + V+ +D LV W R  SL  ++FGLACCAVEMM A+  RYD ER G   RASPRQ+DVMI
Sbjct: 62  YAVSRLDDLVNWGRKSSLWPISFGLACCAVEMMHAAGSRYDFERMGMVFRASPRQTDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALRR+YDQMPEPRYV+S+GSCANGGGYYHYSY+V RG DR+VPVDIYVP
Sbjct: 122 VAGTLTNKMAPALRRIYDQMPEPRYVVSLGSCANGGGYYHYSYAVARGVDRVVPVDIYVP 181

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EALI+G++ LQKKI+
Sbjct: 182 GCPPTSEALIFGLMQLQKKIK 202


>gi|257437224|gb|ACV53599.1| NADH ubiqionone oxidoreductase chain B [Agrobacterium sp. ATCC
           31749]
          Length = 121

 Score =  230 bits (586), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 1/121 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVE-MMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           VTS D+L+TWARTGSLMWM FGLACCAVE +MQAS PRYD+ERFG APRASPRQSDVMIV
Sbjct: 1   VTSTDELITWARTGSLMWMQFGLACCAVEGLMQASGPRYDMERFGVAPRASPRQSDVMIV 60

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLTNKMA ALR+VYDQMPEPRYVISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVPG
Sbjct: 61  AGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVPG 120

Query: 159 C 159
           C
Sbjct: 121 C 121


>gi|237746750|ref|ZP_04577230.1| NADH-quinone oxidoreductase subunit B [Oxalobacter formigenes
           HOxBLS]
 gi|229378101|gb|EEO28192.1| NADH-quinone oxidoreductase subunit B [Oxalobacter formigenes
           HOxBLS]
          Length = 159

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/151 (69%), Positives = 127/151 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + +KGF+ T++D  + W RTGS+  ++FGLACCA+EMM +S  RYD++RFG   RASPRQ
Sbjct: 6   LLNKGFVTTTLDTAINWLRTGSVWPVSFGLACCAIEMMHSSASRYDMDRFGTFFRASPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD+MIVAGTL NKMA ALR+VYDQM EPR+V+SMGSCANGGGYYH SYSVVRGCDRIVPV
Sbjct: 66  SDLMIVAGTLCNKMAPALRKVYDQMAEPRWVVSMGSCANGGGYYHDSYSVVRGCDRIVPV 125

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           DIYVPGCPPTAEAL+Y ++ L+ KIRR   +
Sbjct: 126 DIYVPGCPPTAEALLYALMQLRGKIRRTSTI 156


>gi|302928116|ref|XP_003054637.1| hypothetical protein NECHADRAFT_73438 [Nectria haematococca mpVI
           77-13-4]
 gi|256735578|gb|EEU48924.1| hypothetical protein NECHADRAFT_73438 [Nectria haematococca mpVI
           77-13-4]
          Length = 221

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++D++  WAR GS   +TFGLACC +EMM  SMPRYD +R G   RASPRQSDVMI
Sbjct: 69  YALTTLDKIAAWARNGSFWPLTFGLACCGIEMMHVSMPRYDQDRLGIIFRASPRQSDVMI 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA+A+R  YDQMPEPR+VISMGSCANGGGYYHYSYSV+RG DRI+PVDIYVP
Sbjct: 129 VAGTVTNKMATAVRLCYDQMPEPRWVISMGSCANGGGYYHYSYSVLRGVDRILPVDIYVP 188

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+YG+  LQ+KIR
Sbjct: 189 GCPPTAEALMYGVFQLQRKIR 209


>gi|259486449|tpe|CBF84294.1| TPA: hypothetical protein ANIA_11251 [Aspergillus nidulans FGSC A4]
          Length = 211

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T  D L++WAR GS   ++F LACC VEMM  SMPRYD +R G   RASPRQ+DVMI
Sbjct: 60  YVLTKTDALISWARNGSFWPLSFALACCGVEMMHTSMPRYDQDRLGIIFRASPRQADVMI 119

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRG DRIVPVD+YVP
Sbjct: 120 VAGTLTNKMAPALRQLYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDVYVP 179

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPP  EAL+ GI  LQ+KIRR
Sbjct: 180 GCPPMPEALLQGIFTLQRKIRR 201


>gi|258568476|ref|XP_002584982.1| NADH-ubiquinone oxidoreductase 19.3 kDa subunit [Uncinocarpus
           reesii 1704]
 gi|237906428|gb|EEP80829.1| NADH-ubiquinone oxidoreductase 19.3 kDa subunit [Uncinocarpus
           reesii 1704]
          Length = 176

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 3/144 (2%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 22  FALTTLDQVANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 81

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSV RGCDRIVPVDIYVP
Sbjct: 82  VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVTRGCDRIVPVDIYVP 141

Query: 158 GC---PPTAEALIYGILLLQKKIR 178
           G    PPT+EAL+YGI  LQKK+R
Sbjct: 142 GSLKGPPTSEALMYGIFQLQKKMR 165


>gi|260940357|ref|XP_002614478.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238851664|gb|EEQ41128.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 208

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 105/142 (73%), Positives = 120/142 (84%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +TS+D +  WAR  S   +TFGLACCAVEMM  S PRYD +R G   RASPRQSD+MI
Sbjct: 57  YALTSLDAIAMWARKSSFWPVTFGLACCAVEMMHVSTPRYDQDRLGIIFRASPRQSDIMI 116

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQM +PR+VISMGSCANGGGYYHYSYSVVRGCDR+VPVDIYVP
Sbjct: 117 VAGTLTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVP 176

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+  LQKK+ +
Sbjct: 177 GCPPTAEALMYGVFQLQKKMMK 198


>gi|315051282|ref|XP_003175015.1| NADH-ubiquinone oxidoreductase subunit [Arthroderma gypseum CBS
           118893]
 gi|311340330|gb|EFQ99532.1| NADH-ubiquinone oxidoreductase subunit [Arthroderma gypseum CBS
           118893]
          Length = 191

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 126/160 (78%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           ++++        E T    +VT +DQ+  WAR GSL  + FGLACC VEMM  SMPRYDL
Sbjct: 22  KRLEVPLPSQGEEPTPLRHMVTKLDQITNWARQGSLWPLMFGLACCGVEMMALSMPRYDL 81

Query: 80  ERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           +R G   RASPRQ+DV+IV+GT+TNKM  ALR +YDQMP+P++VISMGSCANGGGYYHYS
Sbjct: 82  DRMGIIYRASPRQADVLIVSGTVTNKMGPALRLLYDQMPDPKWVISMGSCANGGGYYHYS 141

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           YSVVRG DR+VPVD+YVPGCPPTAEA +YGIL LQKKI R
Sbjct: 142 YSVVRGVDRLVPVDVYVPGCPPTAEAFMYGILQLQKKISR 181


>gi|270008238|gb|EFA04686.1| hypothetical protein TcasGA2_TC014482 [Tribolium castaneum]
          Length = 204

 Score =  228 bits (581), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 101/147 (68%), Positives = 127/147 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++  +D L+ W R  S+  +TFGLACCA+EMM  + PRYD++R+G   RASPRQ++V+I
Sbjct: 51  WVLARLDDLLNWGRKTSMWPLTFGLACCAIEMMHIAAPRYDMDRYGVVFRASPRQTEVII 110

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA++LR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 111 VAGTVTNKMAASLRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 170

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPPTAEAL+YGIL LQKK+ R   ++
Sbjct: 171 GCPPTAEALMYGILQLQKKVNRHNAIQ 197


>gi|332255974|ref|XP_003277096.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial-like [Nomascus leucogenys]
          Length = 156

 Score =  228 bits (580), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 116/126 (92%)

Query: 54  SLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRV 113
           SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMIVAGTLTNKMA ALR+V
Sbjct: 21  SLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKV 80

Query: 114 YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLL 173
           YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+PGCPPTAEAL+YGIL L
Sbjct: 81  YDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQL 140

Query: 174 QKKIRR 179
           Q+KI+R
Sbjct: 141 QRKIKR 146


>gi|242765656|ref|XP_002341019.1| NADH-ubiquinone oxidoreductase subunit B, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218724215|gb|EED23632.1| NADH-ubiquinone oxidoreductase subunit B, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 247

 Score =  228 bits (580), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 111/162 (68%), Positives = 123/162 (75%), Gaps = 21/162 (12%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR  SL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 75  YALTTLDQIANWARQSSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 134

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 135 VAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 194

Query: 158 GC---------------------PPTAEALIYGILLLQKKIR 178
           GC                     PPT+EAL+YGI  LQKK+R
Sbjct: 195 GCKFDILLMLKLSLILIERHLKGPPTSEALMYGIFQLQKKMR 236


>gi|242015738|ref|XP_002428504.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, putative [Pediculus
           humanus corporis]
 gi|212513138|gb|EEB15766.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, putative [Pediculus
           humanus corporis]
          Length = 214

 Score =  227 bits (579), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 100/141 (70%), Positives = 120/141 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++   D  + WAR  S+  +TFGLACCAVEMM  + PRYD++RFG   RASPRQ+D++I
Sbjct: 63  YVLARTDDFINWARKSSIFPLTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADLII 122

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LR++YDQM  P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 123 VAGTLTNKMAPLLRKIYDQMLSPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 182

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL+Y +LLLQKKI+
Sbjct: 183 GCPPTAEALLYAVLLLQKKIK 203


>gi|317158068|ref|XP_001826792.2| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7 [Aspergillus
           oryzae RIB40]
          Length = 190

 Score =  227 bits (579), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 107/156 (68%), Positives = 125/156 (80%), Gaps = 3/156 (1%)

Query: 27  SRISSEITHKG---FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           S I +  TH      ++T++DQLV WAR  SL  ++FGLACCAVEMMQ SMPRYD +R G
Sbjct: 25  SIIKTNGTHSNKAEHVLTTIDQLVNWARQSSLWPLSFGLACCAVEMMQVSMPRYDQDRLG 84

Query: 84  FAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVV 143
              RASPRQSDVM+VAGT+TNKM  ALR+ YDQMP+P++VISMGSCANGGGYYHYSYSVV
Sbjct: 85  IIFRASPRQSDVMVVAGTVTNKMGPALRQCYDQMPDPKWVISMGSCANGGGYYHYSYSVV 144

Query: 144 RGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RG DRIVPVD+Y+PGCPPT EA + GI  LQKK+R 
Sbjct: 145 RGVDRIVPVDVYIPGCPPTPEAFLCGIFQLQKKMRH 180


>gi|255941166|ref|XP_002561352.1| Pc16g10420 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211585975|emb|CAP93712.1| Pc16g10420 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 209

 Score =  227 bits (579), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G+L+ + DQLV W R GSL  ++FGLACC +EMM  SMPRYD +R G   RASPRQ+DVM
Sbjct: 58  GYLLYA-DQLVNWGRQGSLWPLSFGLACCGIEMMHTSMPRYDQDRLGIIFRASPRQADVM 116

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+ NKMA A+R++YDQMPEP++VISMGSCANGGGYYHYSY+VVRG DRIVPVDIYV
Sbjct: 117 IVAGTVVNKMAPAVRQLYDQMPEPKWVISMGSCANGGGYYHYSYNVVRGVDRIVPVDIYV 176

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPPTAEAL+ GI LLQKK+RR
Sbjct: 177 PGCPPTAEALLQGIFLLQKKMRR 199


>gi|149034570|gb|EDL89307.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_c
           [Rattus norvegicus]
          Length = 132

 Score =  227 bits (579), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQM
Sbjct: 1   MTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI
Sbjct: 61  PEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKI 120

Query: 178 RRVGNVK 184
           +R   +K
Sbjct: 121 KREQKLK 127


>gi|159124830|gb|EDP49948.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           fumigatus A1163]
          Length = 225

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/142 (72%), Positives = 123/142 (86%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ D L+ WAR GSL  ++FGLACC VEMM ASMPRYD +R G   RASPRQ+DVM+V
Sbjct: 75  ILTTTDSLINWARQGSLWPLSFGLACCGVEMMAASMPRYDQDRQGIIFRASPRQADVMLV 134

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+TNKMA ALR++YDQMP+P++VISMGSCANGGGYYH+SYSVVRG DR+VPVDIYVPG
Sbjct: 135 AGTVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYHHSYSVVRGVDRLVPVDIYVPG 194

Query: 159 CPPTAEALIYGILLLQKKIRRV 180
           CPPT EAL+YGIL L++KI R 
Sbjct: 195 CPPTPEALLYGILQLKRKIERT 216


>gi|72004758|ref|XP_780430.1| PREDICTED: similar to NADH-plastoquinone oxidoreductase
           [Strongylocentrotus purpuratus]
 gi|115948827|ref|XP_001196650.1| PREDICTED: similar to NADH-plastoquinone oxidoreductase
           [Strongylocentrotus purpuratus]
          Length = 132

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MT GLACCAVEMM  + PRYD++RFG   RASPRQSDVMIVAGTLTNKMA ALR+VYDQM
Sbjct: 1   MTLGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEPR+VISMGSCANGGGYYHYSY+VVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQKKI
Sbjct: 61  PEPRWVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVPGCPPTAEALLYGVLQLQKKI 120

Query: 178 RRVGNV 183
           +R  N+
Sbjct: 121 KRAQNI 126


>gi|50423781|ref|XP_460475.1| DEHA2F02552p [Debaryomyces hansenii CBS767]
 gi|49656144|emb|CAG88782.1| DEHA2F02552p [Debaryomyces hansenii]
          Length = 208

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/157 (66%), Positives = 125/157 (79%), Gaps = 2/157 (1%)

Query: 25  DFSRISSEITHK--GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERF 82
           DF  +S +       + +TS+D +  WAR  S   +TFGLACCAVEMM  S PRYD +R 
Sbjct: 42  DFPLMSQKTASAPVDYALTSLDAIANWARKSSFWPVTFGLACCAVEMMHVSTPRYDQDRL 101

Query: 83  GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           G   RASPRQSD+MIVAGT+TNKMA ALR+VYDQM +PR+VISMGSCANGGGYYHYSYSV
Sbjct: 102 GIIFRASPRQSDIMIVAGTVTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSV 161

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VRGCDR++PVD+YVPGCPPTAEAL+YG+  LQKK+ +
Sbjct: 162 VRGCDRLIPVDVYVPGCPPTAEALMYGVFQLQKKMMK 198


>gi|91083385|ref|XP_967426.1| PREDICTED: similar to NADH-ubiquinone oxidoreductase, partial
           [Tribolium castaneum]
          Length = 227

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 124/140 (88%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++  +D L+ W R  S+  +TFGLACCA+EMM  + PRYD++R+G   RASPRQ++V+I
Sbjct: 43  WVLARLDDLLNWGRKTSMWPLTFGLACCAIEMMHIAAPRYDMDRYGVVFRASPRQTEVII 102

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA++LR+VYDQMPEPR+VISMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 103 VAGTVTNKMAASLRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 162

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPTAEAL+YGIL LQKK+
Sbjct: 163 GCPPTAEALMYGILQLQKKV 182


>gi|29841262|gb|AAP06294.1| similar to probable NADH-ubiquinone oxidoreductase 20 kDa subunit
           precursor; complex I-20kC; CI-20KD [Schistosoma
           japonicum]
 gi|226470044|emb|CAX70303.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Schistosoma
           japonicum]
          Length = 207

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/147 (68%), Positives = 125/147 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F++T +D L  WAR  S+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D+MI
Sbjct: 56  FVLTRLDDLANWARKNSIYPLTFGLACCAVEMMHIAGPRYDMDRYGVVFRASPRQADLMI 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           V+GT+TNKMA ALRR+YDQM  P++VISMGSCANGGGYYHYSYSV+RGCDR++PVDIYVP
Sbjct: 116 VSGTVTNKMAPALRRIYDQMTHPKWVISMGSCANGGGYYHYSYSVLRGCDRVIPVDIYVP 175

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPP+AEAL+Y IL LQKKI+   +V+
Sbjct: 176 GCPPSAEALMYSILQLQKKIKSEKHVQ 202


>gi|307006579|gb|ADN23574.1| NADH-ubiquinone oxidoreductase NUFS7/PSST/20 kDa subunit [Hyalomma
           marginatum rufipes]
          Length = 182

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/144 (71%), Positives = 122/144 (84%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F +   D ++ W R  SL  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+DV+I
Sbjct: 31  FALARADDILAWGRKTSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVII 90

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQM EP++VIS GSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 91  VAGTVTNKMAPALRKVYDQMLEPKWVISTGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 150

Query: 158 GCPPTAEALIYGILLLQKKIRRVG 181
           GCPPTAEAL+YGIL LQ+KI+R+ 
Sbjct: 151 GCPPTAEALMYGILQLQRKIKRLN 174


>gi|226470042|emb|CAX70302.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Schistosoma
           japonicum]
 gi|226489138|emb|CAX74918.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Schistosoma
           japonicum]
          Length = 207

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/147 (68%), Positives = 125/147 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F++T +D L  WAR  S+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D+MI
Sbjct: 56  FVLTRLDDLANWARKNSIYPLTFGLACCAVEMMHIAGPRYDMDRYGVVFRASPRQADLMI 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           V+GT+TNKMA ALRR+YDQM  P++VISMGSCANGGGYYHYSYSV+RGCDR++PVDIYVP
Sbjct: 116 VSGTVTNKMAPALRRIYDQMTHPKWVISMGSCANGGGYYHYSYSVLRGCDRVIPVDIYVP 175

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPP+AEAL+Y IL LQKKI+   +V+
Sbjct: 176 GCPPSAEALMYSILQLQKKIKSEKHVQ 202


>gi|146421276|ref|XP_001486588.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390003|gb|EDK38161.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 210

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/142 (72%), Positives = 120/142 (84%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++TS+D +  WAR  S   +TFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 59  YVLTSLDTIANWARKSSFWPVTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDVMI 118

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKM  ALR+VYDQM +PR+VISMGSCANGGGYYHYSYSVVRGCDR++PVD+YVP
Sbjct: 119 VAGTVTNKMGPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSVVRGCDRLIPVDVYVP 178

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+  LQKK+ R
Sbjct: 179 GCPPTAEALMYGVFRLQKKMMR 200


>gi|320580734|gb|EFW94956.1| NADH-ubiquinone oxidoreductase subunit [Pichia angusta DL-1]
          Length = 193

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 116/140 (82%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +  TS D+L  WAR  S    TFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 41  YAFTSFDKLKNWARKSSFWPATFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDVMI 100

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQMP PR+VISMGSCANGGGYYHYSYSVVRG DRIVPVDIYVP
Sbjct: 101 VAGTVTNKMAPALRQVYDQMPYPRWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDIYVP 160

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPP++EAL+YGI  LQKKI
Sbjct: 161 GCPPSSEALMYGIFRLQKKI 180


>gi|156384021|ref|XP_001633130.1| predicted protein [Nematostella vectensis]
 gi|156220196|gb|EDO41067.1| predicted protein [Nematostella vectensis]
          Length = 209

 Score =  225 bits (573), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 123/142 (86%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G++VT +D LV W+R  SL  + FGLACC +EMM  + PRYD++RFG   RASPRQ DVM
Sbjct: 56  GYVVTKLDDLVNWSRRSSLWPLMFGLACCGIEMMHFAAPRYDMDRFGVVFRASPRQIDVM 115

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           +V+GT+TNKMA ALRR+YDQMPEPR+VIS+GSCAN GGYY++SYSVVRGCDRI+PVDIYV
Sbjct: 116 LVSGTVTNKMAPALRRLYDQMPEPRWVISVGSCANSGGYYYHSYSVVRGCDRIIPVDIYV 175

Query: 157 PGCPPTAEALIYGILLLQKKIR 178
           PGCPP+AEAL++G+L LQKK+R
Sbjct: 176 PGCPPSAEALLFGVLQLQKKVR 197


>gi|328353181|emb|CCA39579.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Pichia pastoris CBS
           7435]
          Length = 282

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +  T+ D++  WAR  S   MTFGLACCAVEMM  S PRYD +R G   RASPRQSD+MI
Sbjct: 130 YTFTTFDKMKNWARKSSFWPMTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMI 189

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQMP PR+VISMGSCANGGGYYHYSYSVVRG DRIVPVDIYVP
Sbjct: 190 VAGTVTNKMAPALRQVYDQMPYPRWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDIYVP 249

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPT+EAL+YG+  LQKK+
Sbjct: 250 GCPPTSEALMYGVFQLQKKM 269


>gi|254571403|ref|XP_002492811.1| hypothetical protein [Pichia pastoris GS115]
 gi|238032609|emb|CAY70632.1| Hypothetical protein PAS_chr3_0585 [Pichia pastoris GS115]
 gi|308152254|emb|CBI83546.1| NUKM (PSST) subunit of mitochondrial NADH:ubiquinone oxidoreductase
           (complex I) [Pichia pastoris]
          Length = 204

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +  T+ D++  WAR  S   MTFGLACCAVEMM  S PRYD +R G   RASPRQSD+MI
Sbjct: 52  YTFTTFDKMKNWARKSSFWPMTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMI 111

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+VYDQMP PR+VISMGSCANGGGYYHYSYSVVRG DRIVPVDIYVP
Sbjct: 112 VAGTVTNKMAPALRQVYDQMPYPRWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDIYVP 171

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPT+EAL+YG+  LQKK+
Sbjct: 172 GCPPTSEALMYGVFQLQKKM 191


>gi|119497569|ref|XP_001265543.1| NADH-ubiquinone oxidoreductase subunit B, putative [Neosartorya
           fischeri NRRL 181]
 gi|119413705|gb|EAW23646.1| NADH-ubiquinone oxidoreductase subunit B, putative [Neosartorya
           fischeri NRRL 181]
          Length = 226

 Score =  224 bits (570), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/142 (71%), Positives = 121/142 (85%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ D L+ WAR GS   + FGLACC VEMM ASMPRYD +R G   RASPRQ+DVMIV
Sbjct: 76  ILTTTDSLINWARQGSFWPLAFGLACCGVEMMAASMPRYDQDRQGIIFRASPRQADVMIV 135

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           +GT+TNKMA ALR++YDQMP+P++VISMGSCANGGGYYH+SYSVVRG DR+VPVDIYVPG
Sbjct: 136 SGTVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYHHSYSVVRGVDRLVPVDIYVPG 195

Query: 159 CPPTAEALIYGILLLQKKIRRV 180
           CPPT EAL+YGIL L++KI R 
Sbjct: 196 CPPTPEALLYGILQLKRKIERT 217


>gi|121714236|ref|XP_001274729.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           clavatus NRRL 1]
 gi|119402882|gb|EAW13303.1| NADH-ubiquinone oxidoreductase subunit B, putative [Aspergillus
           clavatus NRRL 1]
          Length = 225

 Score =  223 bits (569), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (85%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ D L+ WAR GSL  + FGLACC VEMM ASMPRYD +R G   RASPRQ+DVMIV
Sbjct: 75  ILTTTDALINWARQGSLWPLAFGLACCGVEMMAASMPRYDQDRQGIIFRASPRQADVMIV 134

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+TNKMA ALR++YDQMP+P++VISMGSCANGGGYYH+SYSVVRG DR+VPVDIYVPG
Sbjct: 135 AGTVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYHHSYSVVRGVDRLVPVDIYVPG 194

Query: 159 CPPTAEALIYGILLLQKKIR 178
           CPPT EAL+Y +  LQ+K+R
Sbjct: 195 CPPTPEALLYAVFQLQRKMR 214


>gi|296811983|ref|XP_002846329.1| NADH:ubiquinone oxidoreductase kD subunit [Arthroderma otae CBS
           113480]
 gi|238841585|gb|EEQ31247.1| NADH:ubiquinone oxidoreductase kD subunit [Arthroderma otae CBS
           113480]
          Length = 197

 Score =  223 bits (569), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (85%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T  DQ+  WAR GSL  +TFGLACC VEMM  SMPRYDL+R G   RASPRQ+DV+IV
Sbjct: 47  VLTKFDQIANWARQGSLWPLTFGLACCGVEMMAVSMPRYDLDRMGIFYRASPRQADVLIV 106

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           +GT+TNKM  A+R +YDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+YVPG
Sbjct: 107 SGTVTNKMGPAIRLLYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDVYVPG 166

Query: 159 CPPTAEALIYGILLLQKKIR 178
           CPPTAEA +YG+L LQKKI+
Sbjct: 167 CPPTAEAFLYGVLQLQKKIK 186


>gi|156351435|ref|XP_001622510.1| hypothetical protein NEMVEDRAFT_v1g220626 [Nematostella vectensis]
 gi|156209067|gb|EDO30410.1| predicted protein [Nematostella vectensis]
          Length = 133

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMIVAGTLTNKMA ALR+VYDQM
Sbjct: 1   MTFGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEPR+VISMGSCANGGGYYHYSYSVVRGCDR++PVDIYVPGCPPTAEAL+YG+L LQKK+
Sbjct: 61  PEPRWVISMGSCANGGGYYHYSYSVVRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKV 120

Query: 178 R 178
           R
Sbjct: 121 R 121


>gi|170592879|ref|XP_001901192.1| Probable NADH-ubiquinone oxidoreductase 20 kDa subunit,
           mitochondrialprecursor  [Brugia malayi]
 gi|158591259|gb|EDP29872.1| Probable NADH-ubiquinone oxidoreductase 20 kDa subunit,
           mitochondrialprecursor , putative [Brugia malayi]
          Length = 216

 Score =  223 bits (567), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (85%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VT +D L       SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMIVA
Sbjct: 67  VTRLDDLNNMIHRCSLWPMTFGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQSDVMIVA 126

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+TNKMA A+RRVYDQMPEP++VISMGSCANGGGYYHYSYSV++G DRI+PVDIYVPGC
Sbjct: 127 GTVTNKMAPAVRRVYDQMPEPKWVISMGSCANGGGYYHYSYSVLKGVDRIIPVDIYVPGC 186

Query: 160 PPTAEALIYGILLLQKKIRR 179
           PP+AEAL+YG+L LQKKI+R
Sbjct: 187 PPSAEALLYGVLQLQKKIKR 206


>gi|312077007|ref|XP_003141114.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 [Loa loa]
 gi|307763722|gb|EFO22956.1| NADH-ubiquinone oxidoreductase Fe-S protein 7 [Loa loa]
          Length = 204

 Score =  221 bits (564), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/144 (72%), Positives = 120/144 (83%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VT +D L       SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMIVA
Sbjct: 61  VTRLDDLNNMIHRSSLWPMTFGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQSDVMIVA 120

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+TNKMA A+RRVYDQMPEP++VISMGSCANGGGYYHYSYSV++G DRI+PVDIYVPGC
Sbjct: 121 GTVTNKMAPAVRRVYDQMPEPKWVISMGSCANGGGYYHYSYSVLKGVDRIIPVDIYVPGC 180

Query: 160 PPTAEALIYGILLLQKKIRRVGNV 183
           PP+AEAL+YG+L LQKK+   G V
Sbjct: 181 PPSAEALLYGVLQLQKKLSGNGRV 204


>gi|256088165|ref|XP_002580226.1| NADH-plastoquinone oxidoreductase [Schistosoma mansoni]
 gi|238665746|emb|CAZ36465.1| NADH-plastoquinone oxidoreductase, putative [Schistosoma mansoni]
          Length = 207

 Score =  221 bits (564), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +++T +D L  WAR  S+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D++I
Sbjct: 56  YVITRLDDLADWARKNSIYPLTFGLACCAVEMMHIAGPRYDMDRYGVVFRASPRQADLLI 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           V+GT+TNKMA AL R+Y QM +P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 116 VSGTVTNKMAPALHRIYSQMTQPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 175

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPP+AEAL+Y IL LQKKI+   + K
Sbjct: 176 GCPPSAEALMYSILQLQKKIKSEKHFK 202


>gi|299830273|ref|YP_003734437.1| NADH dehydrogenase subunit 10 [Paramecium caudatum]
 gi|299507832|emb|CAZ66816.1| NADH dehydrogenase subunit 10 [Paramecium caudatum]
          Length = 154

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 97/147 (65%), Positives = 124/147 (84%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL TS + L++WAR GS   +TFGLACCA+EMM A++ RYD +RFG   RA+PRQSD++I
Sbjct: 5   FLKTSANNLISWARQGSFWPLTFGLACCALEMMHATVSRYDFDRFGVIFRATPRQSDLII 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQ  +P++V+SMGSCANGGGYYHYSY+VV+GCD+I+PVDI+VP
Sbjct: 65  VAGTVTNKMAPALRRLYDQTADPKWVLSMGSCANGGGYYHYSYAVVKGCDKIIPVDIFVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPP+AEAL +G+L LQK + +  N K
Sbjct: 125 GCPPSAEALFFGVLQLQKTLMKTINEK 151


>gi|17509685|ref|NP_492445.1| NADH Ubiquinone oxidoreductase Fe-S protein family member (nduf-7)
           [Caenorhabditis elegans]
 gi|3024249|sp|Q94360|NDUS7_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|3880584|emb|CAB02132.1| C. elegans protein W10D5.2, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 199

 Score =  221 bits (563), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D ++  A+ GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D++ 
Sbjct: 48  YALARLDDVLNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIF 107

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQMPE ++VISMGSCANGGGYYHY+YSV+RGCDR++PVDIYVP
Sbjct: 108 VAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVP 167

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI+R
Sbjct: 168 GCPPTAEALLYGVLQLQKKIKR 189


>gi|302833603|ref|XP_002948365.1| NADH:ubiquinone oxidoreductase subunit 10 [Volvox carteri f.
           nagariensis]
 gi|300266585|gb|EFJ50772.1| NADH:ubiquinone oxidoreductase subunit 10 [Volvox carteri f.
           nagariensis]
          Length = 164

 Score =  221 bits (563), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD ++ WAR GS+  MTFGLACCAVEMM A   RYDL+RFG   R SPRQSD MI
Sbjct: 13  FVVSKVDNVINWARAGSIWPMTFGLACCAVEMMHAGASRYDLDRFGIIFRPSPRQSDCMI 72

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEP++V+SMGSCANGGGYYHYSY+VVRGCDR+VPVD+YVP
Sbjct: 73  VAGTLTNKMAPALRKVYDQMPEPKWVVSMGSCANGGGYYHYSYAVVRGCDRVVPVDVYVP 132

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAE L+YG+L LQKKI R
Sbjct: 133 GCPPTAEGLLYGLLQLQKKIYR 154


>gi|268566427|ref|XP_002639719.1| Hypothetical protein CBG12445 [Caenorhabditis briggsae]
 gi|300681044|sp|A8XFG2|NDUS7_CAEBR RecName: Full=Probable NADH dehydrogenase [ubiquinone] iron-sulfur
           protein 7, mitochondrial; Flags: Precursor
 gi|187029568|emb|CAP31423.1| CBR-NDUF-7 protein [Caenorhabditis briggsae AF16]
          Length = 199

 Score =  221 bits (562), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D ++  A+ GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D++ 
Sbjct: 48  YALARLDDVMNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIF 107

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQMPE ++VISMGSCANGGGYYHY+YSV+RGCDR++PVDIYVP
Sbjct: 108 VAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVP 167

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI+R
Sbjct: 168 GCPPTAEALLYGVLQLQKKIKR 189


>gi|159485096|ref|XP_001700585.1| NADH:ubiquinone oxidoreductase subunit 10 [Chlamydomonas
           reinhardtii]
 gi|34328788|gb|AAQ63698.1| NADH:ubiquinone oxidoreductase subunit 10 [Chlamydomonas
           reinhardtii]
 gi|158272225|gb|EDO98029.1| NADH:ubiquinone oxidoreductase subunit 10 [Chlamydomonas
           reinhardtii]
          Length = 164

 Score =  221 bits (562), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+V+ VD +V WAR GS+  MTFGLACCAVEMM A   RYDL+R+G   R SPRQSD MI
Sbjct: 13  FVVSKVDNVVNWARAGSIWPMTFGLACCAVEMMHAGASRYDLDRYGIIFRPSPRQSDAMI 72

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEP++V+SMGSCANGGGYYHYSY+VVRGCDR+VPVD+YVP
Sbjct: 73  VAGTLTNKMAPALRKVYDQMPEPKWVVSMGSCANGGGYYHYSYAVVRGCDRVVPVDVYVP 132

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAE L+YG+L LQKKI R
Sbjct: 133 GCPPTAEGLLYGLLQLQKKIYR 154


>gi|308500063|ref|XP_003112217.1| CRE-NDUF-7 protein [Caenorhabditis remanei]
 gi|308268698|gb|EFP12651.1| CRE-NDUF-7 protein [Caenorhabditis remanei]
          Length = 199

 Score =  221 bits (562), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  +D ++  A+ GS+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D++ 
Sbjct: 48  YALARLDDVMNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIF 107

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQMPE ++VISMGSCANGGGYYHY+YSV+RGCDR++PVDIYVP
Sbjct: 108 VAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVP 167

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI+R
Sbjct: 168 GCPPTAEALLYGVLQLQKKIKR 189


>gi|114053179|ref|NP_001040530.1| NADH-ubiquinone oxidoreductase 20 kDa subunit precursor [Bombyx
           mori]
 gi|95102896|gb|ABF51389.1| NADH-ubiquinone oxidoreductase 20 kDa subunit precursor [Bombyx
           mori]
          Length = 235

 Score =  220 bits (561), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 120/143 (83%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V   D ++ W R  S+  +TFGLACCA+EMM  + PRYD++R G   R +PRQ+DV+I
Sbjct: 84  WVVARADDILNWGRRNSVWPLTFGLACCALEMMHYAGPRYDMDRLGMVFRGTPRQTDVII 143

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR+ YD MPEPR+V+SMGSCANGGGYYHY+YS VRGCDRIVPVDIYVP
Sbjct: 144 VAGTVTNKMAPALRKTYDLMPEPRWVVSMGSCANGGGYYHYTYSTVRGCDRIVPVDIYVP 203

Query: 158 GCPPTAEALIYGILLLQKKIRRV 180
           GCPPTAEAL+YG+L LQKKI+R+
Sbjct: 204 GCPPTAEALLYGMLQLQKKIKRM 226


>gi|145612789|ref|XP_360493.2| hypothetical protein MGG_10805 [Magnaporthe oryzae 70-15]
 gi|145019908|gb|EDK04136.1| hypothetical protein MGG_10805 [Magnaporthe oryzae 70-15]
          Length = 147

 Score =  220 bits (560), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 100/137 (72%), Positives = 120/137 (87%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D+L+ WAR GS+  +TF LACC +EMM  SMPRYD +R G   RASPRQ+DVMIVAGT+
Sbjct: 1   MDRLLAWARNGSMWPLTFALACCGIEMMHLSMPRYDQDRLGIIFRASPRQADVMIVAGTV 60

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA A+R+ YDQMP+P++VISMG+CANGGGYYHYSYSVVRG DRI+PVDIYVPGCPPT
Sbjct: 61  TNKMAPAVRQCYDQMPDPKWVISMGTCANGGGYYHYSYSVVRGVDRILPVDIYVPGCPPT 120

Query: 163 AEALIYGILLLQKKIRR 179
           AEAL+YG+L LQKKI++
Sbjct: 121 AEALMYGLLQLQKKIQK 137


>gi|1019632|gb|AAA79257.1| photosystem II protein G [Paramecium aurelia]
          Length = 156

 Score =  220 bits (560), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 97/152 (63%), Positives = 124/152 (81%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I    FL  S + L++WAR GS   +TFGLACCA+EMM A++ RYD +RFG   RA+PRQ
Sbjct: 2   ILKADFLKLSANNLISWARQGSFWPLTFGLACCALEMMHATVSRYDFDRFGVIFRATPRQ 61

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D++IVAGT+TNKMA ALRR+YDQ  +P++V+SMGSCANGGGYYHYSY+VV+GCD+I+PV
Sbjct: 62  ADLIIVAGTVTNKMAPALRRLYDQTADPKWVLSMGSCANGGGYYHYSYAVVKGCDKIIPV 121

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           DI+VPGCPPTAEAL +G+L LQK + +  N K
Sbjct: 122 DIFVPGCPPTAEALFFGVLQLQKTLMKTINEK 153


>gi|301107946|ref|XP_002903055.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
 gi|262098173|gb|EEY56225.1| NADH ubiquinone oxidoreductase, putative [Phytophthora infestans
           T30-4]
          Length = 155

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 121/141 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V+ +D L+ W++  SL  ++FGLACCAVEMM  +  RYD ER G   RASPR +DVMI
Sbjct: 4   YVVSRLDDLMNWSKKSSLWPLSFGLACCAVEMMHTAGSRYDFERMGLLFRASPRCTDVMI 63

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQMPEP++VISMGSCANGGGYYHYSYSVVRG +RI+PVDIYVP
Sbjct: 64  VAGTVTNKMAPALRRIYDQMPEPKFVISMGSCANGGGYYHYSYSVVRGVNRILPVDIYVP 123

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPTAEAL++G++ LQKK++
Sbjct: 124 GCPPTAEALLFGVMQLQKKLK 144


>gi|11466261|ref|NP_049576.1| NADH dehydrogenase subunit 10 [Tetrahymena pyriformis]
 gi|5306137|gb|AAD41921.1|AF160864_9 NADH dehydrogenase subunit 10 [Tetrahymena pyriformis]
          Length = 162

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/145 (67%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT V+ +V+WAR GS   +TFGLACCAVEMM A++ RYD +RFG   RA+PRQ+D+++
Sbjct: 5   YIVTPVNAVVSWARQGSFWPLTFGLACCAVEMMHATVSRYDFDRFGVIFRATPRQADLIL 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LRR+Y+Q  +P++V+SMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 65  VAGTLTNKMAPGLRRLYEQTLDPKWVLSMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL++G+L LQK + R  N
Sbjct: 125 GCPPTAEALMFGVLQLQKSLYRQVN 149


>gi|114329866|ref|YP_740769.1| NADH dehydrogenase subunit 10 [Tetrahymena paravorax]
 gi|114150099|gb|ABI51678.1| NADH dehydrogenase subunit 10 [Tetrahymena paravorax]
          Length = 162

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/145 (67%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT V+ +V+WAR GS   +TFGLACCAVEMM A++ RYD +RFG   RA+PRQ+D+++
Sbjct: 5   YIVTPVNAVVSWARQGSFWPLTFGLACCAVEMMHATVSRYDFDRFGVIFRATPRQADLIL 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LRR+Y+Q  +P++V+SMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 65  VAGTLTNKMAPGLRRLYEQTLDPKWVLSMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL++G+L LQK + R  N
Sbjct: 125 GCPPTAEALMFGVLQLQKSLYRQIN 149


>gi|290988400|ref|XP_002676909.1| predicted protein [Naegleria gruberi]
 gi|284090514|gb|EFC44165.1| predicted protein [Naegleria gruberi]
          Length = 186

 Score =  218 bits (555), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (81%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +L   V  L  WAR  S+  +TFGLACCAVEMM  +  RYDLER+G   R +PRQSD MI
Sbjct: 7   YLKAPVHDLFAWARISSMWPVTFGLACCAVEMMHVAAARYDLERYGIFFRPTPRQSDAMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLTNKMA ALR+V+DQM EPRY +SMGSCANGGGYYH+SY VVRG D+I+PVD+YVP
Sbjct: 67  IAGTLTNKMAPALRKVWDQMAEPRYSVSMGSCANGGGYYHFSYHVVRGADQIIPVDVYVP 126

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+ +LQKKI+R
Sbjct: 127 GCPPTAEALLYGVYMLQKKIKR 148


>gi|114329910|ref|YP_740813.1| NADH dehydrogenase subunit 10 [Tetrahymena pigmentosa]
 gi|114150143|gb|ABI51721.1| NADH dehydrogenase subunit 10 [Tetrahymena pigmentosa]
          Length = 162

 Score =  218 bits (555), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 98/145 (67%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT V+ +V+WAR GS   +TFGLACCAVEMM A++ RYD +RFG   RA+PRQ+D+++
Sbjct: 5   YIVTPVNAVVSWARQGSFWPLTFGLACCAVEMMHATVSRYDFDRFGVIFRATPRQADLIL 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LRR+Y+Q  +P++V+SMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 65  VAGTLTNKMAPGLRRLYEQTLDPKWVLSMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL++G+L LQK + R  N
Sbjct: 125 GCPPTAEALMFGVLQLQKSLYRQIN 149


>gi|301631485|ref|XP_002944828.1| PREDICTED: NADH-quinone oxidoreductase subunit B-like [Xenopus
           (Silurana) tropicalis]
          Length = 164

 Score =  218 bits (555), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/136 (75%), Positives = 117/136 (86%), Gaps = 1/136 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPR 91
           +  +GF+ TS D +V WA+TGS+  MTFGLACCAVEMM A+  RYDL RFG    RASPR
Sbjct: 5   VMKEGFVTTSYDAVVNWAKTGSIWPMTFGLACCAVEMMHAASARYDLARFGAEVFRASPR 64

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAGTL NKMA A+R+VYDQM EPR+V+SMGSCANGGGYYHYSYSVVRGCDR+VP
Sbjct: 65  QSDLMIVAGTLCNKMAPAMRKVYDQMSEPRWVLSMGSCANGGGYYHYSYSVVRGCDRVVP 124

Query: 152 VDIYVPGCPPTAEALI 167
           VD+YVPGCPPTAEALI
Sbjct: 125 VDVYVPGCPPTAEALI 140


>gi|260076082|gb|ACX30960.1| NADH dehydrogenase subunit 10 [Euplotes minuta]
          Length = 167

 Score =  218 bits (554), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 122/140 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +LVT +  +V W+R+GS+  +TFGLACCAVEMM ++M RYDL+RFG   RASPR SD++I
Sbjct: 9   WLVTKLQTMVNWSRSGSIWPLTFGLACCAVEMMHSAMSRYDLDRFGMIFRASPRHSDLII 68

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLTNKMA  LRR+++QM EP++++SMGSCANGGGYYHYSY+VVRG +RIVPVD+YVP
Sbjct: 69  IAGTLTNKMAPTLRRLFEQMQEPKFILSMGSCANGGGYYHYSYAVVRGAERIVPVDMYVP 128

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPTAEALI+G+L LQ K+
Sbjct: 129 GCPPTAEALIFGLLQLQGKV 148


>gi|15027638|ref|NP_149372.1| NADH dehydrogenase subunit 10 [Tetrahymena thermophila]
 gi|15011474|gb|AAK77569.1|AF396436_9 NADH dehydrogenase subunit 10 [Tetrahymena thermophila]
          Length = 162

 Score =  218 bits (554), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 97/145 (66%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT ++ +V+WAR GS   +TFGLACCAVEMM A++ RYD +RFG   RA+PRQ+D+++
Sbjct: 5   YIVTPINAVVSWARQGSFWPLTFGLACCAVEMMHATVSRYDFDRFGVIFRATPRQADLIL 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LRR+Y+Q  +P++V+SMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 65  VAGTLTNKMAPGLRRLYEQTLDPKWVLSMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL++G+L LQK + R  N
Sbjct: 125 GCPPTAEALMFGVLQLQKSLYRQIN 149


>gi|114329820|ref|YP_740724.1| NADH dehydrogenase subunit 10 [Tetrahymena malaccensis]
 gi|114150053|gb|ABI51633.1| NADH dehydrogenase subunit 10 [Tetrahymena malaccensis]
          Length = 162

 Score =  218 bits (554), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 97/145 (66%), Positives = 124/145 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT ++ +V+WAR GS   +TFGLACCAVEMM A++ RYD +RFG   RA+PRQ+D+++
Sbjct: 5   YIVTPINAVVSWARQGSFWPLTFGLACCAVEMMHATVSRYDFDRFGVIFRATPRQADLIL 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA  LRR+Y+Q  +P++V+SMGSCANGGGYYHYSYSVVRGC+RI+PVDIYVP
Sbjct: 65  VAGTLTNKMAPGLRRLYEQTLDPKWVLSMGSCANGGGYYHYSYSVVRGCNRIIPVDIYVP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPPTAEAL++G+L LQK + R  N
Sbjct: 125 GCPPTAEALMFGVLQLQKSLYRQIN 149


>gi|260076121|gb|ACX30998.1| NADH dehydrogenase subunit 10 [Moneuplotes crassus]
          Length = 163

 Score =  217 bits (553), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 121/140 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           +LVT +  ++ W+R GS+  +TFGLACCAVEMM ++M RYDL+RFG   RASPR SD++I
Sbjct: 5   WLVTKLQIMINWSRAGSIWPLTFGLACCAVEMMHSAMSRYDLDRFGTIFRASPRHSDLII 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLTNKMA  LRR+++QM EP++++SMGSCANGGGYYHYSY+VVRG DRIVPVD+YVP
Sbjct: 65  IAGTLTNKMAPTLRRLFEQMQEPKFILSMGSCANGGGYYHYSYAVVRGADRIVPVDMYVP 124

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPTAEALI+G+L LQ K+
Sbjct: 125 GCPPTAEALIFGLLQLQGKV 144


>gi|46134967|ref|XP_389508.1| hypothetical protein FG09332.1 [Gibberella zeae PH-1]
          Length = 233

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T+VD+L  WARTGSL  MTF LACC +EMM  SMPRYD +R G   RASPRQSDVMI
Sbjct: 81  YALTTVDKLANWARTGSLWPMTFALACCGIEMMHVSMPRYDQDRLGIIFRASPRQSDVMI 140

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYY+YSYSVVRG DRI+PVDIYVP
Sbjct: 141 VAGTLTNKMAPALRQVYDQMPEPRWVISMGSCANGGGYYYYSYSVVRGVDRIIPVDIYVP 200

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+  LQ+KIR+
Sbjct: 201 GCPPTAEALMYGVFQLQRKIRK 222


>gi|9652180|gb|AAF91429.1|AF279902_1 NADH-ubiquinone oxidoreductase subunit PSST [Lupinus luteus]
          Length = 210

 Score =  214 bits (546), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 112/142 (78%), Positives = 122/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+++ VD L+ WAR GS+  MTFGLACCAVEMM     RYDL+RFG   R SPRQSD MI
Sbjct: 59  FVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMI 118

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGYYHYSY VVRGCDRIVPVDIYVP
Sbjct: 119 VAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYYVVRGCDRIVPVDIYVP 178

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI R
Sbjct: 179 GCPPTAEALLYGLLQLQKKINR 200


>gi|324522539|gb|ADY48077.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7 [Ascaris
           suum]
          Length = 210

 Score =  214 bits (545), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (84%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  VD ++   +  SL  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ D++ 
Sbjct: 59  YALARVDDVINLCQRTSLWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQVDLIF 118

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+TNKMA ALRR++DQMPE ++VISMGSCANGGGYYHY+YSV++GCDR++PVDIYVP
Sbjct: 119 IAGTVTNKMAPALRRIFDQMPEAKWVISMGSCANGGGYYHYAYSVLKGCDRVIPVDIYVP 178

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPTAEAL+YG+L LQKKI+R
Sbjct: 179 GCPPTAEALLYGVLQLQKKIKR 200


>gi|154282161|ref|XP_001541893.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Ajellomyces capsulatus NAm1]
 gi|150412072|gb|EDN07460.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Ajellomyces capsulatus NAm1]
          Length = 242

 Score =  214 bits (544), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 117/140 (83%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G  + S+D +  WAR GSL  ++ GLACC VEMM  SMPRYD +R G   RASPRQSD++
Sbjct: 89  GHFLGSIDAVTNWARQGSLWPVSLGLACCGVEMMAVSMPRYDQDRLGTIFRASPRQSDLL 148

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+++
Sbjct: 149 IVAGTVTNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDLFL 208

Query: 157 PGCPPTAEALIYGILLLQKK 176
           PGCPPTAEAL+Y + +L+KK
Sbjct: 209 PGCPPTAEALLYAMAVLRKK 228


>gi|158260365|dbj|BAF82360.1| unnamed protein product [Homo sapiens]
          Length = 206

 Score =  213 bits (542), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (83%), Gaps = 4/131 (3%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 G----CPPTAE 164
           G     PPT E
Sbjct: 182 GRAGTAPPTRE 192


>gi|193787188|dbj|BAG52394.1| unnamed protein product [Homo sapiens]
          Length = 206

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (83%), Gaps = 4/131 (3%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181

Query: 158 G----CPPTAE 164
           G     PPT E
Sbjct: 182 GRAGTAPPTRE 192


>gi|242810530|ref|XP_002485599.1| NADH-plastoquinone oxidoreductase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218716224|gb|EED15646.1| NADH-plastoquinone oxidoreductase, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 195

 Score =  212 bits (539), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 116/142 (81%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G+++TSVDQ+V WAR  SL  ++F LACC +EMMQ SMP+YD +R G    ASPRQ+DVM
Sbjct: 43  GYVLTSVDQIVNWARQNSLWALSFVLACCTIEMMQVSMPQYDQDRLGIIFSASPRQADVM 102

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           +VAGT+T+KMA ALR+ YDQM EPR++I+MGSCANGGGYYHY YSVVRG DRI+PVD+Y+
Sbjct: 103 VVAGTVTSKMAPALRQCYDQMSEPRWLITMGSCANGGGYYHYIYSVVRGVDRIIPVDVYI 162

Query: 157 PGCPPTAEALIYGILLLQKKIR 178
           PGC PT EA +YG   LQ KIR
Sbjct: 163 PGCSPTPEAFLYGTFQLQNKIR 184


>gi|131324|sp|P15602|NDUS7_PARTE RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa subunit
 gi|578753|emb|CAA34045.1| unnamed protein product [Paramecium aurelia]
          Length = 156

 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/152 (61%), Positives = 121/152 (79%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I    FL  S + L++WAR GS   +TFGLACCA+EMM A++ RYD +RFG   RA+PRQ
Sbjct: 2   ILKADFLKLSANNLISWARQGSFWPLTFGLACCALEMMHATVSRYDFDRFGVIFRATPRQ 61

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D++IVAGT+TNKMA ALRR+YDQ  +P++V+SMGSCANGGGYYHYSY+VV+GCD+I+PV
Sbjct: 62  ADLIIVAGTVTNKMAPALRRLYDQTADPKWVLSMGSCANGGGYYHYSYAVVKGCDKIIPV 121

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           D+  P CPPTAEAL +G+L LQK + +  N K
Sbjct: 122 DMLCPRCPPTAEALFFGVLQLQKTLMKTINEK 153


>gi|21750696|dbj|BAC03820.1| unnamed protein product [Homo sapiens]
          Length = 213

 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (83%), Gaps = 4/131 (3%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 69  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 129 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 188

Query: 158 G----CPPTAE 164
           G     PPT E
Sbjct: 189 GRAGTAPPTRE 199


>gi|167945481|ref|ZP_02532555.1| NADH dehydrogenase subunit B [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 140

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/138 (73%), Positives = 114/138 (82%), Gaps = 1/138 (0%)

Query: 47  VTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKM 106
           + WARTGSL  MTFGLACCAVEMM A+  RYD++RFG   R SPRQSDVMIVAGTL NKM
Sbjct: 1   INWARTGSLWPMTFGLACCAVEMMHAAAARYDMDRFGIVFRPSPRQSDVMIVAGTLVNKM 60

Query: 107 ASA-LRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEA 165
           A+    R   + PEPR+VISMGSCANGGGYYHYSY+VVRGCDR+VPVDIYVPGCPPTAEA
Sbjct: 61  AAWRCARSTTRWPEPRWVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVPGCPPTAEA 120

Query: 166 LIYGILLLQKKIRRVGNV 183
           L+YGI+ LQ KIRR   +
Sbjct: 121 LLYGIIQLQDKIRRTCTI 138


>gi|167740356|ref|ZP_02413130.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 14]
 gi|167817572|ref|ZP_02449252.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 91]
 gi|167825975|ref|ZP_02457446.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 9]
 gi|167896050|ref|ZP_02483452.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 7894]
 gi|167912696|ref|ZP_02499787.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 112]
 gi|167920662|ref|ZP_02507753.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei BCC215]
 gi|226192982|ref|ZP_03788593.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813963|ref|YP_002898414.1| NADH-quinone oxidoreductase subunit b (NADH dehydrogenase i subunit
           b) (ndh-1 subunit b) [Burkholderia pseudomallei MSHR346]
 gi|225934952|gb|EEH30928.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506107|gb|ACQ98425.1| NADH-quinone oxidoreductase subunit b (NADH dehydrogenase i subunit
           b) (ndh-1 subunit b) [Burkholderia pseudomallei MSHR346]
          Length = 167

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLACCAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 8   LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQ 67

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHY YSVVRGCDRIVPV
Sbjct: 68  CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYGYSVVRGCDRIVPV 127

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+YG++ LQ+K+
Sbjct: 128 DVYVPGCPPTAEALVYGLMQLQRKV 152


>gi|149034568|gb|EDL89305.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_a
           [Rattus norvegicus]
          Length = 210

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 106/122 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 67  YVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 186

Query: 158 GC 159
             
Sbjct: 187 AA 188


>gi|8928600|ref|NP_059405.1| NADH dehydrogenase subunit 10 [Paramecium aurelia]
          Length = 154

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 120/147 (81%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL  S + L++WAR GS   +TFGLACCA+EMM A++ RYD +RFG   RA+PRQ+D++I
Sbjct: 5   FLKLSANNLISWARQGSFWPLTFGLACCALEMMHATVSRYDFDRFGVIFRATPRQADLII 64

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALRR+YDQ  +P++V+SMGSCANGGGYYHYSY+VV+GCD+I+PVD+  P
Sbjct: 65  VAGTVTNKMAPALRRLYDQTADPKWVLSMGSCANGGGYYHYSYAVVKGCDKIIPVDMLCP 124

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
            CPPTAEAL +G+L LQK + +  N K
Sbjct: 125 RCPPTAEALFFGVLQLQKTLMKTINEK 151


>gi|148699632|gb|EDL31579.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_a [Mus
           musculus]
          Length = 199

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 106/122 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++VT +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQ+DVMI
Sbjct: 73  YVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMI 132

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
Sbjct: 133 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 192

Query: 158 GC 159
             
Sbjct: 193 AA 194


>gi|325093407|gb|EGC46717.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus H88]
          Length = 240

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 114/134 (85%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D +  WAR GSL  ++ GLACC VEMM  SMPRYD +R G   RASPRQSD++IVAGT+
Sbjct: 93  IDAVTNWARQGSLWPVSLGLACCGVEMMAVSMPRYDQDRLGTIFRASPRQSDLLIVAGTV 152

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+++PGCPPT
Sbjct: 153 TNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDLFLPGCPPT 212

Query: 163 AEALIYGILLLQKK 176
           AEAL+Y + +L+KK
Sbjct: 213 AEALLYAMAVLRKK 226


>gi|296232412|ref|XP_002761582.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 7,
           mitochondrial-like [Callithrix jacchus]
          Length = 305

 Score =  210 bits (534), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 107/176 (60%), Positives = 125/176 (71%), Gaps = 2/176 (1%)

Query: 6   VNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACC 65
           V+Q + +   S +   +    + +    +   ++V  +D L+ WAR  SL  MTFGLACC
Sbjct: 120 VHQTVATNGPSSTQPALPKARAVVPKPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACC 179

Query: 66  AVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVIS 125
           AVEMM  + PRYD++RFG   RASPRQSDVMIVAGTLTNKMA ALRRV    P P     
Sbjct: 180 AVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRRVGRVGPWPPLPSR 239

Query: 126 M--GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
               SCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI+R
Sbjct: 240 RLPHSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKR 295


>gi|290998039|ref|XP_002681588.1| predicted protein [Naegleria gruberi]
 gi|284095213|gb|EFC48844.1| predicted protein [Naegleria gruberi]
          Length = 174

 Score =  210 bits (534), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 113/142 (79%), Gaps = 3/142 (2%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL   +  L  WART SL  ++FGLACCAVEMM  S  RYD+ER G   R +PRQSD MI
Sbjct: 6   FLKAPIHDLYAWARTSSLWPVSFGLACCAVEMMHTSASRYDIERMGIFYRPTPRQSDAMI 65

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLTNKMA ALR+V+DQM EP+Y ISMGSCANGGGYYHYSY VVRG D+IVPVD+YVP
Sbjct: 66  IAGTLTNKMAPALRKVWDQMSEPKYSISMGSCANGGGYYHYSYHVVRGADQIVPVDVYVP 125

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPT   L+YGI +LQKKI+R
Sbjct: 126 GCPPT---LLYGIYMLQKKIKR 144


>gi|225563447|gb|EEH11726.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus G186AR]
          Length = 240

 Score =  210 bits (534), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 114/134 (85%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           +D +  WAR GSL  ++ GLACC VEMM  SMPRYD +R G   RASPRQSD++IVAGT+
Sbjct: 93  IDAVTNWARQGSLWPVSLGLACCGVEMMAVSMPRYDQDRLGTIFRASPRQSDLLIVAGTV 152

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+++PGCPPT
Sbjct: 153 TNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDLFLPGCPPT 212

Query: 163 AEALIYGILLLQKK 176
           AEAL+Y + +L+KK
Sbjct: 213 AEALLYAMAVLRKK 226


>gi|307069594|ref|YP_003878071.1| putative NADH:ubiquinone oxidoreductase, chain B [Candidatus
           Zinderia insecticola CARI]
 gi|306482854|gb|ADM89725.1| putative NADH:ubiquinone oxidoreductase, chain B [Candidatus
           Zinderia insecticola CARI]
          Length = 149

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I++  F   S+ +L  W+ + SL  +TFGLACCA+EMM A   R+DL++FG   RASPRQ
Sbjct: 2   ISNTSFATFSIKKLKKWSYSKSLWPVTFGLACCAIEMMHAGSSRFDLDQFGLFFRASPRQ 61

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SD++I+AGTL NKMA  LRR+YDQMP P++VISMGSCANGGGYYHYSYSVVRGC+ I+PV
Sbjct: 62  SDLIIIAGTLCNKMAPVLRRIYDQMPIPKWVISMGSCANGGGYYHYSYSVVRGCNNIIPV 121

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIR 178
           DIYVPGCPPT E L+Y I+ L+KKI 
Sbjct: 122 DIYVPGCPPTPETLLYSIIQLKKKIN 147


>gi|300123970|emb|CBK25241.2| unnamed protein product [Blastocystis hominis]
          Length = 274

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 117/140 (83%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VT+VD+++ + R GS+   TFGLACCA+EM+ AS  R+D ER G  PRA+PRQ+D+MIV+
Sbjct: 125 VTTVDKVIGYCRAGSVFPQTFGLACCAMEMIDASSARFDFERLGMIPRATPRQADLMIVS 184

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+TNKMA A+RR+YDQM EPRYVISMGSCAN GGYY YSY+VVRG DR+ PVD YVPGC
Sbjct: 185 GTVTNKMAPAIRRLYDQMSEPRYVISMGSCANSGGYYAYSYNVVRGVDRLFPVDYYVPGC 244

Query: 160 PPTAEALIYGILLLQKKIRR 179
           PPTA+ L+Y IL++ KK+++
Sbjct: 245 PPTADGLLYAILMVMKKLKQ 264


>gi|99034974|ref|ZP_01314777.1| hypothetical protein Wendoof_01000400 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 161

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/142 (71%), Positives = 115/142 (80%), Gaps = 8/142 (5%)

Query: 23  DADFSRISSEITHKGFLVTS----VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           + D+ R   E    GFLVT      D ++ WAR+GSL  MTFGLACCAVEMM  +  RYD
Sbjct: 8   NDDWGRYKKE----GFLVTKFGDLTDYVMNWARSGSLWPMTFGLACCAVEMMHTASSRYD 63

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+R+G   RASPRQSDVMIVAGTLTNKMA+ALR+VYDQM +P+YVISMGSCANGGGYYHY
Sbjct: 64  LDRYGIMFRASPRQSDVMIVAGTLTNKMAAALRKVYDQMADPKYVISMGSCANGGGYYHY 123

Query: 139 SYSVVRGCDRIVPVDIYVPGCP 160
           SYSVVRGCDRIVPVD+YVPGCP
Sbjct: 124 SYSVVRGCDRIVPVDVYVPGCP 145


>gi|300175569|emb|CBK20880.2| subunit NuoB (NDUFS7) [Blastocystis hominis]
          Length = 220

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 117/140 (83%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VT+VD+++ + R GS+   TFGLACCA+EM+ AS  R+D ER G  PRA+PRQ+D+MIV+
Sbjct: 71  VTTVDKVIGYCRAGSVFPQTFGLACCAMEMIDASSARFDFERLGMIPRATPRQADLMIVS 130

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+TNKMA A+RR+YDQM EPRYVISMGSCAN GGYY YSY+VVRG DR+ PVD YVPGC
Sbjct: 131 GTVTNKMAPAIRRLYDQMSEPRYVISMGSCANSGGYYAYSYNVVRGVDRLFPVDYYVPGC 190

Query: 160 PPTAEALIYGILLLQKKIRR 179
           PPTA+ L+Y IL++ KK+++
Sbjct: 191 PPTADGLLYAILMVMKKLKQ 210


>gi|221039728|dbj|BAH11627.1| unnamed protein product [Homo sapiens]
          Length = 182

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 105/120 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D LV WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 62  YVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 121

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIY+P
Sbjct: 122 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181


>gi|239610399|gb|EEQ87386.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Ajellomyces
           dermatitidis ER-3]
          Length = 245

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 116/141 (82%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G  + S+D +  W R  SL  ++ GLACC +EMM  SMPRYD +R G   RASPRQSD++
Sbjct: 92  GHFLGSIDAVANWGRQASLWPISLGLACCGLEMMAVSMPRYDQDRLGTIFRASPRQSDLL 151

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+Y+
Sbjct: 152 IVAGTVTNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDVYL 211

Query: 157 PGCPPTAEALIYGILLLQKKI 177
           PGCPPTAEAL+Y I ++++K+
Sbjct: 212 PGCPPTAEALMYAISVVRRKL 232


>gi|261195670|ref|XP_002624239.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239588111|gb|EEQ70754.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Ajellomyces
           dermatitidis SLH14081]
          Length = 244

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 116/141 (82%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G  + S+D +  W R  SL  ++ GLACC +EMM  SMPRYD +R G   RASPRQSD++
Sbjct: 91  GHFLGSIDAVANWGRQASLWPISLGLACCGLEMMAVSMPRYDQDRLGTIFRASPRQSDLL 150

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+Y+
Sbjct: 151 IVAGTVTNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDVYL 210

Query: 157 PGCPPTAEALIYGILLLQKKI 177
           PGCPPTAEAL+Y I ++++K+
Sbjct: 211 PGCPPTAEALMYAISVVRRKL 231


>gi|327349174|gb|EGE78031.1| NADH-ubiquinone oxidoreductase 20 kDa subunit [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 172

 Score =  207 bits (527), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 116/141 (82%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G  + S+D +  W R  SL  ++ GLACC +EMM  SMPRYD +R G   RASPRQSD++
Sbjct: 19  GHFLGSIDAVANWGRQASLWPISLGLACCGLEMMAVSMPRYDQDRLGTIFRASPRQSDLL 78

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+TNKMA ALR VYDQMP+P++VISMGSCANGGGYYHYSYSVVRG DR++PVD+Y+
Sbjct: 79  IVAGTVTNKMAPALRLVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRLLPVDVYL 138

Query: 157 PGCPPTAEALIYGILLLQKKI 177
           PGCPPTAEAL+Y I ++++K+
Sbjct: 139 PGCPPTAEALMYAISVVRRKL 159


>gi|238493105|ref|XP_002377789.1| formate hydrogenlyase, putative [Aspergillus flavus NRRL3357]
 gi|220696283|gb|EED52625.1| formate hydrogenlyase, putative [Aspergillus flavus NRRL3357]
          Length = 228

 Score =  206 bits (525), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T+ DQL+ WAR GSL  +TF LACC +EMM  SMPRYD +R G   RASPRQ+DVMI
Sbjct: 77  YFLTTTDQLINWARQGSLWPLTFALACCGIEMMHVSMPRYDQDRLGIIFRASPRQADVMI 136

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+TNKMA ALR++YDQMP+P++VISMGSCANGGGYY+YSYSVVRG DR+VPVDIYVP
Sbjct: 137 VAGTVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYYYSYSVVRGVDRVVPVDIYVP 196

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPPT EAL+Y I  LQKKIRR
Sbjct: 197 GCPPTPEALMYAIFQLQKKIRR 218


>gi|147744666|gb|ABQ51200.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Capra hircus]
          Length = 183

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 95/119 (79%), Positives = 104/119 (87%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++V  +D L+ WAR  SL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDVMI
Sbjct: 65  YVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMI 124

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           VAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV
Sbjct: 125 VAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 183


>gi|322801771|gb|EFZ22368.1| hypothetical protein SINV_15858 [Solenopsis invicta]
          Length = 189

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/121 (76%), Positives = 105/121 (86%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +  VD ++ W R GSL  MTFGLACCAVEMM  + PRYD++RFG   RASPRQSDV+I
Sbjct: 69  YALARVDDILNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVII 128

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR++YDQMPEPR+VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVP
Sbjct: 129 VAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVP 188

Query: 158 G 158
           G
Sbjct: 189 G 189


>gi|76811559|ref|YP_334953.1| NADH dehydrogenase subunit B [Burkholderia pseudomallei 1710b]
 gi|76581012|gb|ABA50487.1| NADH-quinone oxidoreductase, B subunit [Burkholderia pseudomallei
           1710b]
          Length = 226

 Score =  205 bits (521), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/145 (71%), Positives = 123/145 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLA CAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 67  LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLARCAVEMMHAAGARYDMDRFGMIPRASPRQ 126

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHY YSVVRGCDRIVPV
Sbjct: 127 CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYGYSVVRGCDRIVPV 186

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+Y ++ LQ+K+
Sbjct: 187 DVYVPGCPPTAEALVYDLMQLQRKV 211


>gi|254259706|ref|ZP_04950760.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1710a]
 gi|218528075|sp|Q3JNA0|NUOB2_BURP1 RecName: Full=Putative NADH-quinone oxidoreductase subunit B 2;
           AltName: Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|254218395|gb|EET07779.1| putative NADH-quinone oxidoreductase, B subunit [Burkholderia
           pseudomallei 1710a]
          Length = 167

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 104/145 (71%), Positives = 123/145 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF+VT++D  +  A+  SL +MTFGLA CAVEMM A+  RYD++RFG  PRASPRQ
Sbjct: 8   LEKDGFIVTTLDAAMAAAQKNSLWYMTFGLARCAVEMMHAAGARYDMDRFGMIPRASPRQ 67

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
            D+MIVAGTLTNKMA A+RRVYDQM EPRYV+SMGSCANGGGYYHY YSVVRGCDRIVPV
Sbjct: 68  CDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYGYSVVRGCDRIVPV 127

Query: 153 DIYVPGCPPTAEALIYGILLLQKKI 177
           D+YVPGCPPTAEAL+Y ++ LQ+K+
Sbjct: 128 DVYVPGCPPTAEALVYDLMQLQRKV 152


>gi|83774873|dbj|BAE64996.1| unnamed protein product [Aspergillus oryzae]
          Length = 176

 Score =  203 bits (517), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 104/141 (73%), Positives = 121/141 (85%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+ DQL+ WAR GSL  +TF LACC +EMM  SMPRYD +R G   RASPRQ+DVMIV
Sbjct: 26  ILTTTDQLINWARQGSLWPLTFALACCGIEMMHVSMPRYDQDRLGIIFRASPRQADVMIV 85

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+TNKMA ALR++YDQMP+P++VISMGSCANGGGYY+YSYSVVRG DR+VPVDIYVPG
Sbjct: 86  AGTVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYYYSYSVVRGVDRVVPVDIYVPG 145

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPPT EAL+Y I  LQKKIRR
Sbjct: 146 CPPTPEALMYAIFQLQKKIRR 166


>gi|317156952|ref|XP_001826129.2| NADH dehydrogenase [ubiquinone] iron-sulfur protein 7 [Aspergillus
           oryzae RIB40]
          Length = 155

 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 119/139 (85%)

Query: 41  TSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAG 100
           T+ DQL+ WAR GSL  +TF LACC +EMM  SMPRYD +R G   RASPRQ+DVMIVAG
Sbjct: 7   TTTDQLINWARQGSLWPLTFALACCGIEMMHVSMPRYDQDRLGIIFRASPRQADVMIVAG 66

Query: 101 TLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCP 160
           T+TNKMA ALR++YDQMP+P++VISMGSCANGGGYY+YSYSVVRG DR+VPVDIYVPGCP
Sbjct: 67  TVTNKMAPALRQLYDQMPDPKWVISMGSCANGGGYYYYSYSVVRGVDRVVPVDIYVPGCP 126

Query: 161 PTAEALIYGILLLQKKIRR 179
           PT EAL+Y I  LQKKIRR
Sbjct: 127 PTPEALMYAIFQLQKKIRR 145


>gi|110636931|ref|YP_677138.1| NADH:ubiquinone oxidoreductase [Cytophaga hutchinsonii ATCC 33406]
 gi|110279612|gb|ABG57798.1| NADH dehydrogenase subunit B [Cytophaga hutchinsonii ATCC 33406]
          Length = 184

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (75%), Gaps = 1/154 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP 86
           S +  +    G +V+ ++ ++ WAR  SL  M+FGLACCA+EMMQ     YDL+RFG  P
Sbjct: 8   SLLDHKFGQGGIVVSQLEDVLNWARLSSLFPMSFGLACCAIEMMQTFTSGYDLDRFGVIP 67

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRG 145
           R SPRQSDVMIVAGT+T KMA  +RR+Y+QMPEPRYVISMGSC+N GG Y+ + Y VV+G
Sbjct: 68  RPSPRQSDVMIVAGTVTFKMADRIRRLYEQMPEPRYVISMGSCSNCGGPYWEHGYHVVKG 127

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
            DRIVPVDIYVPGCPP  EALI G L LQ+KIR+
Sbjct: 128 VDRIVPVDIYVPGCPPRPEALIGGFLKLQEKIRK 161


>gi|238065078|sp|Q11XR8|NUOB1_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
          Length = 178

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (75%), Gaps = 1/154 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP 86
           S +  +    G +V+ ++ ++ WAR  SL  M+FGLACCA+EMMQ     YDL+RFG  P
Sbjct: 2   SLLDHKFGQGGIVVSQLEDVLNWARLSSLFPMSFGLACCAIEMMQTFTSGYDLDRFGVIP 61

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRG 145
           R SPRQSDVMIVAGT+T KMA  +RR+Y+QMPEPRYVISMGSC+N GG Y+ + Y VV+G
Sbjct: 62  RPSPRQSDVMIVAGTVTFKMADRIRRLYEQMPEPRYVISMGSCSNCGGPYWEHGYHVVKG 121

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
            DRIVPVDIYVPGCPP  EALI G L LQ+KIR+
Sbjct: 122 VDRIVPVDIYVPGCPPRPEALIGGFLKLQEKIRK 155


>gi|327398400|ref|YP_004339269.1| NAD(P)H-quinone oxidoreductase subunit K [Hippea maritima DSM
           10411]
 gi|327181029|gb|AEA33210.1| NAD(P)H-quinone oxidoreductase subunit K [Hippea maritima DSM
           10411]
          Length = 153

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/147 (63%), Positives = 117/147 (79%), Gaps = 1/147 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           ++ T +D+LV+WAR  SL  MTFGLACCA+EMM     R+DL+RFG   RASPR SD+MI
Sbjct: 7   WITTKLDKLVSWARYSSLWPMTFGLACCAIEMMATGASRFDLDRFGVVFRASPRHSDIMI 66

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLT KMA A R+VYDQMP P++VISMGSCAN GG +  +YSVV+G D I+PVD+YVP
Sbjct: 67  IAGTLTKKMAIAARKVYDQMPHPKWVISMGSCANTGGMFD-TYSVVQGVDTIMPVDVYVP 125

Query: 158 GCPPTAEALIYGILLLQKKIRRVGNVK 184
           GCPP  E L+YGI+ LQ+KIRR G++K
Sbjct: 126 GCPPRPEGLLYGIMKLQEKIRREGSMK 152


>gi|21673597|ref|NP_661662.1| NADH dehydrogenase I, 20 kDa subunit [Chlorobium tepidum TLS]
 gi|81791547|sp|Q8KEC2|NUOB_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|21646711|gb|AAM72004.1| NADH dehydrogenase I, 20 kdA subunit [Chlorobium tepidum TLS]
          Length = 189

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/154 (59%), Positives = 119/154 (77%), Gaps = 1/154 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + I+++  LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDARISNRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  +  +Y+QMPEPRYV+SMGSC+N GG Y+H+ Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVVTLYEQMPEPRYVLSMGSCSNSGGPYWHHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           RI+PVD+YVPGCPP  EALI G++ +Q+ IR  G
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGLMKIQELIRMEG 157


>gi|254670954|emb|CBA07618.1| NADH-ubiquinone oxidoreductase, 20 kDa subunit [Neisseria
           meningitidis alpha153]
          Length = 158

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 107/126 (84%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D+MIVAGTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+VPV
Sbjct: 66  ADLMIVAGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVVPV 125

Query: 153 DIYVPG 158
           D+YVPG
Sbjct: 126 DVYVPG 131


>gi|295697744|ref|YP_003590982.1| NADH-quinone oxidoreductase, B subunit [Bacillus tusciae DSM 2912]
 gi|295413346|gb|ADG07838.1| NADH-quinone oxidoreductase, B subunit [Bacillus tusciae DSM 2912]
          Length = 183

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 118/149 (79%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           S+++T  G LV++++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   RAS
Sbjct: 25  SADLTRAGVLVSTIEQLKAWARSNSLWPLTFGLACCAIEMMGTGASHYDLDRFGIIFRAS 84

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMIVAGT+T KM   LRR+YDQMP+P++V++MGSCA  GG Y  SY+V++G D++
Sbjct: 85  PRQSDVMIVAGTVTKKMGPLLRRLYDQMPDPKWVVAMGSCATAGGPYVRSYAVMKGVDQV 144

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVD+Y+PGCPP+  ALIYG+  LQ+KIR
Sbjct: 145 VPVDVYIPGCPPSPPALIYGLNKLQEKIR 173


>gi|294661316|ref|YP_003573192.1| hypothetical protein Aasi_1809 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|227336467|gb|ACP21064.1| hypothetical protein Aasi_1809 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 173

 Score =  198 bits (503), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/161 (57%), Positives = 121/161 (75%), Gaps = 1/161 (0%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           + +++     IS++    G ++ +++ L+ WA   SL  +TFGLACCA+EMM A    YD
Sbjct: 7   INQINNYMDTISNKTGEGGVIMVALEDLLNWAERSSLWPITFGLACCAIEMMGAYASHYD 66

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYH 137
           L+R G  PR SPRQ+DVMIV+GT+T KMA ++RR+YDQMPEPRYVISMGSCAN GG Y+ 
Sbjct: 67  LDRLGVIPRNSPRQADVMIVSGTVTFKMADSIRRLYDQMPEPRYVISMGSCANCGGPYWQ 126

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           + Y VV+G DRI+PVD+YVPGCPP  EALI GIL LQ+KI+
Sbjct: 127 HGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGILKLQEKIK 167


>gi|56421890|ref|YP_149208.1| NADH dehydrogenase subunit B [Geobacillus kaustophilus HTA426]
 gi|261420760|ref|YP_003254442.1| NADH dehydrogenase subunit B [Geobacillus sp. Y412MC61]
 gi|297531555|ref|YP_003672830.1| NADH-quinone oxidoreductase subunit beta [Geobacillus sp. C56-T3]
 gi|319768430|ref|YP_004133931.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. Y412MC52]
 gi|81346274|sp|Q5KUJ6|NUOB_GEOKA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|56381732|dbj|BAD77640.1| NADH:ubiquinone oxidoreductase chain B (Fe-S oxidoreductases)
           [Geobacillus kaustophilus HTA426]
 gi|261377217|gb|ACX79960.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. Y412MC61]
 gi|297254807|gb|ADI28253.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. C56-T3]
 gi|317113296|gb|ADU95788.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. Y412MC52]
          Length = 170

 Score =  197 bits (502), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 93/153 (60%), Positives = 116/153 (75%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           FS +  E   +   +T+++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG  
Sbjct: 8   FSGVEMEEVKRNVFLTTLEQLKGWARSSSLWPLTFGLACCAIEMMAVGGAHYDLDRFGSF 67

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            RASPRQ+DVMIV+GT+T KMA  LRR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+G
Sbjct: 68  FRASPRQADVMIVSGTVTKKMAPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVKG 127

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 128 VDQIVPVDVYIPGCPPNPAALIYGIHKLKEKIR 160


>gi|164662629|ref|XP_001732436.1| hypothetical protein MGL_0211 [Malassezia globosa CBS 7966]
 gi|159106339|gb|EDP45222.1| hypothetical protein MGL_0211 [Malassezia globosa CBS 7966]
          Length = 120

 Score =  197 bits (501), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 92/110 (83%), Positives = 101/110 (91%)

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M AS PRYD +R G   RA+PRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSC
Sbjct: 1   MHASGPRYDQDRLGIVFRATPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSC 60

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           ANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPP+AEAL+YGIL LQ+KIRR
Sbjct: 61  ANGGGYYHYSYSVVRGCDRIVPVDLYVPGCPPSAEALLYGILQLQRKIRR 110


>gi|194333676|ref|YP_002015536.1| NADH dehydrogenase subunit B [Prosthecochloris aestuarii DSM 271]
 gi|238065190|sp|B4S752|NUOB_PROA2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|194311494|gb|ACF45889.1| NADH-quinone oxidoreductase, B subunit [Prosthecochloris aestuarii
           DSM 271]
          Length = 190

 Score =  197 bits (501), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 118/151 (78%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + ++I++   LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAKISNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWKHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  EALI G++ +Q+ IR
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGLMKVQELIR 154


>gi|189500538|ref|YP_001960008.1| NADH dehydrogenase subunit B [Chlorobium phaeobacteroides BS1]
 gi|238055285|sp|B3EKA0|NUOB_CHLPB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|189495979|gb|ACE04527.1| NADH-quinone oxidoreductase, B subunit [Chlorobium phaeobacteroides
           BS1]
          Length = 190

 Score =  197 bits (500), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 118/151 (78%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + ++I++   LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAKISNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWKHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  EALI G++ +Q+ IR
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGLMKVQELIR 154


>gi|255036234|ref|YP_003086855.1| NADH-quinone oxidoreductase, B subunit [Dyadobacter fermentans DSM
           18053]
 gi|254948990|gb|ACT93690.1| NADH-quinone oxidoreductase, B subunit [Dyadobacter fermentans DSM
           18053]
          Length = 176

 Score =  197 bits (500), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (77%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G ++T+ + L+ WAR  SL  M FGLACCA+EMM      YDLERFG  PR SPRQSDVM
Sbjct: 11  GIILTNAEDLMNWARLSSLWPMGFGLACCAIEMMATYAANYDLERFGIMPRPSPRQSDVM 70

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCDRIVPVDIY 155
           IVAGT+T KMA  +RR+Y+QMPEPRYVISMGSC+N GG Y+ + Y VV+G DRI+PVD+Y
Sbjct: 71  IVAGTVTFKMADRIRRLYEQMPEPRYVISMGSCSNCGGPYWEHGYHVVKGVDRIIPVDVY 130

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           VPGCPP  EALI G + LQ+KIR
Sbjct: 131 VPGCPPRPEALIGGFMKLQEKIR 153


>gi|226315029|ref|YP_002774925.1| NADH dehydrogenase subunit B [Brevibacillus brevis NBRC 100599]
 gi|259514656|sp|C0Z772|NUOB_BREBN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|226097979|dbj|BAH46421.1| NADH-quinone oxidoreductase chain B [Brevibacillus brevis NBRC
           100599]
          Length = 172

 Score =  197 bits (500), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 94/160 (58%), Positives = 120/160 (75%), Gaps = 3/160 (1%)

Query: 22  VDADFSRISSEIT---HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           ++ D + I+ E+    ++  + T+++ +  W R+ SL  +TFGLACCA+EMM     RYD
Sbjct: 1   MELDLTSIAPELQEELNRNVMFTTLETVKGWVRSNSLWPLTFGLACCAIEMMGTGGARYD 60

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+RFG   RASPRQSDVMIVAGT+T KMA  LRR+YDQMPEP++VI+MGSCA  GG Y  
Sbjct: 61  LDRFGVIFRASPRQSDVMIVAGTVTKKMAPLLRRLYDQMPEPKWVIAMGSCATAGGPYVR 120

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           SYSVV+G D+IVPVD+Y+PGCPP   ALIYGI  LQ+KIR
Sbjct: 121 SYSVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLQEKIR 160


>gi|238065051|sp|B3ET80|NUOB_AMOA5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
          Length = 160

 Score =  197 bits (500), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 93/151 (61%), Positives = 117/151 (77%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           IS++    G ++ +++ L+ WA   SL  +TFGLACCA+EMM A    YDL+R G  PR 
Sbjct: 4   ISNKTGEGGVIMVALEDLLNWAERSSLWPITFGLACCAIEMMGAYASHYDLDRLGVIPRN 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQ+DVMIV+GT+T KMA ++RR+YDQMPEPRYVISMGSCAN GG Y+ + Y VV+G D
Sbjct: 64  SPRQADVMIVSGTVTFKMADSIRRLYDQMPEPRYVISMGSCANCGGPYWQHGYHVVKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  EALI GIL LQ+KI+
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGILKLQEKIK 154


>gi|332971775|gb|EGK10723.1| NADH-quinone oxidoreductase subunit B [Desmospora sp. 8437]
          Length = 175

 Score =  197 bits (500), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 92/144 (63%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    T+++ +  WAR+ SL  MTFGLACCA+EMM    P YDL+RFG   RASPRQSD
Sbjct: 17  QRNVFTTTLENVKAWARSNSLWPMTFGLACCAIEMMGTGAPHYDLDRFGSFFRASPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIVAGT+T KM   LRR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+G D+IVPVD+
Sbjct: 77  VMIVAGTVTKKMGPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  LQ+KIR
Sbjct: 137 YIPGCPPNPAALIYGIHKLQEKIR 160


>gi|145219899|ref|YP_001130608.1| NADH-quinone oxidoreductase, B subunit [Prosthecochloris
           vibrioformis DSM 265]
 gi|238065192|sp|A4SF47|NUOB_PROVI RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|145206063|gb|ABP37106.1| NADH dehydrogenase subunit B [Chlorobium phaeovibrioides DSM 265]
          Length = 189

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 118/154 (76%), Gaps = 1/154 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + ++ +  LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAAVSRQNVLVTSVDSVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           R++PVD+YVPGCPP  EALI G++ +Q+ IR  G
Sbjct: 124 RVIPVDVYVPGCPPRPEALIGGLMKIQELIRMEG 157


>gi|78188613|ref|YP_378951.1| NADH dehydrogenase subunit B [Chlorobium chlorochromatii CaD3]
 gi|123580176|sp|Q3ASW7|NUOB_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78170812|gb|ABB27908.1| NADH dehydrogenase subunit B [Chlorobium chlorochromatii CaD3]
          Length = 190

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/151 (59%), Positives = 117/151 (77%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + IT+   LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAGITNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCD 147
           SPRQSD+M+VAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMLVAGTVTMKMAERVIRLYEQMPEPRYVLSMGSCSNSGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  E+LI G++ +Q+ IR
Sbjct: 124 RIIPVDVYVPGCPPRPESLIGGLMKVQELIR 154


>gi|110598466|ref|ZP_01386737.1| NADH-quinone oxidoreductase, B subunit [Chlorobium ferrooxidans DSM
           13031]
 gi|110339916|gb|EAT58420.1| NADH-quinone oxidoreductase, B subunit [Chlorobium ferrooxidans DSM
           13031]
          Length = 189

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/151 (59%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + IT    LVTSVD ++ WAR  S+  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAGITKHNVLVTSVDNVLNWARLSSIWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           R++PVD+YVPGCPP  EALI G++ +Q+ IR
Sbjct: 124 RVIPVDVYVPGCPPRPEALIGGLMKIQELIR 154


>gi|193212957|ref|YP_001998910.1| NADH dehydrogenase subunit B [Chlorobaculum parvum NCIB 8327]
 gi|238055284|sp|B3QP57|NUOB_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|193086434|gb|ACF11710.1| NADH-quinone oxidoreductase, B subunit [Chlorobaculum parvum NCIB
           8327]
          Length = 189

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/154 (57%), Positives = 119/154 (77%), Gaps = 1/154 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + ++++++  LVTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAKVSNRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  +  +Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVVTLYEQMPEPRYVLSMGSCSNCGGPYWDHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           R++PVD+YVPGCPP  EALI G++ +Q+ IR  G
Sbjct: 124 RVIPVDVYVPGCPPRPEALIGGLMKIQELIRMEG 157


>gi|295400695|ref|ZP_06810672.1| NADH-quinone oxidoreductase, B subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112611|ref|YP_003990927.1| NADH-quinone oxidoreductase subunit beta [Geobacillus sp. Y4.1MC1]
 gi|294977276|gb|EFG52877.1| NADH-quinone oxidoreductase, B subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217712|gb|ADP76316.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. Y4.1MC1]
          Length = 170

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 1/148 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
            EI    FL T+++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   RASP
Sbjct: 14  EEIKRNVFL-TTLEQLKAWARSNSLWPLTFGLACCAIEMMGVGGSHYDLDRFGSFFRASP 72

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMIV+GT+T KMA  LRR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+G D+IV
Sbjct: 73  RQSDVMIVSGTVTKKMAPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVKGVDQIV 132

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIR 178
           PVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 133 PVDVYIPGCPPNPAALIYGINKLKEKIR 160


>gi|162457344|ref|YP_001619711.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
 gi|238065042|sp|A9G9S9|NUOB2_SORC5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|161167926|emb|CAN99231.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
          Length = 182

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/151 (59%), Positives = 116/151 (76%), Gaps = 4/151 (2%)

Query: 32  EITHKGFLVTSVDQ----LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPR 87
           E    G + TSVDQ    L+ W R+ S+ +M FGLACCA+E+MQ   PR DLERFG APR
Sbjct: 19  ESDGGGVITTSVDQTVNWLLNWGRSNSVWYMLFGLACCAIELMQTGGPRGDLERFGAAPR 78

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
            SPR SD+ I+AGTLT KMA+ ++R+YDQM EPR+VISMGSC+N GG + Y+YSV +G D
Sbjct: 79  PSPRSSDLFIIAGTLTYKMATRVKRLYDQMSEPRFVISMGSCSNCGGLFQYAYSVCKGVD 138

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +I+PVD+YVPGCPP  EAL+ G+L +Q+KI+
Sbjct: 139 QIIPVDVYVPGCPPRPEALLEGLLKIQEKIK 169


>gi|138896932|ref|YP_001127385.1| NADH dehydrogenase subunit B [Geobacillus thermodenitrificans
           NG80-2]
 gi|238065154|sp|A4ITI6|NUOB_GEOTN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|134268445|gb|ABO68640.1| NADH-quinone oxidoreductase chain B [Geobacillus
           thermodenitrificans NG80-2]
          Length = 170

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/147 (62%), Positives = 112/147 (76%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           E   +    T+++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   RASPR
Sbjct: 14  EEVKRNVFFTTLEQLKGWARSNSLWPLTFGLACCAIEMMAVGGAHYDLDRFGSFFRASPR 73

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSDVMIV+GT+T KMA  LRR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+G D+IVP
Sbjct: 74  QSDVMIVSGTVTKKMAPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVKGVDQIVP 133

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIR 178
           VD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 134 VDVYIPGCPPNPAALIYGIHKLKEKIR 160


>gi|196249749|ref|ZP_03148445.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. G11MC16]
 gi|196210625|gb|EDY05388.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. G11MC16]
          Length = 170

 Score =  194 bits (493), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/147 (62%), Positives = 112/147 (76%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           E   +    T+++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   RASPR
Sbjct: 14  EEVKRNVFFTTLEQLKGWARSNSLWPLTFGLACCAIEMMAVGGAHYDLDRFGSFFRASPR 73

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSDVMIV+GT+T KMA  LRR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+G D+IVP
Sbjct: 74  QSDVMIVSGTVTKKMAPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVKGVDQIVP 133

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIR 178
           VD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 134 VDVYIPGCPPNPAALIYGIHKLKEKIR 160


>gi|221633754|ref|YP_002522980.1| NADH dehydrogenase i subunit B [Thermomicrobium roseum DSM 5159]
 gi|238065220|sp|B9L170|NUOB_THERP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|221156029|gb|ACM05156.1| nadh dehydrogenase i, b subunit [Thermomicrobium roseum DSM 5159]
          Length = 185

 Score =  194 bits (493), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 2/157 (1%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL-ERFGFAPR 87
           +S+  +H   + T+ D L +WAR  SL W+ FGLACCA+EM+ ++MPR+DL ERFG   R
Sbjct: 3   MSAAQSHPNIITTTADWLFSWARRSSLWWLQFGLACCAIEMISSAMPRFDLAERFGMLYR 62

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIVAGT+T KMA  +R++YDQM +P++VISMGSCAN GG +  +Y+VV+G D
Sbjct: 63  ASPRQADLMIVAGTVTKKMAPVVRQLYDQMADPKWVISMGSCANVGGPFD-TYAVVQGVD 121

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           +++PVDIYVPGCPP  EAL YG+L LQ +I R   +K
Sbjct: 122 QVIPVDIYVPGCPPVPEALYYGVLELQNRIIRYERLK 158


>gi|239828582|ref|YP_002951206.1| NADH dehydrogenase subunit B [Geobacillus sp. WCH70]
 gi|259514668|sp|C5D987|NUOB_GEOSW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|239808875|gb|ACS25940.1| NADH-quinone oxidoreductase, B subunit [Geobacillus sp. WCH70]
          Length = 170

 Score =  194 bits (493), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 92/154 (59%), Positives = 114/154 (74%)

Query: 25  DFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF 84
           D     +E   +    T+++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG 
Sbjct: 7   DVPEGDTEELKRNVFFTTLEQLKAWARSNSLWPLTFGLACCAIEMMGVGGAHYDLDRFGS 66

Query: 85  APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQSDVMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SYSVV+
Sbjct: 67  FFRASPRQSDVMIVSGTVTKKMAPIIRRLYDQMPEPKWVIAMGSCATAGGPYVKSYSVVK 126

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           G D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 127 GVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIR 160


>gi|167463142|ref|ZP_02328231.1| NADH-quinone oxidoreductase, B subunit [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322383097|ref|ZP_08056924.1| hypothetical protein PL1_1946 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152759|gb|EFX45385.1| hypothetical protein PL1_1946 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 172

 Score =  194 bits (493), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 90/158 (56%), Positives = 116/158 (73%), Gaps = 1/158 (0%)

Query: 21  KVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           ++DA    +  E+  +    T++DQ+  WAR+ SL  +TFGLACCA+EMM      YDL+
Sbjct: 4   RLDAVLPEVQEEL-QRNVFTTTLDQVKAWARSSSLWPLTFGLACCAIEMMGTGAAHYDLD 62

Query: 81  RFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSY 140
           RFG   R SPRQ+DVMIVA T+T KMA  LRR+Y+QMPEP++VI+MGSCA  GG Y  SY
Sbjct: 63  RFGVIFRTSPRQADVMIVAETVTKKMAPLLRRLYEQMPEPKWVIAMGSCATAGGPYVKSY 122

Query: 141 SVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +VV+G D++VPVD+Y+PGCPP   ALIYGI  LQ+KIR
Sbjct: 123 AVVKGVDQVVPVDVYIPGCPPNPAALIYGIHKLQEKIR 160


>gi|189346374|ref|YP_001942903.1| NADH dehydrogenase subunit B [Chlorobium limicola DSM 245]
 gi|238055283|sp|B3EI94|NUOB_CHLL2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|189340521|gb|ACD89924.1| NADH-quinone oxidoreductase, B subunit [Chlorobium limicola DSM
           245]
          Length = 189

 Score =  193 bits (491), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 89/151 (58%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + IT    +VTSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAGITKHNVVVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           R++PVD+YVPGCPP  E+LI G++ +Q+ IR
Sbjct: 124 RVIPVDVYVPGCPPRPESLIGGLMKVQELIR 154


>gi|194336921|ref|YP_002018715.1| NADH-quinone oxidoreductase, B subunit [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|238065188|sp|B4SBZ2|NUOB_PELPB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|194309398|gb|ACF44098.1| NADH-quinone oxidoreductase, B subunit [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 189

 Score =  193 bits (491), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + IT    L+TSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAGITQHNVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMIVAGTVTMKMAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           R++PVD++VPGCPP  E+LI G++ +Q+ IR
Sbjct: 124 RVIPVDVFVPGCPPRPESLIGGLMKVQELIR 154


>gi|307721750|ref|YP_003892890.1| NADH dehydrogenase subunit B [Sulfurimonas autotrophica DSM 16294]
 gi|306979843|gb|ADN09878.1| NADH dehydrogenase subunit B [Sulfurimonas autotrophica DSM 16294]
          Length = 169

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 115/147 (78%), Gaps = 3/147 (2%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TSVD++V W R+ SL  +T+GLACC +EMM +   RYD +RFG   RASPRQ+DVMIVA
Sbjct: 18  LTSVDKIVNWGRSNSLWALTYGLACCGIEMMASGASRYDFDRFGTIFRASPRQADVMIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  ++R+YDQM EPR+VISMGSCAN GG ++ +Y+ V+GCDRI+PVD+Y+PGC
Sbjct: 78  GTLTKKHAEFIKRLYDQMTEPRWVISMGSCANTGGMFN-TYATVQGCDRIIPVDLYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIR--RVGNVK 184
            P  E L YG++LLQKKIR  + GN +
Sbjct: 137 APRPETLQYGVMLLQKKIRANKAGNAQ 163


>gi|119356790|ref|YP_911434.1| NADH-quinone oxidoreductase, B subunit [Chlorobium phaeobacteroides
           DSM 266]
 gi|238055286|sp|A1BF33|NUOB_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|119354139|gb|ABL65010.1| NADH dehydrogenase subunit B [Chlorobium phaeobacteroides DSM 266]
          Length = 189

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           + + IT    L+TSVD ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDAGITKHNVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+M+VAGT++ KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y V++G D
Sbjct: 64  SPRQSDLMLVAGTVSMKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  E+LI G++ +Q+ IR
Sbjct: 124 RIIPVDVYVPGCPPRPESLIGGLMKVQELIR 154


>gi|317130743|ref|YP_004097025.1| NADH-quinone oxidoreductase subunit beta [Bacillus cellulosilyticus
           DSM 2522]
 gi|315475691|gb|ADU32294.1| NADH-quinone oxidoreductase, B subunit [Bacillus cellulosilyticus
           DSM 2522]
          Length = 175

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/152 (61%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 28  RISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPR 87
           RI  +I    F  T V+QL  W+RT SL  ++FGLACCA+EMM     RYD +RFG   R
Sbjct: 15  RILEDIKRNVFF-TKVEQLKAWSRTRSLWPLSFGLACCAIEMMGTGAARYDFDRFGVIFR 73

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPR SDVMIVAGT+T+KMA  LR +YDQMPEP++VISMGSCA  GG Y  +YSVV G D
Sbjct: 74  ASPRHSDVMIVAGTVTSKMAPVLRTLYDQMPEPKWVISMGSCATCGGPYKEAYSVVNGVD 133

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           ++VPVD+YVPGCPPT  AL+ G+ LL++KIRR
Sbjct: 134 KVVPVDVYVPGCPPTPPALLDGVDLLREKIRR 165


>gi|322819469|gb|EFZ26582.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor, putative [Trypanosoma cruzi]
          Length = 189

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 110/137 (80%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           ++  L  W  T SL  +TFGLACCAVEMM A   RYDL+RFG  PR +PRQ++++IV+GT
Sbjct: 42  TLHDLTEWCLTYSLWPLTFGLACCAVEMMHAYAARYDLDRFGIVPRPTPRQAEIIIVSGT 101

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +TNKMA  LR +Y QM  P++VISMGSCANGGGYYH+SY+V+RGC+R +PVD ++PGCPP
Sbjct: 102 VTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPP 161

Query: 162 TAEALIYGILLLQKKIR 178
           +AE+L++ +  LQKKIR
Sbjct: 162 SAESLVFCLHTLQKKIR 178


>gi|71410632|ref|XP_807601.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Trypanosoma cruzi strain CL
 gi|71652884|ref|XP_815090.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Trypanosoma cruzi strain CL
 gi|70871638|gb|EAN85750.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor, putative [Trypanosoma cruzi]
 gi|70880118|gb|EAN93239.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor, putative [Trypanosoma cruzi]
          Length = 202

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 110/137 (80%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           ++  L  W  T SL  +TFGLACCAVEMM A   RYDL+RFG  PR +PRQ++++IV+GT
Sbjct: 55  TLHDLTEWCLTYSLWPLTFGLACCAVEMMHAYAARYDLDRFGIVPRPTPRQAEIIIVSGT 114

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +TNKMA  LR +Y QM  P++VISMGSCANGGGYYH+SY+V+RGC+R +PVD ++PGCPP
Sbjct: 115 VTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPP 174

Query: 162 TAEALIYGILLLQKKIR 178
           +AE+L++ +  LQKKIR
Sbjct: 175 SAESLVFCLHTLQKKIR 191


>gi|291334203|gb|ADD93870.1| hypothetical protein [uncultured marine bacterium
           MedDCM-OCT-S08-C1340]
          Length = 118

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%)

Query: 69  MMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGS 128
           MM A   RYDL+RFG   R SPRQSDVMIVAGTL NKMA ALR+VYDQM +P++VISMGS
Sbjct: 1   MMHAGASRYDLDRFGMLFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMADPKWVISMGS 60

Query: 129 CANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           CANGGGYYHYSYSVVRGCDRIVPVD+YVPGCPPTAEAL+YGIL LQ KIR    +K
Sbjct: 61  CANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGILQLQNKIRNKNRIK 116


>gi|312130053|ref|YP_003997393.1| NADH dehydrogenase subunit b [Leadbetterella byssophila DSM 17132]
 gi|311906599|gb|ADQ17040.1| NADH dehydrogenase subunit B [Leadbetterella byssophila DSM 17132]
          Length = 169

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/162 (55%), Positives = 121/162 (74%), Gaps = 4/162 (2%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           LE +++++   S E      ++T++D+L  WAR  SL  M FGLACCA+EMM      YD
Sbjct: 2   LESLESNYWEKSGE---GEVILTNLDELTNWARANSLWPMGFGLACCAIEMMATFASSYD 58

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYH 137
           LERFG  PR SPRQSD+MI++GT+T KMA  +RR+Y+QM EPRYVISMGSC+N GG Y+ 
Sbjct: 59  LERFGIFPRNSPRQSDLMIISGTVTFKMADRVRRLYEQMAEPRYVISMGSCSNCGGPYWE 118

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           + Y V++G D+++PVD+YVPGCPP  EALI G++ LQ+KI+R
Sbjct: 119 HGYHVLKGVDKVIPVDVYVPGCPPRPEALIGGLIKLQEKIKR 160


>gi|319650861|ref|ZP_08004998.1| NADH dehydrogenase subunit B [Bacillus sp. 2_A_57_CT2]
 gi|317397459|gb|EFV78160.1| NADH dehydrogenase subunit B [Bacillus sp. 2_A_57_CT2]
          Length = 177

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEIT---HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           ++D     IS E      +   + +++Q+  WAR+ SL  MTFGLACCA+EMM      Y
Sbjct: 7   EMDLKLDNISPEEMEELQRNVFMATLEQIKAWARSNSLWPMTFGLACCAIEMMGVGSSHY 66

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           DL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y 
Sbjct: 67  DLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYV 126

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SYSVV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 127 KSYSVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIR 167


>gi|254847826|gb|ACT83735.1| NADH dehydrogenase ubiquinone Fe-S 7 protein-like protein
           [Piriformospora indica]
          Length = 120

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 97/104 (93%)

Query: 76  RYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGY 135
           RYD +R G   RASPRQSD+MIVAGTLTNKMA ALR+VYDQMPEPR+VISMGSCANGGGY
Sbjct: 6   RYDQDRLGIVFRASPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGY 65

Query: 136 YHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           YHYSYSVVRGCDRIVPVDIYVPGCPPTAEAL+YG+L LQ+K+RR
Sbjct: 66  YHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGVLQLQRKMRR 109


>gi|124006095|ref|ZP_01690931.1| NADH-ubiquinone oxidoreductase 20 kda subunit [Microscilla marina
           ATCC 23134]
 gi|123988272|gb|EAY27925.1| NADH-ubiquinone oxidoreductase 20 kda subunit [Microscilla marina
           ATCC 23134]
          Length = 174

 Score =  191 bits (486), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/151 (58%), Positives = 111/151 (73%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +  +      ++T  + L+ WAR  SL  M FGLACCA+EMM      YDL+RFG  PRA
Sbjct: 4   LDQQFEQDNIILTKAEDLINWARLSSLWPMGFGLACCAIEMMSTFAAGYDLDRFGVFPRA 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSDVMIVAGT+T KMA  ++R+Y+QM EPRYVISMGSC+N GG Y+ + Y VV+G D
Sbjct: 64  SPRQSDVMIVAGTVTFKMADRIKRLYEQMAEPRYVISMGSCSNCGGPYWEHGYHVVKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           RI+PVD+YVPGCPP  EALI G + LQ+K+R
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGFMKLQEKVR 154


>gi|212640517|ref|YP_002317037.1| NADH dehydrogenase subunit B [Anoxybacillus flavithermus WK1]
 gi|238065054|sp|B7GMF0|NUOB_ANOFW RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|212561997|gb|ACJ35052.1| NADH dehydrogenase subunit B [Anoxybacillus flavithermus WK1]
          Length = 177

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISS---EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           K+D     +S    E   +   +T+++QL  WAR+ SL  +TFGLACCA+EMM      Y
Sbjct: 7   KMDVKLLNVSDQEMEEMRRNVFLTTLEQLKAWARSNSLWPLTFGLACCAIEMMGVGSSHY 66

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           DL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y 
Sbjct: 67  DLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYV 126

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 127 KSYCVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIR 167


>gi|290988470|ref|XP_002676938.1| predicted protein [Naegleria gruberi]
 gi|284090543|gb|EFC44194.1| predicted protein [Naegleria gruberi]
          Length = 131

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 100/125 (80%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL   +  L  WAR GS+  +TFGLACCAVEMM AS  RYDLER G   R +PRQ+D MI
Sbjct: 6   FLKAPLHDLFAWARVGSMWPVTFGLACCAVEMMHASASRYDLERKGIFFRPTPRQADAMI 65

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGTLTNKMA ALR+V+DQM EPRY ISMGSCANGGGYYH+SY VVRG D+IVPVD+YVP
Sbjct: 66  IAGTLTNKMAPALRKVWDQMAEPRYSISMGSCANGGGYYHFSYHVVRGADQIVPVDVYVP 125

Query: 158 GCPPT 162
           GCPP 
Sbjct: 126 GCPPN 130


>gi|152990038|ref|YP_001355760.1| NADH dehydrogenase subunit B [Nitratiruptor sp. SB155-2]
 gi|238065184|sp|A6Q1P4|NUOB_NITSB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|151421899|dbj|BAF69403.1| NADH-quinone oxidoreductase, chain B [Nitratiruptor sp. SB155-2]
          Length = 169

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 111/140 (79%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T+VD+LV W RT SL  +T+GLACCA+EMM +   RYD +RFG   RASPRQSDVMIVA
Sbjct: 18  LTTVDKLVNWGRTNSLWVLTYGLACCAIEMMASGASRYDFDRFGVIFRASPRQSDVMIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  +RR+YDQM EP++VISMGSCAN GG ++ +Y+ V+G DR++PVDIY+PGC
Sbjct: 78  GTLTKKHAEFIRRLYDQMAEPKWVISMGSCANTGGMFN-TYATVQGVDRVIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y ++LLQKK+R+
Sbjct: 137 APRPETLQYAVMLLQKKLRK 156


>gi|193216261|ref|YP_001997460.1| NADH dehydrogenase subunit B [Chloroherpeton thalassium ATCC 35110]
 gi|238065031|sp|B3QY47|NUOB2_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|193089738|gb|ACF15013.1| NADH-quinone oxidoreductase, B subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 195

 Score =  191 bits (485), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +  +    G ++T+ + ++ WAR  SL  M FGLACCA+EMM  +   YDLERFG  PR+
Sbjct: 4   LDQKFDKGGVVITAAENVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRS 63

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSD+MIVAGT+T KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y VV+G D
Sbjct: 64  SPRQSDLMIVAGTVTFKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVVKGVD 123

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RI+PVD+YVPGCPP  EALI G++ +Q+ IR 
Sbjct: 124 RIIPVDVYVPGCPPRPEALIGGLMKVQELIRE 155


>gi|269836326|ref|YP_003318554.1| NADH-quinone oxidoreductase, B subunit [Sphaerobacter thermophilus
           DSM 20745]
 gi|269785589|gb|ACZ37732.1| NADH-quinone oxidoreductase, B subunit [Sphaerobacter thermophilus
           DSM 20745]
          Length = 185

 Score =  191 bits (484), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 86/144 (59%), Positives = 114/144 (79%), Gaps = 2/144 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL-ERFGFAPRASPRQS 93
            +  L T+VD +  WAR  SL W+ FGLACCA+EM+ A+MPR+DL ERFG   RASPRQ+
Sbjct: 9   ERNILTTTVDTVFNWARRSSLWWLQFGLACCAIEMISAAMPRFDLAERFGMLYRASPRQA 68

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD 153
           D+MIVAGT+T KMA  +R++YDQM +P++VISMGSCAN GG +  +Y+VV+G D+++PVD
Sbjct: 69  DLMIVAGTVTKKMAPVVRQLYDQMADPKWVISMGSCANVGGPFD-TYAVVQGVDQVIPVD 127

Query: 154 IYVPGCPPTAEALIYGILLLQKKI 177
           +YVPGCPP  EAL YG+L LQ ++
Sbjct: 128 VYVPGCPPLPEALYYGVLELQNRV 151


>gi|89095634|ref|ZP_01168528.1| NADH dehydrogenase subunit B [Bacillus sp. NRRL B-14911]
 gi|89089380|gb|EAR68487.1| NADH dehydrogenase subunit B [Bacillus sp. NRRL B-14911]
          Length = 177

 Score =  191 bits (484), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 116/161 (72%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITH---KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           ++D     I+ E      +   + +++Q+  WAR+ SL  MTFGLACCA+EMM      Y
Sbjct: 7   QMDLKLENITPEEMQELQRNVFMATLEQIKAWARSNSLWPMTFGLACCAIEMMGVGSSHY 66

Query: 78  DLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           DL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y 
Sbjct: 67  DLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYV 126

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SYSVV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 127 KSYSVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIR 167


>gi|251799771|ref|YP_003014502.1| NADH dehydrogenase subunit B [Paenibacillus sp. JDR-2]
 gi|247547397|gb|ACT04416.1| NADH-quinone oxidoreductase, B subunit [Paenibacillus sp. JDR-2]
          Length = 172

 Score =  191 bits (484), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (75%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +   + +++QL  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNVFMGTLEQLKAWARSNSLWPLTFGLACCAIEMMGTGASHYDLDRFGVMFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIVAGT+T KM   LRR+YDQMPEP++VI+MGSCA  GG Y  SY+V++G D+IVPVD+
Sbjct: 77  VMIVAGTVTKKMGPLLRRLYDQMPEPKWVIAMGSCATAGGPYIKSYAVMKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  LQ+KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLQEKIR 160


>gi|152977486|ref|YP_001377003.1| NADH dehydrogenase subunit B [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|238065062|sp|A7GV50|NUOB_BACCN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|152026238|gb|ABS24008.1| NADH-quinone oxidoreductase, B subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 172

 Score =  191 bits (484), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    T+++Q+  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFTTLEQIKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|49188135|ref|YP_031388.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Sterne]
 gi|49481270|ref|YP_039290.1| NADH dehydrogenase subunit B [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52140262|ref|YP_086568.1| NADH dehydrogenase subunit B [Bacillus cereus E33L]
 gi|65317275|ref|ZP_00390234.1| COG0377: NADH:ubiquinone oxidoreductase 20 kD subunit and related
           Fe-S oxidoreductases [Bacillus anthracis str. A2012]
 gi|75762936|ref|ZP_00742740.1| NADH-quinone oxidoreductase chain B [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|118480339|ref|YP_897490.1| NADH dehydrogenase subunit B [Bacillus thuringiensis str. Al Hakam]
 gi|81394192|sp|Q6HAY6|NUOB_BACHK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81685364|sp|Q630U9|NUOB_BACCZ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065057|sp|A0RL90|NUOB_BACAH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|49182062|gb|AAT57438.1| NADH dehydrogenase I, B subunit [Bacillus anthracis str. Sterne]
 gi|49332826|gb|AAT63472.1| NADH dehydrogenase I, subunit B (NADH-quinone oxidoreductase, chain
           B) [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51973731|gb|AAU15281.1| NADH dehydrogenase I, subunit B (NADH-quinone oxidoreductase, chain
           B) [Bacillus cereus E33L]
 gi|74489578|gb|EAO52990.1| NADH-quinone oxidoreductase chain B [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|118419564|gb|ABK87983.1| NADH dehydrogenase subunit B [Bacillus thuringiensis str. Al Hakam]
          Length = 179

 Score =  190 bits (483), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 24  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 83

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 84  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDV 143

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 144 YIPGCPPNPAALIYGINKLKEKIR 167


>gi|226489136|emb|CAX74917.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7 [Schistosoma
           japonicum]
          Length = 176

 Score =  190 bits (483), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (85%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F++T +D L  WAR  S+  +TFGLACCAVEMM  + PRYD++R+G   RASPRQ+D+MI
Sbjct: 56  FVLTRLDDLANWARKNSIYPLTFGLACCAVEMMHIAGPRYDMDRYGVVFRASPRQADLMI 115

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           V+GT+TNKMA ALRR+YDQM  P++VISMGSCANGGGYYHYSYSV+RGCDR++PVDIYVP
Sbjct: 116 VSGTVTNKMAPALRRIYDQMTHPKWVISMGSCANGGGYYHYSYSVLRGCDRVIPVDIYVP 175


>gi|30023332|ref|NP_834963.1| NADH dehydrogenase subunit B [Bacillus cereus ATCC 14579]
 gi|30265322|ref|NP_847699.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Ames]
 gi|42784469|ref|NP_981716.1| NADH dehydrogenase subunit B [Bacillus cereus ATCC 10987]
 gi|47530861|ref|YP_022210.1| NADH dehydrogenase subunit B [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|165869972|ref|ZP_02214629.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0488]
 gi|167636380|ref|ZP_02394680.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0442]
 gi|167641714|ref|ZP_02399958.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0193]
 gi|170689329|ref|ZP_02880523.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0465]
 gi|170708828|ref|ZP_02899263.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0389]
 gi|177654059|ref|ZP_02936069.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0174]
 gi|190567657|ref|ZP_03020569.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036336|ref|ZP_03103734.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus W]
 gi|196039410|ref|ZP_03106715.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           NVH0597-99]
 gi|196045583|ref|ZP_03112813.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           03BB108]
 gi|206976881|ref|ZP_03237783.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           H3081.97]
 gi|217962788|ref|YP_002341364.1| NADH dehydrogenase subunit B [Bacillus cereus AH187]
 gi|218232741|ref|YP_002370074.1| NADH dehydrogenase subunit B [Bacillus cereus B4264]
 gi|218906476|ref|YP_002454310.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus AH820]
 gi|222098770|ref|YP_002532828.1| NADH dehydrogenase subunit b [Bacillus cereus Q1]
 gi|225867276|ref|YP_002752654.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           03BB102]
 gi|227818062|ref|YP_002818071.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           CDC 684]
 gi|229601924|ref|YP_002869514.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0248]
 gi|254686278|ref|ZP_05150137.1| NADH dehydrogenase subunit B [Bacillus anthracis str. CNEVA-9066]
 gi|254724274|ref|ZP_05186058.1| NADH dehydrogenase subunit B [Bacillus anthracis str. A1055]
 gi|254735227|ref|ZP_05192936.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744431|ref|ZP_05202111.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Kruger B]
 gi|254755735|ref|ZP_05207768.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Vollum]
 gi|254759532|ref|ZP_05211557.1| NADH dehydrogenase subunit B [Bacillus anthracis str. Australia 94]
 gi|296505727|ref|YP_003667427.1| NADH dehydrogenase subunit B [Bacillus thuringiensis BMB171]
 gi|300117809|ref|ZP_07055576.1| NADH dehydrogenase subunit B [Bacillus cereus SJ1]
 gi|301056766|ref|YP_003794977.1| NADH dehydrogenase subunit beta [Bacillus anthracis CI]
 gi|81408415|sp|Q72XF4|NUOB_BACC1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81433046|sp|Q814W7|NUOB_BACCR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|81580962|sp|Q81K01|NUOB_BACAN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065058|sp|B7JGM4|NUOB_BACC0 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065060|sp|B7HFJ5|NUOB_BACC4 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065061|sp|B7HY57|NUOB_BACC7 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065063|sp|B9IRT1|NUOB_BACCQ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767787|sp|C3P1E8|NUOB_BACAA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767788|sp|C3LFH3|NUOB_BACAC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767789|sp|C1F0M2|NUOB_BACC3 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|29898893|gb|AAP12164.1| NADH-quinone oxidoreductase chain B [Bacillus cereus ATCC 14579]
 gi|30260000|gb|AAP29185.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           Ames]
 gi|42740401|gb|AAS44324.1| NADH dehydrogenase I, B subunit [Bacillus cereus ATCC 10987]
 gi|47506009|gb|AAT34685.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           'Ames Ancestor']
 gi|164714295|gb|EDR19815.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0488]
 gi|167510339|gb|EDR85741.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0193]
 gi|167528214|gb|EDR90996.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0442]
 gi|170126228|gb|EDS95120.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0389]
 gi|170666697|gb|EDT17466.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0465]
 gi|172080942|gb|EDT66021.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0174]
 gi|190561073|gb|EDV15046.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991128|gb|EDX55098.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus W]
 gi|196023414|gb|EDX62091.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           03BB108]
 gi|196029570|gb|EDX68172.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           NVH0597-99]
 gi|206744847|gb|EDZ56252.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           H3081.97]
 gi|217066695|gb|ACJ80945.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus AH187]
 gi|218160698|gb|ACK60690.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus B4264]
 gi|218535886|gb|ACK88284.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus AH820]
 gi|221242829|gb|ACM15539.1| NADH dehydrogenase I, subunit B (NADH-quinone oxidoreductase, chain
           B) [Bacillus cereus Q1]
 gi|225791042|gb|ACO31259.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus
           03BB102]
 gi|227004083|gb|ACP13826.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           CDC 684]
 gi|229266332|gb|ACQ47969.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus anthracis str.
           A0248]
 gi|296326779|gb|ADH09707.1| NADH dehydrogenase subunit B [Bacillus thuringiensis BMB171]
 gi|298724673|gb|EFI65348.1| NADH dehydrogenase subunit B [Bacillus cereus SJ1]
 gi|300378935|gb|ADK07839.1| NADH dehydrogenase beta subunit [Bacillus cereus biovar anthracis
           str. CI]
 gi|324329247|gb|ADY24507.1| NADH dehydrogenase subunit B [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326943097|gb|AEA18993.1| NADH dehydrogenase subunit B [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 172

 Score =  190 bits (482), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|218900425|ref|YP_002448836.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus G9842]
 gi|238065059|sp|B7IQV2|NUOB_BACC2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|218541670|gb|ACK94064.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus G9842]
          Length = 172

 Score =  190 bits (482), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|47569794|ref|ZP_00240465.1| NADH dehydrogenase I, B subunit [Bacillus cereus G9241]
 gi|47553536|gb|EAL11916.1| NADH dehydrogenase I, B subunit [Bacillus cereus G9241]
          Length = 172

 Score =  190 bits (482), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYINSYAVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|284038505|ref|YP_003388435.1| NADH-quinone oxidoreductase subunit beta [Spirosoma linguale DSM
           74]
 gi|283817798|gb|ADB39636.1| NADH-quinone oxidoreductase, B subunit [Spirosoma linguale DSM 74]
          Length = 176

 Score =  190 bits (482), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%), Gaps = 1/136 (0%)

Query: 44  DQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLT 103
           + L+ W+R  S+  M+FGLACCA+EMMQA    YDLERFG  PR SPRQSD+MIV+GT+T
Sbjct: 33  EDLLNWSREKSMWPMSFGLACCAIEMMQAFAASYDLERFGIFPRPSPRQSDIMIVSGTVT 92

Query: 104 NKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
            KMA  +RR+Y+QM EPRYVISMGSC+N GG Y+ + Y VV+G DRI+PVD+YVPGCPP 
Sbjct: 93  FKMADRIRRLYEQMAEPRYVISMGSCSNCGGPYWQHGYHVVKGVDRIIPVDVYVPGCPPR 152

Query: 163 AEALIYGILLLQKKIR 178
            EALI G + LQ+KIR
Sbjct: 153 PEALIDGFIKLQEKIR 168


>gi|163942987|ref|YP_001647871.1| NADH dehydrogenase subunit B [Bacillus weihenstephanensis KBAB4]
 gi|238055233|sp|A9VS97|NUOB_BACWK RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|163865184|gb|ABY46243.1| NADH-quinone oxidoreductase, B subunit [Bacillus weihenstephanensis
           KBAB4]
          Length = 172

 Score =  190 bits (482), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|50555305|ref|XP_505061.1| YALI0F06050p [Yarrowia lipolytica]
 gi|49650931|emb|CAG77868.1| YALI0F06050p [Yarrowia lipolytica]
          Length = 216

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 106/143 (74%), Gaps = 2/143 (1%)

Query: 12  SGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEM 69
           +G    S   +  DF   S +  +    + +T++D +  WAR GS   +TFGLACCAVEM
Sbjct: 31  AGTPRVSSSSMPTDFPLPSQQKPNSAVDYTLTTLDAVANWARQGSFWPVTFGLACCAVEM 90

Query: 70  MQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
           M  S PRYD +R G   RASPRQSD+MIVAGTLTNKMA  LR+VYDQMPEPR+VISMGSC
Sbjct: 91  MHVSAPRYDQDRLGIIFRASPRQSDIMIVAGTLTNKMAPVLRQVYDQMPEPRWVISMGSC 150

Query: 130 ANGGGYYHYSYSVVRGCDRIVPV 152
           ANGGGYYH+SYSVVRGCDRIVPV
Sbjct: 151 ANGGGYYHFSYSVVRGCDRIVPV 173


>gi|34556898|ref|NP_906713.1| NADH dehydrogenase subunit B [Wolinella succinogenes DSM 1740]
 gi|81653582|sp|Q7MA50|NUOB_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|34482613|emb|CAE09613.1| NADH DEHYDROGENASE I CHAIN B [Wolinella succinogenes]
          Length = 169

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/141 (60%), Positives = 112/141 (79%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+VD LV W R+ SL  +T+GLACCA+EMM +   RYD +RFG   RASPRQ+DVMIV
Sbjct: 17  VLTTVDHLVNWGRSNSLWALTYGLACCAIEMMASGAGRYDFDRFGTIFRASPRQADVMIV 76

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQM EP++VISMGSCAN GG ++ +Y+ V+GCDRI+PVD+Y+PG
Sbjct: 77  AGTLTKKHAEFIRRLYDQMSEPKWVISMGSCANTGGMFN-TYATVQGCDRIIPVDVYLPG 135

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E L Y +++LQ+KIRR
Sbjct: 136 CAPRPETLQYAVMVLQQKIRR 156


>gi|304407748|ref|ZP_07389399.1| NADH-quinone oxidoreductase, B subunit [Paenibacillus
           curdlanolyticus YK9]
 gi|304343231|gb|EFM09074.1| NADH-quinone oxidoreductase, B subunit [Paenibacillus
           curdlanolyticus YK9]
          Length = 170

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 1/147 (0%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           E+    FL T ++Q+  WAR+ SL  +TFGLACCA+EMM      YDL+RFG   R SPR
Sbjct: 15  ELERNVFLGT-LEQVKAWARSNSLWPLTFGLACCAIEMMGTGASHYDLDRFGVMFRTSPR 73

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           Q+DVMIVAGT+T KM   LRR+YDQMPEP++VI+MGSCA  GG Y  SY+V++G D+IVP
Sbjct: 74  QADVMIVAGTVTKKMGPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYAVIKGVDQIVP 133

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIR 178
           VD+Y+PGCPP+  ALIYGI  LQ+KIR
Sbjct: 134 VDVYIPGCPPSPAALIYGINKLQEKIR 160


>gi|78778022|ref|YP_394337.1| NADH dehydrogenase subunit B [Sulfurimonas denitrificans DSM 1251]
 gi|123549715|sp|Q30PH9|NUOB_SULDN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78498562|gb|ABB45102.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Sulfurimonas
           denitrificans DSM 1251]
          Length = 169

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/139 (61%), Positives = 110/139 (79%), Gaps = 1/139 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TS+D++V W R+ SL  MT+GLACC +EMM +   RYD +RFG   RASPRQSDVMIVA
Sbjct: 18  LTSIDKIVNWGRSNSLWAMTYGLACCGIEMMASGASRYDFDRFGTIFRASPRQSDVMIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  ++R+YDQM EP++VISMGSCAN GG ++ +Y+ V+G DRI+PVD+Y+PGC
Sbjct: 78  GTLTKKHAEFIKRLYDQMTEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDLYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIR 178
            P  E L YG++LLQKKIR
Sbjct: 137 APRPETLQYGVMLLQKKIR 155


>gi|227536077|ref|ZP_03966126.1| NADH:ubiquinone oxidoreductase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227243974|gb|EEI93989.1| NADH:ubiquinone oxidoreductase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 167

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           I +++ + G +V  +D L+ WAR  S+  ++FG+ACCA+EMM A    YDL+R G  PR 
Sbjct: 3   IENQLQNNGVVVAKLDDLLNWARLSSMWPVSFGIACCAIEMMGAMASTYDLDRLGVFPRP 62

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSDVMI+AGT+T KMA  +R++Y+QMPEP+YVISMGSC+N GG Y+ + Y VV+G D
Sbjct: 63  SPRQSDVMIIAGTVTFKMADRIRKLYEQMPEPKYVISMGSCSNCGGPYWQHGYHVVKGVD 122

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RI+PVD+YV GCPP  EALI   L LQKKI +
Sbjct: 123 RIIPVDVYVQGCPPRPEALIGAFLELQKKIEK 154


>gi|300772047|ref|ZP_07081917.1| NADH dehydrogenase I [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760350|gb|EFK57176.1| NADH dehydrogenase I [Sphingobacterium spiritivorum ATCC 33861]
          Length = 167

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           I +++ + G +V  +D L+ WAR  S+  ++FG+ACCA+EMM A    YDL+R G  PR 
Sbjct: 3   IENQLQNNGVVVAKLDDLLNWARLSSMWPVSFGIACCAIEMMGAMASTYDLDRLGVFPRP 62

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQSDVMI+AGT+T KMA  +R++Y+QMPEP+YVISMGSC+N GG Y+ + Y VV+G D
Sbjct: 63  SPRQSDVMIIAGTVTFKMADRIRKLYEQMPEPKYVISMGSCSNCGGPYWQHGYHVVKGVD 122

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RI+PVD+YV GCPP  EALI   L LQKKI +
Sbjct: 123 RIIPVDVYVQGCPPRPEALIGAFLELQKKIEK 154


>gi|78186619|ref|YP_374662.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Chlorobium
           luteolum DSM 273]
 gi|123583245|sp|Q3B4W2|NUOB_PELLD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78166521|gb|ABB23619.1| NADH dehydrogenase subunit B [Chlorobium luteolum DSM 273]
          Length = 189

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/158 (57%), Positives = 116/158 (73%), Gaps = 8/158 (5%)

Query: 22  VDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLER 81
           +DA FSR          LV  VD ++ WAR  SL  M FGLACCA+EMM  +   YDLER
Sbjct: 4   LDAGFSR-------DNVLVAPVDAVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLER 56

Query: 82  FGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSY 140
           FG  PR+SPRQSD+MIVAGT++ KMA  + R+Y+QMPEPRYV+SMGSC+N GG Y+ + Y
Sbjct: 57  FGIFPRSSPRQSDLMIVAGTVSMKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGY 116

Query: 141 SVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            V++G DR++PVD+YVPGCPP  EALI G++ +Q+ IR
Sbjct: 117 HVLKGVDRVIPVDVYVPGCPPRPEALIGGLMKVQELIR 154


>gi|237752491|ref|ZP_04582971.1| NADH dehydrogenase subunit B [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375980|gb|EEO26071.1| NADH dehydrogenase subunit B [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 176

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TSVD+L+ W R+ SL  MT+GLACCA+EMM     RYD +RFG   RASPRQSDVMI+A
Sbjct: 25  LTSVDKLLNWGRSNSLWAMTYGLACCAIEMMATGASRYDFDRFGTIFRASPRQSDVMIIA 84

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+T K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+PGC
Sbjct: 85  GTVTKKHAQFVRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDIYLPGC 143

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQ+KIR+
Sbjct: 144 SPRPETLQYALMVLQQKIRK 163


>gi|242310555|ref|ZP_04809710.1| NADH dehydrogenase I [Helicobacter pullorum MIT 98-5489]
 gi|239522953|gb|EEQ62819.1| NADH dehydrogenase I [Helicobacter pullorum MIT 98-5489]
          Length = 176

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/140 (60%), Positives = 111/140 (79%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TS+D+L+ W R+ SL  MT+GLACCA+EMM     RYD +RFG   RASPRQSDVMI+A
Sbjct: 25  LTSLDKLINWGRSNSLWAMTYGLACCAIEMMATGASRYDFDRFGTIFRASPRQSDVMIIA 84

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+T K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+PGC
Sbjct: 85  GTVTKKHAQFVRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDIYLPGC 143

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQ+KIR+
Sbjct: 144 SPRPETLQYALMVLQQKIRK 163


>gi|206970223|ref|ZP_03231176.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus AH1134]
 gi|206734800|gb|EDZ51969.1| NADH dehydrogenase (ubiquinone), B subunit [Bacillus cereus AH1134]
          Length = 172

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSD 94
            +    ++++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSD
Sbjct: 17  ERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSD 76

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           VMIV+GT+T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+I+PVD+
Sbjct: 77  VMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQILPVDV 136

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP   ALIYGI  L++KIR
Sbjct: 137 YIPGCPPNPAALIYGINKLKEKIR 160


>gi|332296570|ref|YP_004438493.1| NAD(P)H-quinone oxidoreductase subunit K [Thermodesulfobium
           narugense DSM 14796]
 gi|332179673|gb|AEE15362.1| NAD(P)H-quinone oxidoreductase subunit K [Thermodesulfobium
           narugense DSM 14796]
          Length = 178

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 1/138 (0%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           +++ +V W R  SL  MTFGLACCA+EMM    P  DL+RFG   RASPRQ+D+MIVAGT
Sbjct: 33  AINWVVNWGRVSSLWPMTFGLACCAIEMMAVGAPHNDLDRFGILFRASPRQADLMIVAGT 92

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +T KMA  LRRVYDQMP+PRYVISMGSCAN GG ++ +YSV++G D++VPVD+Y+PGCPP
Sbjct: 93  VTLKMAPVLRRVYDQMPQPRYVISMGSCANSGGIFN-TYSVLQGVDQVVPVDVYLPGCPP 151

Query: 162 TAEALIYGILLLQKKIRR 179
             EAL++ +L LQ+KI++
Sbjct: 152 RPEALLHALLYLQQKIKK 169


>gi|195953122|ref|YP_002121412.1| NADH-quinone oxidoreductase, B subunit [Hydrogenobaculum sp.
           Y04AAS1]
 gi|238065161|sp|B4U8H3|NUOB_HYDS0 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|195932734|gb|ACG57434.1| NADH-quinone oxidoreductase, B subunit [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 177

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 117/151 (77%), Gaps = 1/151 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           ++S I   GF+ T+VD+L++W R  +L  +T GLACCA+EMM A+  R+D++R G   RA
Sbjct: 1   MASSINGNGFITTTVDELLSWGRRNALWPVTIGLACCAIEMMHAAASRFDIDRLGMIFRA 60

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPRQ+DV+IVAGT+ NK+A  L+ V+DQMPEP++ ISMG CA+ GG +  +YS ++G DR
Sbjct: 61  SPRQADVLIVAGTVVNKVAPMLKLVWDQMPEPKWCISMGGCASAGGPFP-TYSTLQGIDR 119

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           I+PVD+Y+PGCPPT + LIYG+L LQ+KIR 
Sbjct: 120 IIPVDVYIPGCPPTPQGLIYGLLELQRKIRE 150


>gi|312886635|ref|ZP_07746242.1| NADH dehydrogenase subunit B [Mucilaginibacter paludis DSM 18603]
 gi|311300737|gb|EFQ77799.1| NADH dehydrogenase subunit B [Mucilaginibacter paludis DSM 18603]
          Length = 166

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/153 (58%), Positives = 119/153 (77%), Gaps = 3/153 (1%)

Query: 29  ISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP 86
           +S++IT++G   +VT +D L+ W+R  SL  ++FG+ACCA+EMM +    YDL+RFG  P
Sbjct: 1   MSNDITNEGGGIIVTKLDDLMNWSRLSSLWPLSFGIACCAIEMMGSMASTYDLDRFGVFP 60

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRG 145
           R S RQ+DV+I+AGT+T KMA  ++R+Y+QMPEP+YVISMGSC+N GG Y+ + Y VV+G
Sbjct: 61  RPSARQADVIIIAGTVTFKMAERIKRLYEQMPEPKYVISMGSCSNCGGPYWQHGYHVVKG 120

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            DRI+PVDIYV GCPP  EALI GIL LQKKI 
Sbjct: 121 VDRIIPVDIYVQGCPPRPEALIGGILELQKKIE 153


>gi|311033318|ref|ZP_07711408.1| NADH dehydrogenase subunit B [Bacillus sp. m3-13]
          Length = 170

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (72%), Gaps = 3/160 (1%)

Query: 22  VDADFSRISSEITH---KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           +D +   IS E      +   +T++++L  WAR+ S+  MTFGLACCA+EMM      YD
Sbjct: 1   MDLNLESISPEEMEELKQTVFLTTLEELKAWARSNSMWPMTFGLACCAIEMMGVGSSHYD 60

Query: 79  LERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
           L+RFG   R SPRQSD MIV+GT+T KMA  L+R+YDQMPEP++VI+MGSCA  GG Y  
Sbjct: 61  LDRFGSFFRTSPRQSDCMIVSGTVTKKMAPVLKRLYDQMPEPKWVIAMGSCATAGGPYIK 120

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           SY+VV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KIR
Sbjct: 121 SYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLREKIR 160


>gi|297625190|ref|YP_003706624.1| NADH-quinone oxidoreductase subunit B [Truepera radiovictrix DSM
           17093]
 gi|297166370|gb|ADI16081.1| NADH-quinone oxidoreductase, B subunit [Truepera radiovictrix DSM
           17093]
          Length = 178

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F +   E+ ++G L +++ +LV W R+ SL   TFGLACCA+EMMQ++  R+DL RFG  
Sbjct: 7   FEKDVQELENEGILFSTLSKLVAWGRSNSLWPATFGLACCAIEMMQSTNARHDLSRFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD++VPGCPP  EAL+Y ++ LQKK+R
Sbjct: 126 NVDSVVPVDVFVPGCPPRPEALVYAVMQLQKKVR 159


>gi|154175216|ref|YP_001407461.1| NADH dehydrogenase subunit B [Campylobacter curvus 525.92]
 gi|254767791|sp|A7GW69|NUOB_CAMC5 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|112803227|gb|EAU00571.1| 50S ribosomal protein L10 [Campylobacter curvus 525.92]
          Length = 170

 Score =  188 bits (477), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/141 (60%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+VD+LV W R+ SL  +++GLACCA+EMM +   RYD +RFG   RASPR S+VMI+
Sbjct: 17  VLTTVDRLVQWGRSNSLWALSYGLACCAIEMMASGASRYDFDRFGTIFRASPRHSEVMII 76

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A   RR+YDQMPEP++VISMGSCAN GG ++ +YS V+G DRI+PVDIY+PG
Sbjct: 77  AGTLTKKHAEFTRRLYDQMPEPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYLPG 135

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E L Y +++LQKKIRR
Sbjct: 136 CAPRPETLQYALMILQKKIRR 156


>gi|157164838|ref|YP_001466103.1| NADH dehydrogenase subunit B [Campylobacter concisus 13826]
 gi|238055276|sp|A7ZBE5|NUOB_CAMC1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|112800518|gb|EAT97862.1| NADH-quinone oxidoreductase, b subunit [Campylobacter concisus
           13826]
          Length = 170

 Score =  188 bits (477), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+VD+LV W R+ SL  +++GLACCA+EMM +   RYD +RFG   RASPR S+VMI+
Sbjct: 17  VLTTVDKLVQWGRSNSLWALSYGLACCAIEMMASGASRYDFDRFGTIFRASPRHSEVMII 76

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A   RR+YDQMPEP++VISMGSCAN GG ++ +YS V+G DRI+PVDIY+PG
Sbjct: 77  AGTLTKKHAEFTRRLYDQMPEPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYIPG 135

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E L Y +++LQKKIR+
Sbjct: 136 CAPRPETLQYALMMLQKKIRK 156


>gi|71754617|ref|XP_828223.1| NADH-ubiquinone oxidoreductase 20 kDa subunit mitochondrial
           precursor [Trypanosoma brucei TREU927]
 gi|6647671|sp|Q26783|NDUS7_TRYBB RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein
           7, mitochondrial; AltName: Full=Complex I-20kD;
           Short=CI-20kD; AltName: Full=NADH-ubiquinone
           oxidoreductase 20 kDa subunit; Flags: Precursor
 gi|162168|gb|AAA30217.1| NADH dehydrogenase (ubiquinone) [Trypanosoma brucei]
 gi|70833609|gb|EAN79111.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Trypanosoma brucei]
 gi|261334029|emb|CBH17023.1| NADH-ubiquinone oxidoreductase 20 kDa subunit (mitochondrial
           precursor), putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 202

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 82/137 (59%), Positives = 108/137 (78%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           ++  L  W    S   +TFGLACCAVEMM A   RYDL+RFG  PR +PRQ++++IV+GT
Sbjct: 55  TLHDLTEWCLAYSPWPLTFGLACCAVEMMHAYASRYDLDRFGIVPRPTPRQAEIIIVSGT 114

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +TNKMA  LR +Y QM  P++VISMGSCANGGGYYH+SY+V+RGC+R +PVD ++PGCPP
Sbjct: 115 VTNKMAPILRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPP 174

Query: 162 TAEALIYGILLLQKKIR 178
           +AE+L++ +  LQKKIR
Sbjct: 175 SAESLVFCLHTLQKKIR 191


>gi|163781785|ref|ZP_02176785.1| NADH dehydrogenase I chain B [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883005|gb|EDP76509.1| NADH dehydrogenase I chain B [Hydrogenivirga sp. 128-5-R1-1]
          Length = 179

 Score =  187 bits (476), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 1/154 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           + I   GF+ T+VD+L+ W R  +L  +T GLACCA+EMM A+  R+DL+R G   RASP
Sbjct: 2   ASINSNGFVTTTVDELLKWGRRNALWPVTIGLACCAIEMMHAAASRFDLDRLGVIFRASP 61

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDV+IVAGT+ NK+A  L+ ++DQMP+P++ ISMG C++ GG +  +YS ++G DRI+
Sbjct: 62  RQSDVLIVAGTVVNKVAPMLKLIWDQMPDPKWCISMGGCSSAGGPFP-TYSTLQGIDRII 120

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           PVD+YVPGCPPT + LIYGIL LQ+KI+  G  K
Sbjct: 121 PVDVYVPGCPPTPQGLIYGILQLQRKIKEQGVTK 154


>gi|89895333|ref|YP_518820.1| NADH dehydrogenase I chain B [Desulfitobacterium hafniense Y51]
 gi|219669767|ref|YP_002460202.1| NADH dehydrogenase subunit B [Desulfitobacterium hafniense DCB-2]
 gi|122482325|sp|Q24UB6|NUOB_DESHY RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065122|sp|B8FRK6|NUOB_DESHD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|89334781|dbj|BAE84376.1| NADH dehydrogenase I chain B [Desulfitobacterium hafniense Y51]
 gi|219540027|gb|ACL21766.1| NADH-quinone oxidoreductase, B subunit [Desulfitobacterium
           hafniense DCB-2]
          Length = 173

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 115/158 (72%), Gaps = 1/158 (0%)

Query: 28  RISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP- 86
           R +  +  K  L+TS+D+++ W R  S   +TFGLACCA+EMM A  PR D+ RFG+   
Sbjct: 10  REAEALMEKNVLLTSIDKVLNWGRGHSFWPVTFGLACCAIEMMAAGGPRVDISRFGYEVF 69

Query: 87  RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGC 146
           RASPR +DVMIVAGT T KMA  LR +YDQMPEP++VI+MGSCA+ GG +  SYS++ G 
Sbjct: 70  RASPRHADVMIVAGTCTRKMAPLLRMIYDQMPEPKWVIAMGSCASAGGPFADSYSMLTGV 129

Query: 147 DRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           D+IVPVD+Y+PGCPP  E+L+YG+L LQ K+     V+
Sbjct: 130 DKIVPVDVYIPGCPPRPESLVYGLLQLQHKVNHPDKVR 167


>gi|297565713|ref|YP_003684685.1| NADH-quinone oxidoreductase subunit B [Meiothermus silvanus DSM
           9946]
 gi|296850162|gb|ADH63177.1| NADH-quinone oxidoreductase, B subunit [Meiothermus silvanus DSM
           9946]
          Length = 179

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 119/154 (77%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           FS+   E+ ++G L T++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 8   FSKDVQELENEGVLFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSE 67

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 68  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGACASSGGMFN-NYAIVQ 126

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD+YVPGCPP  EALIY ++ LQKK++
Sbjct: 127 NVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVQ 160


>gi|254456709|ref|ZP_05070137.1| NADH dehydrogenase i chain b [Campylobacterales bacterium GD 1]
 gi|207085501|gb|EDZ62785.1| NADH dehydrogenase i chain b [Campylobacterales bacterium GD 1]
          Length = 169

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 110/139 (79%), Gaps = 1/139 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TS+D++V W R+ SL  +T+GLACC +EMM +   RYD +RFG   RASPRQ+DVMIVA
Sbjct: 18  LTSIDKIVNWGRSNSLWALTYGLACCGIEMMASGASRYDFDRFGTIFRASPRQADVMIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  ++R+YDQM EPR+VISMGSCAN GG ++ +Y+ V+G DRI+PVD+Y+PGC
Sbjct: 78  GTLTKKHAEFIKRLYDQMTEPRWVISMGSCANTGGMFN-TYATVQGVDRIIPVDLYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIR 178
            P  E L YG++LLQ+KIR
Sbjct: 137 APRPETLQYGVMLLQQKIR 155


>gi|154339768|ref|XP_001565841.1| NADH-ubiquinone oxidoreductase 20 kDa subunit,mitochondrial
           precursor [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134063159|emb|CAM45359.1| NADH-ubiquinone oxidoreductase 20 kDa subunit,mitochondrial
           precursor [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 201

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 82/137 (59%), Positives = 108/137 (78%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           ++  L  W    S   +TFGLACCAVEMM +   RYDL+RFG  PR SPRQ++++IV+GT
Sbjct: 55  TLHDLTEWVLAYSPWPLTFGLACCAVEMMHSYSSRYDLDRFGIVPRPSPRQAEIIIVSGT 114

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +TNKMA  LR +Y QM  P++VISMGSCANGGGYYH+SY+V+RGC+R +PVD ++PGCPP
Sbjct: 115 VTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCERSIPVDFWIPGCPP 174

Query: 162 TAEALIYGILLLQKKIR 178
           +AE+L++ +  LQKKIR
Sbjct: 175 SAESLVFCLHNLQKKIR 191


>gi|73544267|ref|XP_848028.1| NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial
           precursor [Leishmania major strain Friedlin]
 gi|146094718|ref|XP_001467361.1| NADH-ubiquinone oxidoreductase [Leishmania infantum JPCM5]
 gi|321398434|emb|CBZ08822.1| NADH-ubiquinone oxidoreductase 20 kDa subunit,mitochondrial
           precursor [Leishmania infantum JPCM5]
 gi|321438382|emb|CBZ12134.1| NADH-ubiquinone oxidoreductase 20 kDa subunit,mitochondrial
           precursor [Leishmania major strain Friedlin]
 gi|322492890|emb|CBZ28169.1| NADH-ubiquinone oxidoreductase 20 kDa subunit,mitochondrial
           precursor [Leishmania mexicana MHOM/GT/2001/U1103]
 gi|322500143|emb|CBZ35218.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 201

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 82/137 (59%), Positives = 108/137 (78%)

Query: 42  SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGT 101
           ++  L  W    S   +TFGLACCAVEMM +   RYDL+RFG  PR SPRQ++++IV+GT
Sbjct: 55  TLHDLTEWVVAYSPWPLTFGLACCAVEMMHSYSSRYDLDRFGIVPRPSPRQAEIIIVSGT 114

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +TNKMA  LR +Y QM  P++VISMGSCANGGGYYH+SY+V+RGC+R +PVD ++PGCPP
Sbjct: 115 VTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPP 174

Query: 162 TAEALIYGILLLQKKIR 178
           +AE+L++ +  LQKKIR
Sbjct: 175 SAESLVFCLHNLQKKIR 191


>gi|15806517|ref|NP_295228.1| NADH dehydrogenase subunit B [Deinococcus radiodurans R1]
 gi|81624845|sp|Q9RU87|NUOB_DEIRA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|6459265|gb|AAF11070.1|AE001994_6 NADH dehydrogenase I, B subunit [Deinococcus radiodurans R1]
          Length = 181

 Score =  187 bits (475), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 120/160 (75%), Gaps = 6/160 (3%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           E +D D+  + SE    G L +S+++LV W R+ SL   TFGLACCA+EMM ++  R D+
Sbjct: 5   ELIDRDWQELESE----GVLFSSLEKLVAWGRSNSLWPATFGLACCAIEMMSSTNARNDM 60

Query: 80  ERFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
            RFG    RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ 
Sbjct: 61  SRFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGACASSGGMFN- 119

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +Y+VV+  D +VPVDI+VPGCPP  EALIY ++ LQKK+R
Sbjct: 120 NYAVVQNVDSVVPVDIFVPGCPPRPEALIYAVMQLQKKVR 159


>gi|228917908|ref|ZP_04081444.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228949019|ref|ZP_04111292.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228968422|ref|ZP_04129414.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228988523|ref|ZP_04148611.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229076513|ref|ZP_04209474.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock4-18]
 gi|229094409|ref|ZP_04225481.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-42]
 gi|229099732|ref|ZP_04230658.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-29]
 gi|229118795|ref|ZP_04248145.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock1-3]
 gi|229124802|ref|ZP_04253981.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus 95/8201]
 gi|229142039|ref|ZP_04270564.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BDRD-ST26]
 gi|229175973|ref|ZP_04303469.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus MM3]
 gi|228607466|gb|EEK64792.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus MM3]
 gi|228641328|gb|EEK97634.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BDRD-ST26]
 gi|228658677|gb|EEL14338.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus 95/8201]
 gi|228664665|gb|EEL20157.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock1-3]
 gi|228683702|gb|EEL37654.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-29]
 gi|228688946|gb|EEL42773.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-42]
 gi|228706605|gb|EEL58817.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock4-18]
 gi|228771203|gb|EEM19681.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228791270|gb|EEM38880.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228810775|gb|EEM57123.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228841705|gb|EEM86816.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 148

 Score =  187 bits (474), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           ++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSDVMIV+GT+
Sbjct: 1   MEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTV 60

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+Y+PGCPP 
Sbjct: 61  TKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPN 120

Query: 163 AEALIYGILLLQKKIR 178
             ALIYGI  L++KIR
Sbjct: 121 PAALIYGINKLKEKIR 136


>gi|228936583|ref|ZP_04099378.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228823098|gb|EEM68935.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
          Length = 148

 Score =  187 bits (474), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTL 102
           ++QL  WAR+ SL  MTFGLACCA+EMM      YDL+RFG   R SPRQSDVMIV+GT+
Sbjct: 1   MEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTV 60

Query: 103 TNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPT 162
           T KMA  +RR+YDQMPEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+Y+PGCPP 
Sbjct: 61  TKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPN 120

Query: 163 AEALIYGILLLQKKIR 178
             ALIYGI  L++KIR
Sbjct: 121 PAALIYGINKLKEKIR 136


>gi|67528182|ref|XP_661901.1| hypothetical protein AN4297.2 [Aspergillus nidulans FGSC A4]
 gi|40740847|gb|EAA60037.1| hypothetical protein AN4297.2 [Aspergillus nidulans FGSC A4]
          Length = 184

 Score =  186 bits (473), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%)

Query: 77  YDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           YD +R G   RASPRQSDVMIVAGTLTNKMA ALR+VYDQMP+PR+VISMGSCANGGGYY
Sbjct: 72  YDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGGGYY 131

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           HYSYSVVRGCDRIVPVD+YVPGCPPT+EAL+YGI  LQKK+R
Sbjct: 132 HYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMR 173


>gi|326474729|gb|EGD98738.1| NADH-ubiquinone oxidoreductase subunit B [Trichophyton tonsurans
           CBS 112818]
          Length = 204

 Score =  186 bits (473), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 105/141 (74%), Gaps = 14/141 (9%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           + +T++DQ+  WAR GSL  MTFGLACCAVEMM  S PRYD +R G   RASPRQSDVMI
Sbjct: 67  YALTTLDQVANWARQGSLWPMTFGLACCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMI 126

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLTNKMA ALR+VYDQMP P            G Y    YSV RGCDRIVPVDIYVP
Sbjct: 127 VAGTLTNKMAPALRQVYDQMPGPTL----------GDY----YSVTRGCDRIVPVDIYVP 172

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPPT+EAL+YGI  LQ+K+R
Sbjct: 173 GCPPTSEALMYGIFQLQRKMR 193


>gi|325996536|gb|ADZ51941.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori 2018]
 gi|325998125|gb|ADZ50333.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori 2017]
          Length = 159

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   ILSTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRIVPVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRIVPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|291296255|ref|YP_003507653.1| NADH-quinone oxidoreductase B subunit [Meiothermus ruber DSM 1279]
 gi|290471214|gb|ADD28633.1| NADH-quinone oxidoreductase, B subunit [Meiothermus ruber DSM 1279]
          Length = 179

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F++   E+ ++G L T++++L+ W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 8   FTKDVQELENEGVLFTTLEKLIAWGRSNSLWPATFGLACCAIEMMASTDARNDLSRFGSE 67

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 68  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGACASSGGMFN-NYAIVQ 126

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD++VPGCPP  EALIY ++ LQKKI+
Sbjct: 127 NVDSVVPVDVFVPGCPPRPEALIYAVMQLQKKIQ 160


>gi|208435155|ref|YP_002266821.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori G27]
 gi|210135420|ref|YP_002301859.1| NADH dehydrogenase subunit B [Helicobacter pylori P12]
 gi|217032322|ref|ZP_03437818.1| hypothetical protein HPB128_132g20 [Helicobacter pylori B128]
 gi|254779804|ref|YP_003057910.1| NADH dehydrogenase subunit B [Helicobacter pylori B38]
 gi|298735715|ref|YP_003728240.1| NADH dehydrogenase I subunit B [Helicobacter pylori B8]
 gi|308183371|ref|YP_003927498.1| NADH dehydrogenase subunit B [Helicobacter pylori PeCan4]
 gi|308185009|ref|YP_003929142.1| NADH dehydrogenase subunit B [Helicobacter pylori SJM180]
 gi|238065158|sp|B6JNA1|NUOB_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065159|sp|B5Z8Q6|NUOB_HELPG RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|208433084|gb|ACI27955.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori G27]
 gi|210133388|gb|ACJ08379.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori P12]
 gi|216945988|gb|EEC24602.1| hypothetical protein HPB128_132g20 [Helicobacter pylori B128]
 gi|254001716|emb|CAX29947.1| NADH-ubiquinone oxidoreductase, NQO6 subunit [Helicobacter pylori
           B38]
 gi|261838584|gb|ACX98350.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori 51]
 gi|261839979|gb|ACX99744.1| NADH dehydrogenase subunit B [Helicobacter pylori 52]
 gi|298354904|emb|CBI65776.1| NADH dehydrogenase I chain B [Helicobacter pylori B8]
 gi|308060929|gb|ADO02825.1| NADH dehydrogenase subunit B [Helicobacter pylori SJM180]
 gi|308065556|gb|ADO07448.1| NADH dehydrogenase subunit B [Helicobacter pylori PeCan4]
 gi|317013049|gb|ADU83657.1| NADH dehydrogenase subunit B [Helicobacter pylori Lithuania75]
 gi|317014652|gb|ADU82088.1| NADH dehydrogenase subunit B [Helicobacter pylori Gambia94/24]
          Length = 159

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   VLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRIVPVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRIVPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|328950032|ref|YP_004367367.1| NAD(P)H-quinone oxidoreductase subunit K [Marinithermus
           hydrothermalis DSM 14884]
 gi|328450356|gb|AEB11257.1| NAD(P)H-quinone oxidoreductase subunit K [Marinithermus
           hydrothermalis DSM 14884]
          Length = 179

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G   T++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 7   FERDVQELERQGVFFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD++VPGCPP  EALIY ++ LQKKIR
Sbjct: 126 NVDSVVPVDVFVPGCPPRPEALIYAVMQLQKKIR 159


>gi|268678781|ref|YP_003303212.1| NADH-quinone oxidoreductase subunit beta [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268616812|gb|ACZ11177.1| NADH-quinone oxidoreductase, B subunit [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 169

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 110/139 (79%), Gaps = 1/139 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T+VD+LV W R+ SL  +T+GLACCA+EMM     RYD +RFG   RASPRQ+DV+++A
Sbjct: 18  LTTVDKLVQWGRSNSLWPLTYGLACCAIEMMATGASRYDFDRFGTIFRASPRQADVIVIA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  +RR+YDQMP+P++VISMGSCAN GG ++ +Y+ V+G DRIVPVDIY+PGC
Sbjct: 78  GTLTKKHAPFMRRLYDQMPDPKWVISMGSCANTGGMFN-TYATVQGADRIVPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIR 178
            P  E L Y ++LLQKKIR
Sbjct: 137 APRPETLQYALMLLQKKIR 155


>gi|226355360|ref|YP_002785100.1| NADH dehydrogenase subunit B [Deinococcus deserti VCD115]
 gi|259514659|sp|C1D0H2|NUOB_DEIDV RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|226317350|gb|ACO45346.1| putative NADH dehydrogenase (quinone), subunit B (NADH-quinone
           oxidoreductase, subunit B) [Deinococcus deserti VCD115]
          Length = 178

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/154 (55%), Positives = 117/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G L +++++LV W R+ SL   TFGLACCA+EMM ++  R D+ RFG  
Sbjct: 7   FDRDWQELESEGILFSNLEKLVAWGRSNSLWPATFGLACCAIEMMSSTNARNDMARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VI+MG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVIAMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVDIYVPGCPP  EALIY ++ LQKK+R
Sbjct: 126 NVDSVVPVDIYVPGCPPRPEALIYAVMQLQKKVR 159


>gi|154148789|ref|YP_001405790.1| NADH dehydrogenase subunit B [Campylobacter hominis ATCC BAA-381]
 gi|218527983|sp|A7HZU9|NUOB_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|153804798|gb|ABS51805.1| NADH-quinone oxidoreductase, b subunit [Campylobacter hominis ATCC
           BAA-381]
          Length = 169

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T++D+LV W R+ SL  M +GLACCA+EMM     RYD +RFG   RAS +QS+VM++
Sbjct: 17  VLTTIDKLVNWGRSNSLWAMNYGLACCAIEMMATGASRYDFDRFGTIFRASAKQSEVMVI 76

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL+ K A   RR+YD MPEP++VISMGSCAN GG ++ +Y+VV+GCDRI+PVDIY+PG
Sbjct: 77  AGTLSKKHAELARRLYDAMPEPKWVISMGSCANTGGMFN-TYAVVQGCDRIIPVDIYLPG 135

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E L Y +++LQKKIRR
Sbjct: 136 CAPRPETLQYALMILQKKIRR 156


>gi|124515815|gb|EAY57324.1| NADH dehydrogenase (ubiquinone), B subunit [Leptospirillum rubarum]
          Length = 178

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVMI 97
           L  +V++L+ W+R  +L  MTFGLACCA+EMM A   R+D++RFG    RASPRQSD+MI
Sbjct: 18  LQDAVNELLNWSRKSALWPMTFGLACCAIEMMGAVASRFDIDRFGAGVFRASPRQSDLMI 77

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLT KMA  +RR+YDQMPEPRYVI+MGSCA  G  Y  SYSVV+G DRI+PVD+YVP
Sbjct: 78  VAGTLTRKMAPVVRRIYDQMPEPRYVIAMGSCATSGNIYD-SYSVVQGVDRIIPVDVYVP 136

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPP  EAL+ G++ LQ+KI +
Sbjct: 137 GCPPRPEALLDGLMKLQEKIMK 158


>gi|15612247|ref|NP_223900.1| NADH dehydrogenase subunit B [Helicobacter pylori J99]
 gi|81625872|sp|Q9ZJW6|NUOB_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|4155792|gb|AAD06768.1| NADH oxidoreductase I [Helicobacter pylori J99]
 gi|308064039|gb|ADO05926.1| NADH dehydrogenase subunit B [Helicobacter pylori Sat464]
          Length = 159

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   ILSTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DR+VPVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRVVPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|320449689|ref|YP_004201785.1| NADH-quinone oxidoreductase subunit B [Thermus scotoductus SA-01]
 gi|320149858|gb|ADW21236.1| NADH-quinone oxidoreductase, subunit B [Thermus scotoductus SA-01]
          Length = 181

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/154 (55%), Positives = 117/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G L T++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 7   FERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRV++QMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD+YVPGCPP  EALIY ++ LQKK+R
Sbjct: 126 NVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVR 159


>gi|109946844|ref|YP_664072.1| NADH dehydrogenase subunit B [Helicobacter acinonychis str. Sheeba]
 gi|122973434|sp|Q17Z53|NUOB_HELAH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|109714065|emb|CAJ99073.1| NADH dehydrogenase I chain B [Helicobacter acinonychis str. Sheeba]
 gi|317011461|gb|ADU85208.1| NADH dehydrogenase subunit B [Helicobacter pylori SouthAfrica7]
          Length = 159

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   VLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRIIPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|121534363|ref|ZP_01666187.1| NADH-quinone oxidoreductase, B subunit [Thermosinus carboxydivorans
           Nor1]
 gi|121307133|gb|EAX48051.1| NADH-quinone oxidoreductase, B subunit [Thermosinus carboxydivorans
           Nor1]
          Length = 173

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/155 (56%), Positives = 119/155 (76%), Gaps = 1/155 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E+  K  ++T+V+ +++WAR  SL  +T GLACCA+EMM A+  R+DL RFG+   R S
Sbjct: 13  QELLAKNIILTTVETVLSWARGNSLWPLTSGLACCAIEMMCAASGRFDLARFGYEVFRPS 72

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D++I AGTLT KMA  L+R+Y+QMPEP+YVI+MGSCAN GG +  SY+VV G D +
Sbjct: 73  PRQADLLIAAGTLTWKMAPVLKRLYEQMPEPKYVIAMGSCANTGGPFADSYAVVPGVDYV 132

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           +PVD+Y+PGCPP  EALI+GIL L++KI+  G VK
Sbjct: 133 IPVDVYIPGCPPRPEALIHGILQLKRKIQNPGVVK 167


>gi|32267101|ref|NP_861133.1| NADH dehydrogenase subunit B [Helicobacter hepaticus ATCC 51449]
 gi|81665416|sp|Q7VFS3|NUOB_HELHP RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|32263153|gb|AAP78199.1| donor-ubiquinone reductase I [Helicobacter hepaticus ATCC 51449]
          Length = 169

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 114/142 (80%), Gaps = 1/142 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
            +++SVD+L+ W+R+ SL  +T+GLACCA+EMM     R+DL+RFG   RASPRQSD+MI
Sbjct: 16  IVLSSVDKLLNWSRSNSLWGVTYGLACCAIEMMATGGSRFDLDRFGSIFRASPRQSDLMI 75

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           ++GT+T K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+P
Sbjct: 76  ISGTVTKKHAEFVRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDIYLP 134

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GC P  E L Y I++LQ+KIRR
Sbjct: 135 GCAPRPETLQYAIMVLQQKIRR 156


>gi|15645875|ref|NP_208053.1| NADH dehydrogenase subunit B [Helicobacter pylori 26695]
 gi|108563630|ref|YP_627946.1| NADH dehydrogenase subunit B [Helicobacter pylori HPAG1]
 gi|188528050|ref|YP_001910737.1| NADH dehydrogenase subunit B [Helicobacter pylori Shi470]
 gi|207091614|ref|ZP_03239401.1| NADH dehydrogenase subunit B [Helicobacter pylori HPKX_438_AG0C1]
 gi|207108182|ref|ZP_03242344.1| NADH dehydrogenase subunit B [Helicobacter pylori HPKX_438_CA4C1]
 gi|217033582|ref|ZP_03439010.1| hypothetical protein HP9810_899g18 [Helicobacter pylori 98-10]
 gi|81555857|sp|O25851|NUOB_HELPY RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|123073732|sp|Q1CS00|NUOB_HELPH RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238065160|sp|B2UV25|NUOB_HELPS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|2314428|gb|AAD08307.1| NADH-ubiquinone oxidoreductase, NQO6 subunit (NQO6) [Helicobacter
           pylori 26695]
 gi|107837403|gb|ABF85272.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori HPAG1]
 gi|188144290|gb|ACD48707.1| NADH dehydrogenase subunit B [Helicobacter pylori Shi470]
 gi|216943928|gb|EEC23362.1| hypothetical protein HP9810_899g18 [Helicobacter pylori 98-10]
 gi|297380441|gb|ADI35328.1| NADH-quinone oxidoreductase, B subunit [Helicobacter pylori v225d]
 gi|308062545|gb|ADO04433.1| NADH dehydrogenase subunit B [Helicobacter pylori Cuz20]
 gi|315587152|gb|ADU41533.1| NADH-quinone oxidoreductase subunit B [Helicobacter pylori 35A]
 gi|317009945|gb|ADU80525.1| NADH dehydrogenase subunit B [Helicobacter pylori India7]
 gi|317178004|dbj|BAJ55793.1| NADH dehydrogenase subunit B [Helicobacter pylori F16]
 gi|317178445|dbj|BAJ56233.1| NADH dehydrogenase subunit B [Helicobacter pylori F30]
 gi|317180987|dbj|BAJ58773.1| NADH dehydrogenase subunit B [Helicobacter pylori F32]
 gi|317182510|dbj|BAJ60294.1| NADH dehydrogenase subunit B [Helicobacter pylori F57]
 gi|332674064|gb|AEE70881.1| NADH-quinone oxidoreductase subunit B [Helicobacter pylori 83]
          Length = 159

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   VLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DR+VPVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRVVPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|94985017|ref|YP_604381.1| NADH-quinone oxidoreductase, B subunit [Deinococcus geothermalis
           DSM 11300]
 gi|238055292|sp|Q1IZX2|NUOB_DEIGD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|94555298|gb|ABF45212.1| NADH dehydrogenase subunit B [Deinococcus geothermalis DSM 11300]
          Length = 178

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G L +++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 7   FDRDWQELESEGVLFSTLEKLVAWGRSNSLWPATFGLACCAIEMMSSTDGRNDLSRFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQMP+P++VISMG+CA+ GG ++ +Y+VV+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPIMRRVYDQMPDPKWVISMGACASSGGMFN-NYAVVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD++VPGCPP  EALIY ++ LQKK+R
Sbjct: 126 NVDHVVPVDVFVPGCPPRPEALIYAVMQLQKKVR 159


>gi|86158994|ref|YP_465779.1| NADH dehydrogenase subunit B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123498614|sp|Q2IL09|NUOB2_ANADE RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|85775505|gb|ABC82342.1| NADH dehydrogenase subunit B [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 173

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/151 (59%), Positives = 110/151 (72%), Gaps = 4/151 (2%)

Query: 29  ISSEITHKGFLVTS-VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPR 87
           I  E+T    L TS +D L+  AR  SL ++TFGLACC +E+MQ   PR DL RFG  PR
Sbjct: 9   IGGEVT---LLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADLMRFGAIPR 65

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D MIVAGTLT KMA   R +YDQMPEP+YVISMGSC+N GG +   YSV +G D
Sbjct: 66  ASPRQADFMIVAGTLTYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVD 125

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +++PVD+YVPGCPP  EAL  G+L LQ+ +R
Sbjct: 126 KVIPVDVYVPGCPPRPEALTEGLLRLQEIVR 156


>gi|46200221|ref|YP_005888.1| NADH-quinone oxidoreductase chain B [Thermus thermophilus HB27]
 gi|55980054|ref|YP_143351.1| NADH dehydrogenase subunit B [Thermus thermophilus HB8]
 gi|2499331|sp|Q56218|NQO6_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 6; AltName:
           Full=NADH dehydrogenase I subunit 6; AltName: Full=NDH-1
           subunit 6
 gi|81405216|sp|Q72GC9|NUOB_THET2 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|90109659|pdb|2FUG|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 gi|90109667|pdb|2FUG|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 gi|90109675|pdb|2FUG|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 gi|90109683|pdb|2FUG|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 gi|258588593|pdb|3I9V|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 gi|258588601|pdb|3I9V|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 gi|258588609|pdb|3IAM|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           With Bound Nadh
 gi|258588617|pdb|3IAM|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           With Bound Nadh
 gi|258588625|pdb|3IAS|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           Re-Refined To 3.15 Angstrom Resolution
 gi|258588633|pdb|3IAS|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           Re-Refined To 3.15 Angstrom Resolution
 gi|258588641|pdb|3IAS|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           Re-Refined To 3.15 Angstrom Resolution
 gi|258588649|pdb|3IAS|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           Re-Refined To 3.15 Angstrom Resolution
 gi|296863609|pdb|3M9S|6 Chain 6, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 gi|296863622|pdb|3M9S|F Chain F, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 gi|1279862|gb|AAA97939.1| NADH dehydrogenase I, subunit NQO6 [Thermus thermophilus]
 gi|46197849|gb|AAS82261.1| NADH-quinone oxidoreductase chain B [Thermus thermophilus HB27]
 gi|55771467|dbj|BAD69908.1| NADH-quinone oxidoreductase chain 6 [Thermus thermophilus HB8]
          Length = 181

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/154 (55%), Positives = 117/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G L T++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 7   FERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRV++QMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD+YVPGCPP  EALIY ++ LQKK+R
Sbjct: 126 NVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVR 159


>gi|206889652|ref|YP_002248950.1| NADH-quinone oxidoreductase chain b 2 [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|238065044|sp|B5YL35|NUOB2_THEYD RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|206741590|gb|ACI20647.1| NADH-quinone oxidoreductase chain b 2 [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 174

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/147 (57%), Positives = 114/147 (77%), Gaps = 1/147 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I     ++T++D++V W R+ SL  +TFGLACCA+EMM A     DL+RFG   RASPRQ
Sbjct: 20  IKGSNVIITTLDKVVNWGRSNSLWPLTFGLACCAIEMMAAGASHLDLDRFGILFRASPRQ 79

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +DV+I+AGT+T KMA  ++RVYDQMPEP+YVI+MGSCA  GG ++ +YS V+G D+ +PV
Sbjct: 80  ADVIIIAGTVTYKMAPIVKRVYDQMPEPKYVIAMGSCACTGGIFN-TYSTVQGADQFLPV 138

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRR 179
           D+YVPGCPP  EAL+YG+L L++KI R
Sbjct: 139 DVYVPGCPPRPEALMYGVLKLKEKIMR 165


>gi|206602059|gb|EDZ38541.1| NADH dehydrogenase (ubiquinone), B subunit [Leptospirillum sp.
           Group II '5-way CG']
          Length = 178

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVMI 97
           L  +V++++ W+R  +L  MTFGLACCA+EMM A   R+D++RFG    RASPRQSD+MI
Sbjct: 18  LQDAVNEMLNWSRKSALWPMTFGLACCAIEMMGAVASRFDIDRFGAGVFRASPRQSDLMI 77

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLT KMA  +RR+YDQMPEPRYVI+MGSCA  G  Y  SYSVV+G DRI+PVD+YVP
Sbjct: 78  VAGTLTRKMAPVVRRIYDQMPEPRYVIAMGSCATSGNIYD-SYSVVQGVDRIIPVDVYVP 136

Query: 158 GCPPTAEALIYGILLLQKKIRR 179
           GCPP  EAL+ G++ LQ+KI +
Sbjct: 137 GCPPRPEALLDGLMKLQEKIMK 158


>gi|295697422|ref|YP_003590660.1| NADH-quinone oxidoreductase, B subunit [Bacillus tusciae DSM 2912]
 gi|295413024|gb|ADG07516.1| NADH-quinone oxidoreductase, B subunit [Bacillus tusciae DSM 2912]
          Length = 177

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 115/151 (76%)

Query: 28  RISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPR 87
           ++  +   +  ++T+++++  WAR+ S+  ++FGLACCA+EMM  S   YD +RFG   R
Sbjct: 13  QLEEKELERNVVLTTLEKVKAWARSNSMWPLSFGLACCAIEMMATSGSHYDADRFGVFFR 72

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIV+GT+T KMA  LRR+YDQM EPR+VI+MGSCA  GG Y  SYSVV G D
Sbjct: 73  ASPRQADLMIVSGTVTKKMAPLLRRLYDQMAEPRWVIAMGSCATAGGPYVRSYSVVNGVD 132

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           +IVPVD+Y+PGCPP+  ALIYG+  LQ+KIR
Sbjct: 133 QIVPVDVYIPGCPPSPVALIYGLNKLQEKIR 163


>gi|326800573|ref|YP_004318392.1| NAD(P)H-quinone oxidoreductase subunit K [Sphingobacterium sp. 21]
 gi|326551337|gb|ADZ79722.1| NAD(P)H-quinone oxidoreductase subunit K [Sphingobacterium sp. 21]
          Length = 163

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           +S  T  G +V  +D L+ WAR  S+  ++FG+ACCA+EMM A    YDL+R+G  PRAS
Sbjct: 3   TSTQTDSGIVVAKLDDLLNWARLSSMWPVSFGIACCAIEMMGAMAATYDLDRYGVFPRAS 62

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCDR 148
           PRQ+DV+I+AGT+T KMA  +R +Y+QMPEP+YVISMGSC+N GG Y+ + Y VV+G D+
Sbjct: 63  PRQADVIIIAGTVTFKMADRIRLLYEQMPEPKYVISMGSCSNCGGPYWQHGYHVVKGVDK 122

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           I+PVDIYV GCPP  EALI   L LQKKI
Sbjct: 123 IIPVDIYVQGCPPRPEALIGAFLELQKKI 151


>gi|302035990|ref|YP_003796312.1| NADH-quinone oxidoreductase subunit B [Candidatus Nitrospira
           defluvii]
 gi|300604054|emb|CBK40386.1| NADH-quinone oxidoreductase, subunit B [Candidatus Nitrospira
           defluvii]
          Length = 159

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/144 (61%), Positives = 112/144 (77%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
             L T++D  V WAR  SL  MTFGLACCA+EM+ +   RYD++RFG    RASPRQSD+
Sbjct: 11  NILTTNLDAFVGWARKSSLWPMTFGLACCAIEMIASVSSRYDIDRFGAGVFRASPRQSDL 70

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGT++ KMA  +RR+YDQM EPRYVISMGSCA  G +Y+ SY+VV+G D+IVPVD+Y
Sbjct: 71  MIVAGTVSRKMAPVIRRIYDQMAEPRYVISMGSCATSGNHYN-SYAVVQGVDQIVPVDVY 129

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           + GCPP  EAL+ G+L LQ+KI+R
Sbjct: 130 IAGCPPRPEALLDGLLKLQEKIQR 153


>gi|257459165|ref|ZP_05624284.1| NADH-quinone oxidoreductase, B subunit [Campylobacter gracilis
           RM3268]
 gi|257443550|gb|EEV18674.1| NADH-quinone oxidoreductase, B subunit [Campylobacter gracilis
           RM3268]
          Length = 169

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (78%), Gaps = 1/140 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T+VD+L+ W R+ SL  MT+GLACCA+EMM A   R+D +RFG   RAS +QSDVMI+
Sbjct: 17  VLTTVDKLIAWGRSNSLWAMTYGLACCAIEMMAAGAGRFDFDRFGTIFRASAKQSDVMII 76

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL+ K A   RR+YD MPEP++VISMGSCAN GG ++ +Y+ V+GCDRIVPVDIY+PG
Sbjct: 77  AGTLSKKHAEFTRRLYDAMPEPKWVISMGSCANTGGMFN-TYATVQGCDRIVPVDIYLPG 135

Query: 159 CPPTAEALIYGILLLQKKIR 178
           C P  E L + +++LQKKIR
Sbjct: 136 CAPRPETLQFAMMVLQKKIR 155


>gi|218295761|ref|ZP_03496557.1| NADH-quinone oxidoreductase, B subunit [Thermus aquaticus Y51MC23]
 gi|218243920|gb|EED10447.1| NADH-quinone oxidoreductase, B subunit [Thermus aquaticus Y51MC23]
          Length = 181

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F +   E+  +G L T++++LV W R+ SL   TFGLACCA+EMM ++  R DL RFG  
Sbjct: 7   FEKDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRV++QMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVD+YVPGCPP  EALIY ++ LQKK+R
Sbjct: 126 NVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVR 159


>gi|325104079|ref|YP_004273733.1| NADH dehydrogenase subunit B [Pedobacter saltans DSM 12145]
 gi|324972927|gb|ADY51911.1| NADH dehydrogenase subunit B [Pedobacter saltans DSM 12145]
          Length = 161

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 82/152 (53%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA 88
           +  ++ + G +VT +D L+ W+R  SL  ++FGLACCA+EMM +    +D +R G  PR 
Sbjct: 3   LEKQLENGGLIVTKLDDLLNWSRLSSLWPLSFGLACCAIEMMGSYSSNFDFDRLGVFPRP 62

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCAN-GGGYYHYSYSVVRGCD 147
           SPRQ+DV+I+AGT+T KMA  ++R+Y+QMPEP+YVISMGSC+N GG Y+ + Y VV+G D
Sbjct: 63  SPRQADVIIIAGTVTFKMAERIKRLYEQMPEPKYVISMGSCSNCGGPYWEHGYHVVKGVD 122

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           RI+PVD+YV GCPP  EALI  I+ LQ+KI +
Sbjct: 123 RIIPVDVYVQGCPPRPEALIGAIIELQQKIEK 154


>gi|305666195|ref|YP_003862482.1| NADH-quinone oxidoreductase chain B [Maribacter sp. HTCC2170]
 gi|88707694|gb|EAQ99935.1| NADH-quinone oxidoreductase chain B [Maribacter sp. HTCC2170]
          Length = 185

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 82/142 (57%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           +VTS+D+++ W R+ SL  + FG +CCA+EMMQ    R+D  RFGF   R SPRQ+D++I
Sbjct: 26  IVTSLDKIINWGRSNSLWSLYFGTSCCAIEMMQTGAARHDYSRFGFEVARPSPRQADLII 85

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCA-NGGGYYHYSYSVVRGCDRIVPVDIYV 156
           +AGT+ NKMA  LRR+YDQM EPRYVI+MG+CA +GG +++ +YSVV+G D ++PVD+YV
Sbjct: 86  IAGTIVNKMAPVLRRLYDQMAEPRYVIAMGACAISGGPFFYNTYSVVKGADHVIPVDVYV 145

Query: 157 PGCPPTAEALIYGILLLQKKIR 178
           PGCPP  EAL+ G+L+LQ KIR
Sbjct: 146 PGCPPRPEALLEGMLMLQDKIR 167


>gi|222824437|ref|YP_002576011.1| NADH-quinone oxidoreductase, B subunit [Campylobacter lari RM2100]
 gi|222539658|gb|ACM64759.1| NADH-quinone oxidoreductase, B subunit [Campylobacter lari RM2100]
          Length = 165

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 114/148 (77%), Gaps = 1/148 (0%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           ++ +   ++T+VD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR
Sbjct: 6   KMNNAPVVLTTVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGARYDFDRFGTIFRASPR 65

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QS+VMI+AGTL+ K A   RR+YDQMP+P++VISMGSCAN GG ++ +YS V+G DRI+P
Sbjct: 66  QSEVMIIAGTLSKKHAEFTRRLYDQMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIP 124

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VDIYVPGC P  E   + +++LQK+IR+
Sbjct: 125 VDIYVPGCAPRPETFQFALMILQKRIRK 152


>gi|15606518|ref|NP_213898.1| NADH dehydrogenase I chain B [Aquifex aeolicus VF5]
 gi|6647653|sp|O67334|NUOB_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|2983736|gb|AAC07297.1| NADH dehydrogenase I chain B [Aquifex aeolicus VF5]
          Length = 179

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/152 (54%), Positives = 114/152 (75%), Gaps = 1/152 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           I   GF+ T+V++L+ W R  SL  +T GLACCA+EMM  +  R+DL+R G   RASPRQ
Sbjct: 4   INSNGFVTTTVEELLRWGRRNSLWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQ 63

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +DV+IVAGT+ NK+A  L+ ++DQMP+P++ ISMG CA+ GG +  +YS ++G DRI+PV
Sbjct: 64  ADVLIVAGTVVNKVAPMLKLIWDQMPDPKWCISMGGCASAGGPFP-TYSTLQGVDRIIPV 122

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           D+Y+PGCPPT + LIYGIL LQ+KI+  G  K
Sbjct: 123 DVYIPGCPPTPQGLIYGILQLQRKIKEQGITK 154


>gi|224437358|ref|ZP_03658330.1| NADH dehydrogenase subunit B [Helicobacter cinaedi CCUG 18818]
 gi|313143821|ref|ZP_07806014.1| NADH dehydrogenase subunit B [Helicobacter cinaedi CCUG 18818]
 gi|313128852|gb|EFR46469.1| NADH dehydrogenase subunit B [Helicobacter cinaedi CCUG 18818]
          Length = 169

 Score =  184 bits (466), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 112/140 (80%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           ++SVD+L+ W R+ SL  +T+GLACCA+EMM     R+DL+RFG   RASPRQ+D+MI++
Sbjct: 18  LSSVDKLLNWGRSNSLWGLTYGLACCAIEMMATGGSRFDLDRFGTIFRASPRQADLMIIS 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+T K A  +RR+YDQMPEP++VISMGSCAN GG ++ +YS V+G DRI+PVDIY+PGC
Sbjct: 78  GTVTKKHAEFVRRLYDQMPEPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQ+KIR+
Sbjct: 137 APRPETLQYAVMVLQQKIRK 156


>gi|251773166|gb|EES53719.1| NADH dehydrogenase (ubiquinone), B subunit [Leptospirillum
           ferrodiazotrophum]
          Length = 165

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 110/140 (78%), Gaps = 2/140 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVMI 97
           L  +V+ +V W+R  +L  MTFGLACCA+EMM A   R+D++RFG    RASPRQSD+MI
Sbjct: 18  LQDAVNDIVNWSRKSALWPMTFGLACCAIEMMGAVASRFDIDRFGAGVFRASPRQSDLMI 77

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLT KMA  +R++YDQMPEPRYVI+MGSCA  G  Y  SYSVV+G DR++PVD+YVP
Sbjct: 78  VAGTLTRKMAPVVRKIYDQMPEPRYVIAMGSCATSGNIYD-SYSVVQGVDRLIPVDVYVP 136

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPP  EAL+ G++ LQ+KI
Sbjct: 137 GCPPRPEALLDGLIKLQEKI 156


>gi|315453251|ref|YP_004073521.1| NADH-quinone oxidoreductase subunit B [Helicobacter felis ATCC
           49179]
 gi|315132303|emb|CBY82931.1| NADH-quinone oxidoreductase subunit B [Helicobacter felis ATCC
           49179]
          Length = 169

 Score =  184 bits (466), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T++D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+A
Sbjct: 18  LTTLDKLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMIIA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A   RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DR++PVDIY+PGC
Sbjct: 78  GTLTKKHAEFTRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGVDRVIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQ KIRR
Sbjct: 137 APRPETLQYALMVLQDKIRR 156


>gi|258592356|emb|CBE68665.1| NADH-quinone oxidoreductase subunit 6 (NADH dehydrogenase I chain
           6) (NDH-1 subunit 6) [NC10 bacterium 'Dutch sediment']
          Length = 181

 Score =  183 bits (465), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 114/146 (78%), Gaps = 2/146 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQS 93
            +G L+T++D LV WAR  S+   +FGLACCA+EMM     R+DL RFG    R SPRQS
Sbjct: 20  ERGLLLTTLDSLVNWARKSSIWPASFGLACCAIEMMATGASRFDLARFGAEVFRGSPRQS 79

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD 153
           D+MIVAG ++ KMA  LRR+YDQMPEP++VI+MG+CA+ GG ++ +Y++V+G D+IVPVD
Sbjct: 80  DLMIVAGRVSRKMAPVLRRIYDQMPEPKWVIAMGACASCGGIFN-TYTIVQGVDQIVPVD 138

Query: 154 IYVPGCPPTAEALIYGILLLQKKIRR 179
           +YVPGCPP  E LI+GI+LLQ+KI +
Sbjct: 139 VYVPGCPPRPEQLIHGIMLLQEKIAK 164


>gi|152993807|ref|YP_001359528.1| NADH dehydrogenase subunit B [Sulfurovum sp. NBC37-1]
 gi|238065218|sp|A6QCG2|NUOB_SULNB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|151425668|dbj|BAF73171.1| NADH-quinone oxidoreductase, chain B [Sulfurovum sp. NBC37-1]
          Length = 172

 Score =  183 bits (465), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +TSVD+LV W R+ SL  +T+GLACCA+EMM +   RYD +R G   RASPRQ+DVMI+A
Sbjct: 18  LTSVDKLVNWGRSNSLWPLTYGLACCAIEMMASGASRYDFDRMGTIFRASPRQADVMILA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTL+ K +   RR+YDQM EP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+PGC
Sbjct: 78  GTLSKKHSEFARRLYDQMTEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQKKIRR
Sbjct: 137 APRPETLQYALMMLQKKIRR 156


>gi|57168317|ref|ZP_00367451.1| NADH2 dehydrogenase (ubiquinone) I chain B Cj1578c [Campylobacter
           coli RM2228]
 gi|153952278|ref|YP_001398860.1| NADH dehydrogenase subunit B [Campylobacter jejuni subsp. doylei
           269.97]
 gi|157415794|ref|YP_001483050.1| NADH dehydrogenase subunit B [Campylobacter jejuni subsp. jejuni
           81116]
 gi|305432374|ref|ZP_07401536.1| NADH-quinone oxidoreductase subunit B [Campylobacter coli JV20]
 gi|238055278|sp|A8FNN6|NUOB_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|254767792|sp|A7H5T0|NUOB_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|57020125|gb|EAL56799.1| NADH2 dehydrogenase (ubiquinone) I chain B Cj1578c [Campylobacter
           coli RM2228]
 gi|152939724|gb|ABS44465.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|157386758|gb|ABV53073.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           81116]
 gi|304444413|gb|EFM37064.1| NADH-quinone oxidoreductase subunit B [Campylobacter coli JV20]
 gi|307748433|gb|ADN91703.1| NADH-quinone oxidoreductase subunit B [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315929523|gb|EFV08716.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 305]
 gi|315931258|gb|EFV10228.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 167

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 84/141 (59%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  VLTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YDQMP+P++VISMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDQMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|57238591|ref|YP_179722.1| NADH dehydrogenase subunit B [Campylobacter jejuni RM1221]
 gi|148925724|ref|ZP_01809412.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|205355593|ref|ZP_03222363.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|81557394|sp|Q5HSL3|NUOB_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|57167395|gb|AAW36174.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni
           RM1221]
 gi|145845734|gb|EDK22825.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|205346370|gb|EDZ33003.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315059028|gb|ADT73357.1| NADH-ubiquinone oxidoreductase chain B [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 167

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 84/141 (59%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  VLTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YDQMP+P++VISMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDQMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|86149321|ref|ZP_01067552.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86152325|ref|ZP_01070536.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|86152543|ref|ZP_01070748.1| nadh-quinone oxidoreductase chain 6 [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88596514|ref|ZP_01099751.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121613264|ref|YP_001001218.1| NADH dehydrogenase subunit B [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|167006111|ref|ZP_02271869.1| NADH dehydrogenase subunit B [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|218563167|ref|YP_002344947.1| NADH dehydrogenase subunit B [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|283956950|ref|ZP_06374422.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           1336]
 gi|315124988|ref|YP_004066992.1| NADH dehydrogenase beta subunit [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|123336622|sp|Q0P850|NUOB_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|238055279|sp|A1W1H7|NUOB_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|85840103|gb|EAQ57361.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85840814|gb|EAQ58065.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85843428|gb|EAQ60638.1| nadh-quinone oxidoreductase chain 6 [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249799|gb|EAQ72758.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88191355|gb|EAQ95327.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360874|emb|CAL35675.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|283791451|gb|EFC30248.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           1336]
 gi|284926773|gb|ADC29125.1| NADH dehydrogenase I chain B [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315018710|gb|ADT66803.1| NADH dehydrogenase beta subunit [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315927676|gb|EFV07007.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 167

 Score =  183 bits (465), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 84/141 (59%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  VLTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YDQMP+P++VISMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDQMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|91065096|gb|ABE03928.1| NuoB [Theonella swinhoei bacterial symbiont clone pSW1H8]
          Length = 178

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+   G L +++ +LV W R+ SL   TFGLACCA+EMMQ++  R DL RFG  
Sbjct: 7   FERDVQELETDGILFSTLGKLVAWGRSNSLWPATFGLACCAIEMMQSTNSRNDLARFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVY+QMP+P++VISMG+CA+ GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVYEQMPDPKWVISMGACASSGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             D +VPVDI+VPGCPP  EAL+Y ++ LQK++R
Sbjct: 126 NVDSVVPVDIFVPGCPPRPEALVYAVMQLQKRVR 159


>gi|313679586|ref|YP_004057325.1| NADH dehydrogenase subunit b [Oceanithermus profundus DSM 14977]
 gi|313152301|gb|ADR36152.1| NADH dehydrogenase subunit B [Oceanithermus profundus DSM 14977]
          Length = 179

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)

Query: 26  FSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA 85
           F R   E+  +G L T++++LV W R+ SL  +TFGLACCA+EMM +S  R DL RFG  
Sbjct: 7   FERDVQELEREGILFTTLEKLVAWGRSNSLWPVTFGLACCAIEMMASSNARNDLSRFGSE 66

Query: 86  P-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVR 144
             RASPRQ+DVMIVAG L+ KMA  +RRVYDQM +P++VI+MG+CA  GG ++ +Y++V+
Sbjct: 67  VFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMGDPKWVIAMGACAASGGMFN-NYAIVQ 125

Query: 145 GCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             + +VPVD+YVPGCPP  EALIY ++ LQKKIR
Sbjct: 126 SVESVVPVDVYVPGCPPRPEALIYAVMQLQKKIR 159


>gi|190893214|ref|YP_001979756.1| NADH-ubiquinone oxidoreductase, chain B [Rhizobium etli CIAT 652]
 gi|238065034|sp|B3PY57|NUOB2_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|190698493|gb|ACE92578.1| NADH-ubiquinone oxidoreductase protein, chain B [Rhizobium etli
           CIAT 652]
          Length = 167

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D ++ W+R+ +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSIINWSRSSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI+R
Sbjct: 132 CPPRPEALMHGFLLLQEKIKR 152


>gi|296274502|ref|YP_003657133.1| NADH-quinone oxidoreductase subunit B [Arcobacter nitrofigilis DSM
           7299]
 gi|296098676|gb|ADG94626.1| NADH-quinone oxidoreductase, B subunit [Arcobacter nitrofigilis DSM
           7299]
          Length = 169

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 112/140 (80%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +++VD++V + R+ SL  +T+GLACCA+EMM +   RYD +RFG   RASPRQ+DV+IVA
Sbjct: 18  LSTVDKIVNFGRSNSLWPLTYGLACCAIEMMASGASRYDFDRFGTIFRASPRQADVLIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  +RR+YDQMP+P++VISMGSCAN GG ++ +Y+ V+G DR++PVDIY+PGC
Sbjct: 78  GTLTKKHAEYMRRLYDQMPDPKWVISMGSCANTGGMFN-TYATVQGVDRVIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQKKIRR
Sbjct: 137 APRPETLQYALMMLQKKIRR 156


>gi|322378681|ref|ZP_08053114.1| Donor-ubiquinone reductase I [Helicobacter suis HS1]
 gi|322380176|ref|ZP_08054411.1| NADH dehydrogenase subunit B [Helicobacter suis HS5]
 gi|321147391|gb|EFX42056.1| NADH dehydrogenase subunit B [Helicobacter suis HS5]
 gi|321148898|gb|EFX43365.1| Donor-ubiquinone reductase I [Helicobacter suis HS1]
          Length = 196

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           ++S+D+L+ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RASPRQSDVMI+A
Sbjct: 45  LSSLDRLLNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMIIA 104

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A   RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DR++PVDIY+PGC
Sbjct: 105 GTLTKKHAEFTRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGVDRVIPVDIYLPGC 163

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQ KIRR
Sbjct: 164 APRPETLQYALMVLQDKIRR 183


>gi|197121687|ref|YP_002133638.1| NADH dehydrogenase subunit B [Anaeromyxobacter sp. K]
 gi|220916483|ref|YP_002491787.1| NADH-quinone oxidoreductase, B subunit [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|238065005|sp|B4UIA4|NUOB1_ANASK RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|196171536|gb|ACG72509.1| NADH-quinone oxidoreductase, B subunit [Anaeromyxobacter sp. K]
 gi|219954337|gb|ACL64721.1| NADH-quinone oxidoreductase, B subunit [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 173

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/139 (59%), Positives = 104/139 (74%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
            + +D L+  AR  SL ++TFGLACC +E+MQ   PR D+ RFG  PRASPRQ+D MIVA
Sbjct: 18  TSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADVMRFGAIPRASPRQADFMIVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT KMA   R +YDQMPEP+YVISMGSC+N GG +   YSV +G D+++PVD+YVPGC
Sbjct: 78  GTLTYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGC 137

Query: 160 PPTAEALIYGILLLQKKIR 178
           PP  EAL  G+L LQ+ +R
Sbjct: 138 PPRPEALTEGLLRLQEIVR 156


>gi|307637933|gb|ADN80383.1| NADH-ubiquinone oxidoreductase chain B [Helicobacter pylori 908]
          Length = 159

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/146 (57%), Positives = 112/146 (76%), Gaps = 1/146 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           +++++D+L+ W R+ SL  +T+GLA CA+EMM     R+D +RFG   RASPRQSDVMI+
Sbjct: 7   ILSTLDKLLNWGRSNSLWPLTYGLAWCAIEMMATGGSRFDFDRFGTIFRASPRQSDVMII 66

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTLT K A  +RR+YDQMPEP++VISMGSCAN GG ++ +Y+ V+G DRIVPVDIY+PG
Sbjct: 67  AGTLTKKHAEFMRRLYDQMPEPKWVISMGSCANTGGMFN-TYATVQGADRIVPVDIYLPG 125

Query: 159 CPPTAEALIYGILLLQKKIRRVGNVK 184
           C P  E L Y +++LQ KIRR   +K
Sbjct: 126 CAPRPETLQYALMVLQDKIRRSKAIK 151


>gi|237751580|ref|ZP_04582060.1| NADH dehydrogenase subunit I B [Helicobacter bilis ATCC 43879]
 gi|229372946|gb|EEO23337.1| NADH dehydrogenase subunit I B [Helicobacter bilis ATCC 43879]
          Length = 169

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 3/155 (1%)

Query: 32  EITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           E++ +G  V   SVD+++ W R+ SL  +T+GLACCA+EMM     R+D +RFG   RAS
Sbjct: 8   ELSPRGMPVALGSVDKILNWGRSNSLWPLTYGLACCAIEMMATGGSRFDFDRFGIIFRAS 67

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQSDVMI+AGTLT K A   RR+YDQMPEP++V+SMGSCAN GG ++ +Y+ V+G DRI
Sbjct: 68  PRQSDVMIIAGTLTKKHAEFTRRLYDQMPEPKWVVSMGSCANTGGMFN-TYATVQGVDRI 126

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           +PVDIY+PGC P  E L Y +++LQ+KIR    +K
Sbjct: 127 IPVDIYLPGCAPRPETLQYAMMVLQQKIRSEKAIK 161


>gi|327191021|gb|EGE58075.1| NADH-ubiquinone oxidoreductase protein, chain B [Rhizobium etli
           CNPAF512]
          Length = 167

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D ++ W+R+ +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSVINWSRSSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI+R
Sbjct: 132 CPPRPEALMHGFLLLQEKIKR 152


>gi|283953809|ref|ZP_06371340.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794850|gb|EFC33588.1| NADH-quinone oxidoreductase, B subunit [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 167

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  VLTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YDQMP+P++V+SMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDQMPDPKWVVSMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|302035622|ref|YP_003795944.1| NADH-quinone oxidoreductase subunit B [Candidatus Nitrospira
           defluvii]
 gi|300603686|emb|CBK40017.1| NADH-quinone oxidoreductase, subunit B [Candidatus Nitrospira
           defluvii]
          Length = 175

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 109/140 (77%), Gaps = 2/140 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVMI 97
           +  +V++ V WAR GSL  MTFGLACCA+EM+ A   RYD++R+G    RASPRQSD+MI
Sbjct: 18  ITLTVEKAVNWARKGSLWPMTFGLACCAIEMIAAVSSRYDMDRYGAGVFRASPRQSDLMI 77

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+  +MA  +R++YDQMPEP+YVI+MGSCA  G  Y  SYSVV+G DR VPVDIYVP
Sbjct: 78  VAGTVCRRMAPVIRKIYDQMPEPKYVIAMGSCATSGNIYD-SYSVVQGVDRFVPVDIYVP 136

Query: 158 GCPPTAEALIYGILLLQKKI 177
           GCPPT EAL  GIL LQ++I
Sbjct: 137 GCPPTPEALFDGILKLQERI 156


>gi|86359327|ref|YP_471219.1| NADH-ubiquinone oxidoreductase chain B protein [Rhizobium etli CFN
           42]
 gi|123510666|sp|Q2K3U4|NUOB3_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 3; AltName:
           Full=NADH dehydrogenase I subunit B 3; AltName:
           Full=NDH-1 subunit B 3
 gi|86283429|gb|ABC92492.1| NADH-ubiquinone oxidoreductase chain B protein [Rhizobium etli CFN
           42]
          Length = 167

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D ++ W+R+ +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSVINWSRSSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI+R
Sbjct: 132 CPPRPEALMHGFLLLQEKIKR 152


>gi|218460106|ref|ZP_03500197.1| NADH-ubiquinone oxidoreductase protein, chain B [Rhizobium etli Kim
           5]
          Length = 167

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D +++W+R  +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI+R
Sbjct: 132 CPPRPEALMHGFLLLQEKIKR 152


>gi|313681394|ref|YP_004059132.1| NADH dehydrogenase subunit b [Sulfuricurvum kujiense DSM 16994]
 gi|313154254|gb|ADR32932.1| NADH dehydrogenase subunit B [Sulfuricurvum kujiense DSM 16994]
          Length = 169

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 110/140 (78%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T++D++V W R+ SL  +T+GLACC +EMM +   RYD +RFG   RASPRQ+++M+VA
Sbjct: 18  LTTIDKVVNWGRSNSLWALTYGLACCGIEMMASGASRYDFDRFGTIFRASPRQAELMVVA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTLT K A  +RR+YDQM EP++VISMGSCAN GG ++ +Y+ V+G DR++PVD+Y+PGC
Sbjct: 78  GTLTKKHAEFIRRLYDQMTEPKWVISMGSCANTGGMFN-TYATVQGVDRVIPVDLYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +LLLQ+KIRR
Sbjct: 137 APRPETLQYAVLLLQQKIRR 156


>gi|296122635|ref|YP_003630413.1| NADH-quinone oxidoreductase, subunit beta [Planctomyces limnophilus
           DSM 3776]
 gi|296014975|gb|ADG68214.1| NADH-quinone oxidoreductase, B subunit [Planctomyces limnophilus
           DSM 3776]
          Length = 225

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 114/146 (78%), Gaps = 2/146 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQS 93
            +  +VT+++Q + W +  S+  +TFG+ACCA+EMM   M +YDL+RFG  A RA+PRQ+
Sbjct: 33  EENLIVTTLEQAMNWGQLSSVWPLTFGIACCAMEMMATGMSKYDLDRFGSGAFRATPRQA 92

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCDRIVPV 152
           D+MIVAGT+T KMAS +RR+YDQMP+P+YVI+MG+C  GGG Y+ Y Y VV+G D +VPV
Sbjct: 93  DLMIVAGTVTYKMASRIRRLYDQMPDPKYVIAMGACTIGGGPYFKYGYHVVKGVDLVVPV 152

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIR 178
           D+Y+PGCPP  EAL+ G++ +Q KIR
Sbjct: 153 DVYIPGCPPRPEALLEGVMRIQDKIR 178


>gi|297585416|ref|YP_003701196.1| NADH-quinone oxidoreductase subunit B [Bacillus selenitireducens
           MLS10]
 gi|297143873|gb|ADI00631.1| NADH-quinone oxidoreductase, B subunit [Bacillus selenitireducens
           MLS10]
          Length = 175

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/147 (58%), Positives = 107/147 (72%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
           E  +K    T VDQ+  W+RT S   ++FGLACCA+EMM     RYD +RFG   RASPR
Sbjct: 18  EDINKNVFFTKVDQIKAWSRTRSFWPLSFGLACCAIEMMATGGNRYDFDRFGVIFRASPR 77

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
            +DVMIVAGT+T KMA  LR +YDQMPEP++VI+MGSCA  GG Y  +YSV+ G D+IVP
Sbjct: 78  HADVMIVAGTVTGKMAPVLRTLYDQMPEPKWVIAMGSCATCGGPYKEAYSVLNGVDKIVP 137

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIR 178
           VD+YV GCPPT  AL+ G+  L++KIR
Sbjct: 138 VDVYVSGCPPTPPALLDGVERLREKIR 164


>gi|206889677|ref|YP_002248748.1| NADH-quinone oxidoreductase chain b 2 [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|238065023|sp|B5YKI3|NUOB1_THEYD RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|206741615|gb|ACI20672.1| NADH-quinone oxidoreductase chain b 2 [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 199

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++T++D++ +W R  SL  +TFGLACCA+EMM  +   YDL+RFG   RA+PRQ+DVMI+
Sbjct: 27  IITTLDKIASWGRCSSLWPLTFGLACCAIEMMATAASHYDLDRFGIIMRATPRQADVMII 86

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T KMA  +  +Y QMPEPRYVI+MGSCA  GG ++ +YS V+G D I+PVD+Y+PG
Sbjct: 87  AGTVTKKMAPVIVNLYHQMPEPRYVIAMGSCACSGGIFN-TYSTVQGVDEILPVDVYIPG 145

Query: 159 CPPTAEALIYGILLLQKKIR 178
           CPP  EALI G+L LQ+KI+
Sbjct: 146 CPPRPEALIEGLLKLQEKIK 165


>gi|16263286|ref|NP_436079.1| NuoB2 NADH I chain B [Sinorhizobium meliloti 1021]
 gi|307304395|ref|ZP_07584146.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           BL225C]
 gi|307318102|ref|ZP_07597538.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           AK83]
 gi|17380450|sp|P56897|NUOB2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|14523963|gb|AAK65491.1| NuoB2 NADH:quinone oxidoreductase (chain B) [Sinorhizobium meliloti
           1021]
 gi|306896143|gb|EFN26893.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           AK83]
 gi|306902597|gb|EFN33191.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium meliloti
           BL225C]
          Length = 167

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D +++W+R  +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI++
Sbjct: 132 CPPRPEALMHGFLLLQEKIKK 152


>gi|5650745|emb|CAB51630.1| putative NADH-ubiquinone oxidoreductase subunit [Sinorhizobium
           meliloti]
          Length = 167

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 111/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D +++W+R  +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI++
Sbjct: 132 CPPRPEALMHGFLLLQEKIKK 152


>gi|161870822|ref|YP_001599995.1| NADH dehydrogenase I chain B [Neisseria meningitidis 053442]
 gi|161596375|gb|ABX74035.1| NADH dehydrogenase I chain B [Neisseria meningitidis 053442]
          Length = 124

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +  KGF+ TS D ++ + RTGSL  +TFGLACCAVEMM A M RYDL+RFG   R SPRQ
Sbjct: 6   VLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHAGMARYDLDRFGIIFRPSPRQ 65

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           +D+MIV GTLTNKMA ALRRVYDQ+ EPR+V+SMGSCANGGGYYHYSYSVVRG DR+V
Sbjct: 66  ADLMIVRGTLTNKMAPALRRVYDQLAEPRWVLSMGSCANGGGYYHYSYSVVRGADRVV 123


>gi|288803376|ref|ZP_06408809.1| NADH dehydrogenase I, B/C/D subunit protein [Prevotella
           melaninogenica D18]
 gi|288334196|gb|EFC72638.1| NADH dehydrogenase I, B/C/D subunit protein [Prevotella
           melaninogenica D18]
          Length = 308

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 115/161 (71%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +   S+++SE+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLSKMASELNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMSVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YDQM EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDQMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|317121592|ref|YP_004101595.1| NADH-quinone oxidoreductase subunit beta [Thermaerobacter
           marianensis DSM 12885]
 gi|315591572|gb|ADU50868.1| NADH-quinone oxidoreductase, B subunit [Thermaerobacter marianensis
           DSM 12885]
          Length = 350

 Score =  181 bits (458), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G L T + +LV W R  S+ ++ FGLACCA+EMM A   R DL+R G   RASPRQ+D+M
Sbjct: 201 GILTTRLQELVNWGRANSMWYLLFGLACCAIEMMAAGGTRTDLDRIGSVFRASPRQADLM 260

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IV+GT+T KMA  ++ +YDQM EP++V+SMG+CA  GG Y+  Y+VV G D+I+PVD+YV
Sbjct: 261 IVSGTVTEKMAPVVKTLYDQMAEPKFVVSMGACATNGGPYYQGYNVVDGVDKIIPVDVYV 320

Query: 157 PGCPPTAEALIYGILLLQKKIRRVG 181
            GCPP  EAL++ IL LQ K+R++G
Sbjct: 321 AGCPPRPEALVHAILKLQDKVRKIG 345


>gi|153004155|ref|YP_001378480.1| NADH dehydrogenase subunit B [Anaeromyxobacter sp. Fw109-5]
 gi|218527973|sp|A7H9V0|NUOB1_ANADF RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|152027728|gb|ABS25496.1| NADH-quinone oxidoreductase, B subunit [Anaeromyxobacter sp.
           Fw109-5]
          Length = 172

 Score =  181 bits (458), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F  + +D+L+  AR  SL ++ FGLACC +E+MQ   PR D+ RFG  PRASPRQ+D MI
Sbjct: 16  FHTSQLDKLINMARENSLWYLLFGLACCGIELMQFGGPRADVMRFGAIPRASPRQADFMI 75

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGTLT KMA   + +YDQMPEP+YVISMGSC+N GG +   YSV +G D+++PVD+YVP
Sbjct: 76  VAGTLTYKMAERAKLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVP 135

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL  G++ LQ+ IR
Sbjct: 136 GCPPRPEALTEGLIRLQELIR 156


>gi|315638063|ref|ZP_07893248.1| NADH-quinone oxidoreductase subunit B [Campylobacter upsaliensis
           JV21]
 gi|315481911|gb|EFU72530.1| NADH-quinone oxidoreductase subunit B [Campylobacter upsaliensis
           JV21]
          Length = 167

 Score =  181 bits (458), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 109/141 (77%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  ILTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YD MP+P++VISMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDMMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|302345400|ref|YP_003813753.1| NADH-quinone oxidoreductase, B subunit [Prevotella melaninogenica
           ATCC 25845]
 gi|302149419|gb|ADK95681.1| NADH-quinone oxidoreductase, B subunit [Prevotella melaninogenica
           ATCC 25845]
          Length = 305

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 115/161 (71%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +   S+++SE+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLSKMASELNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMSVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YDQM EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDQMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|57505815|ref|ZP_00371740.1| NADH2 dehydrogenase (ubiquinone) I chain B Cj1578c [Campylobacter
           upsaliensis RM3195]
 gi|57015845|gb|EAL52634.1| NADH2 dehydrogenase (ubiquinone) I chain B Cj1578c [Campylobacter
           upsaliensis RM3195]
          Length = 167

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 109/141 (77%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++TSVD+LV W R+ SL  +++GLACCA+EMM A   RYD +RFG   RASPR S+VMI+
Sbjct: 15  VLTSVDKLVQWGRSNSLWALSYGLACCAIEMMAAGGSRYDFDRFGTIFRASPRHSEVMII 74

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL  K A   RR+YD MP+P++VISMGSCAN GG ++ +YS V+G DRI+PVDIYVPG
Sbjct: 75  AGTLCKKHAEFTRRLYDMMPDPKWVISMGSCANTGGMFN-TYSTVQGVDRIIPVDIYVPG 133

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           C P  E+  + +++LQKKIR+
Sbjct: 134 CAPRPESFQFALMILQKKIRK 154


>gi|291280356|ref|YP_003497191.1| NADH-quinone oxidoreductase subunit B [Deferribacter desulfuricans
           SSM1]
 gi|290755058|dbj|BAI81435.1| NADH-quinone oxidoreductase, B subunit [Deferribacter desulfuricans
           SSM1]
          Length = 158

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 4/150 (2%)

Query: 33  ITHK---GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS 89
           I HK     +  ++D ++ WAR  S+  +TFGLACCA+EMM A   +YDL+R G   RA+
Sbjct: 4   IEHKFSDNIITATIDGVINWARKSSIWPVTFGLACCAIEMMAAGASKYDLDRLGVIFRAT 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAGT+T KMA  +R+VYDQMPEP++VI+MGSCA  GG ++ +YS V+G D I
Sbjct: 64  PRQADLMIVAGTVTRKMAPVVRKVYDQMPEPKWVIAMGSCATSGGIFN-TYSTVQGVDEI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVD Y+PGCPP  EAL+  I+ LQ+KI+ 
Sbjct: 123 VPVDFYIPGCPPRPEALLDAIVALQEKIKH 152


>gi|313903494|ref|ZP_07836885.1| NADH dehydrogenase subunit B [Thermaerobacter subterraneus DSM
           13965]
 gi|313466315|gb|EFR61838.1| NADH dehydrogenase subunit B [Thermaerobacter subterraneus DSM
           13965]
          Length = 193

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G + T++  LV W R  SL ++ FG+ACCA+EMM A   R DL+R G   RASPRQ+D+M
Sbjct: 46  GVITTNLQTLVNWGRKNSLWYLLFGIACCAIEMMAAGASRIDLDRLGSVFRASPRQADMM 105

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+T KMA  ++ +YDQM EPRYVI+MG+CA+ GG Y+  Y+VV G D+IVPVD+YV
Sbjct: 106 IVAGTVTEKMAPVIKTLYDQMAEPRYVIAMGACASNGGPYYQGYNVVDGVDKIVPVDVYV 165

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
            GCPP  EALIY I+ LQ K+ R
Sbjct: 166 AGCPPRPEALIYAIMKLQDKVAR 188


>gi|283782292|ref|YP_003373047.1| NADH-quinone oxidoreductase, B subunit [Pirellula staleyi DSM 6068]
 gi|283440745|gb|ADB19187.1| NADH-quinone oxidoreductase, B subunit [Pirellula staleyi DSM 6068]
          Length = 227

 Score =  180 bits (457), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 112/146 (76%), Gaps = 2/146 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQS 93
            +    TSV+Q + WAR  S+  MTFGLACCA+EMM A   RYD++RFG  A RA+PRQ+
Sbjct: 31  EENVFTTSVEQAINWARQSSIWPMTFGLACCAIEMMAAGASRYDMDRFGAGAFRATPRQA 90

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCDRIVPV 152
           D+MIVAGT+T KMAS +RR+Y+ MP+P++VI+MG+C  GGG Y+ + Y VV+G D +VPV
Sbjct: 91  DLMIVAGTVTYKMASRVRRLYNMMPDPKFVIAMGACTVGGGPYFKWGYHVVKGVDLVVPV 150

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIR 178
           D+Y+PGCPP  EAL+ G++ +Q KI+
Sbjct: 151 DVYIPGCPPRPEALLEGLMRIQDKIK 176


>gi|319955917|ref|YP_004167180.1| NADH dehydrogenase subunit b [Nitratifractor salsuginis DSM 16511]
 gi|319418321|gb|ADV45431.1| NADH dehydrogenase subunit B [Nitratifractor salsuginis DSM 16511]
          Length = 170

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 109/140 (77%), Gaps = 1/140 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           +T+VD+L+ W R+ SL  +T+GLACCA+EMM +   R+D +R G   RASPRQ+DVMI+A
Sbjct: 18  LTTVDKLLNWGRSNSLWPLTYGLACCAIEMMASGASRFDFDRMGVIFRASPRQADVMILA 77

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GTL+ K A   RR+YDQM EP++VISMGSCAN GG ++ +Y+ V+G DRI+PVDIY+PGC
Sbjct: 78  GTLSKKHAEFARRLYDQMAEPKWVISMGSCANTGGMFN-TYATVQGVDRIIPVDIYLPGC 136

Query: 160 PPTAEALIYGILLLQKKIRR 179
            P  E L Y +++LQKKIRR
Sbjct: 137 APRPETLQYAMMMLQKKIRR 156


>gi|284106847|ref|ZP_06386290.1| NADH-quinone oxidoreductase, B subunit [Candidatus Poribacteria sp.
           WGA-A3]
 gi|283830026|gb|EFC34302.1| NADH-quinone oxidoreductase, B subunit [Candidatus Poribacteria sp.
           WGA-A3]
          Length = 159

 Score =  180 bits (456), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
             + T++D LV+W R  +L  MTFGLACCA+EM+ +   RYD++RFG    RASPRQSDV
Sbjct: 11  NIITTNLDYLVSWCRKSALWPMTFGLACCAIEMIASVSSRYDIDRFGAGVFRASPRQSDV 70

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGT+  KMA  +RR+YDQM EPRYVISMGSCA  G +Y+ SYSVV+G D+IVPVD+Y
Sbjct: 71  MIVAGTVCRKMAPVIRRIYDQMAEPRYVISMGSCATSGNHYN-SYSVVQGVDQIVPVDVY 129

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           V GCPP  EAL+  ++ LQ+KI++
Sbjct: 130 VAGCPPRPEALLDALIKLQEKIQK 153


>gi|256380664|ref|YP_003104324.1| NADH dehydrogenase subunit B [Actinosynnema mirum DSM 43827]
 gi|255924967|gb|ACU40478.1| NADH-quinone oxidoreductase, B subunit [Actinosynnema mirum DSM
           43827]
          Length = 182

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/148 (58%), Positives = 108/148 (72%), Gaps = 2/148 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    G L+ SV++LV W R  SL   TFGLACCA+EMM    PRYDL RFG    RAS
Sbjct: 4   EEKLPNGVLLVSVEKLVNWTRKSSLWPATFGLACCAIEMMTTGAPRYDLARFGMEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG +TNKMA  LR++YDQMPEPR+V++MG CA+ GG ++ +Y+VV+G D I
Sbjct: 64  PRQADLMIVAGRVTNKMAPVLRQIYDQMPEPRWVLAMGVCASSGGMFN-NYAVVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+Y+PGCPP  E LI  IL +  KI
Sbjct: 123 VPVDMYLPGCPPRPEMLIDAILKIHAKI 150


>gi|227822752|ref|YP_002826724.1| NADH dehydrogenase subunit B [Sinorhizobium fredii NGR234]
 gi|227341753|gb|ACP25971.1| NADH dehydrogenase I chain B1 [Sinorhizobium fredii NGR234]
          Length = 167

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 110/141 (78%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ D +++W+R  +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTADSVISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G    VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGAQTFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL++G LLLQ+KI++
Sbjct: 132 CPPRPEALMHGFLLLQEKIKK 152


>gi|108804469|ref|YP_644406.1| NADH-quinone oxidoreductase subunit B [Rubrobacter xylanophilus DSM
           9941]
 gi|123069071|sp|Q1AVI4|NUOB_RUBXD RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|108765712|gb|ABG04594.1| NADH-quinone oxidoreductase, B subunit [Rubrobacter xylanophilus
           DSM 9941]
          Length = 251

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 110/158 (69%), Gaps = 5/158 (3%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG---FA 85
           +  +      + TS D+L  WAR  SL  + FGLACCA+EMM   M   DLERFG   FA
Sbjct: 3   LMQKFDEPNIITTSTDKLFNWARKNSLWPLQFGLACCAIEMMSTGMAHNDLERFGAGFFA 62

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
              SPRQ+DVMIV+GT++ KMA  + R+Y+QMPEP++VI+MG+CA  GG +   YSV+ G
Sbjct: 63  --GSPRQADVMIVSGTVSTKMAERMTRLYEQMPEPKWVIAMGACAISGGPFLDGYSVLMG 120

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
            DR++PVD+YVPGCPP  EALI+GI+ LQKKI R   V
Sbjct: 121 ADRVIPVDVYVPGCPPRPEALIFGIMTLQKKIEREQQV 158


>gi|313672278|ref|YP_004050389.1| NADH dehydrogenase subunit b [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939034|gb|ADR18226.1| NADH dehydrogenase subunit B [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 158

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 108/141 (76%), Gaps = 1/141 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
            + T+VD ++ WAR  SL  +TFGLACCA+EMM     +YDL+R G   RA+PRQ+D+MI
Sbjct: 12  IITTTVDGVINWARRSSLWPVTFGLACCAIEMMAVGASKYDLDRLGVIFRATPRQADLMI 71

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+T KMA  +R+VYDQMPEP++VI+MGSCA  GG ++ +YS V+G D IVPVD Y+P
Sbjct: 72  VAGTVTRKMAPVVRKVYDQMPEPKWVIAMGSCATSGGIFN-TYSTVQGVDEIVPVDFYIP 130

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL+  I+ LQ+KI+
Sbjct: 131 GCPPRPEALLDAIVALQEKIK 151


>gi|163783891|ref|ZP_02178866.1| NADH dehydrogenase I chain B [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880835|gb|EDP74364.1| NADH dehydrogenase I chain B [Hydrogenivirga sp. 128-5-R1-1]
          Length = 172

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           + + G ++T+ +++++W R  SL  ++ GLACCA+EMM  +  R+D +R G   R SPRQ
Sbjct: 4   MNNNGIILTTAEEVLSWGRRNSLWPVSIGLACCAIEMMHTAASRFDTDRLGIIFRGSPRQ 63

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDV+IVAGT+ NK+A  L+ +YDQMP+P++VISMG CA+ GG +  +YS ++G DRI+PV
Sbjct: 64  SDVLIVAGTVVNKVAPMLKLIYDQMPDPKWVISMGGCASAGGPFP-TYSTLQGVDRIIPV 122

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIR 178
           D+YVPGCPPT +AL++GIL LQKKI+
Sbjct: 123 DVYVPGCPPTPQALLWGILELQKKIK 148


>gi|317121157|ref|YP_004101160.1| NADH dehydrogenase subunit B [Thermaerobacter marianensis DSM
           12885]
 gi|315591137|gb|ADU50433.1| NADH dehydrogenase subunit B [Thermaerobacter marianensis DSM
           12885]
          Length = 193

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G + T++  LV W R  SL ++ FG+ACCA+EMM A   R DL+R G   RASPRQ+D+M
Sbjct: 46  GVITTNLQTLVNWGRKNSLWYLLFGIACCAIEMMAAGASRIDLDRLGSVFRASPRQADLM 105

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAGT+T KMA  ++ +YDQM EP+YVI+MG+CA+ GG Y+  Y+VV G D+IVPVD+YV
Sbjct: 106 IVAGTVTEKMAPVIKTLYDQMAEPKYVIAMGACASNGGPYYQGYNVVDGVDKIVPVDVYV 165

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
            GCPP  EALIY I+ LQ K+ R
Sbjct: 166 AGCPPRPEALIYAIMKLQDKVAR 188


>gi|149909804|ref|ZP_01898455.1| NuoB2 NADH I CHAIN B [Moritella sp. PE36]
 gi|149807136|gb|EDM67092.1| NuoB2 NADH  I CHAIN B [Moritella sp. PE36]
          Length = 181

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 111/147 (75%), Gaps = 1/147 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASP 90
           +E      L T+ D ++ W+R  SL   TFG+ACCA+EM+ A   RYDL+RFG   R+SP
Sbjct: 5   TERYKDNVLFTTSDSIINWSRKSSLWPETFGIACCAIEMIAAGCARYDLDRFGVVFRSSP 64

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSDVMI+AGT+T KMA  +RR+YDQMPEPRYVI+MG+CA  GG Y+ +YSVV+G D  V
Sbjct: 65  RQSDVMIIAGTVTKKMAPIIRRLYDQMPEPRYVIAMGTCAISGGVYN-TYSVVQGSDLFV 123

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKI 177
           PVD++V GCPP  +AL++ ++LLQ++I
Sbjct: 124 PVDVHVAGCPPRPDALLHAMVLLQQQI 150


>gi|260592325|ref|ZP_05857783.1| NADH dehydrogenase I, B subunit [Prevotella veroralis F0319]
 gi|260535712|gb|EEX18329.1| NADH dehydrogenase I, B subunit [Prevotella veroralis F0319]
          Length = 295

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 115/161 (71%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +   S+++SE+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLSKMASELNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|320353962|ref|YP_004195301.1| NADH dehydrogenase subunit B [Desulfobulbus propionicus DSM 2032]
 gi|320122464|gb|ADW18010.1| NADH dehydrogenase subunit B [Desulfobulbus propionicus DSM 2032]
          Length = 173

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/141 (59%), Positives = 108/141 (76%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           ++  +++LV W R GS+  +TFGLACCA+EMM A     DL+RFG   RASPRQ+D M+V
Sbjct: 25  ILGPLNKLVNWGRAGSIWPVTFGLACCAIEMMDAGASTNDLDRFGILFRASPRQADCMVV 84

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGTL+ KMA  LRRVYDQMPEPRYV++MGSCA  GG +  +Y+V +G D+I+PVD+YVPG
Sbjct: 85  AGTLSKKMAPVLRRVYDQMPEPRYVLAMGSCACSGGVFD-TYAVTQGVDQIIPVDVYVPG 143

Query: 159 CPPTAEALIYGILLLQKKIRR 179
           CPP  EAL+ G L LQ+KI +
Sbjct: 144 CPPRPEALLEGFLKLQEKILK 164


>gi|288818716|ref|YP_003433064.1| NADH dehydrogenase chain B [Hydrogenobacter thermophilus TK-6]
 gi|288788116|dbj|BAI69863.1| NADH dehydrogenase chain B [Hydrogenobacter thermophilus TK-6]
 gi|308752303|gb|ADO45786.1| NADH-quinone oxidoreductase, B subunit [Hydrogenobacter
           thermophilus TK-6]
          Length = 179

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 113/149 (75%), Gaps = 1/149 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF++T+VD+L+ W R  +L  +T GLACCA+EMM  +  R+DL+R G   RASPRQ
Sbjct: 4   LNSNGFVITTVDELLRWGRRNALWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQ 63

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +DV+IVAGT+ NK+A  L+ +++QMP+P++ I+MG CA+ GG +  +Y+ ++G DRI+PV
Sbjct: 64  ADVLIVAGTVVNKVAPMLKLIWEQMPDPKWCITMGGCASAGGPFP-TYATLQGMDRIIPV 122

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           D+Y+PGCPP  + LIYGIL LQKKI+  G
Sbjct: 123 DVYIPGCPPHPQGLIYGILQLQKKIKEKG 151


>gi|325003723|ref|ZP_08124835.1| NADH dehydrogenase subunit B [Pseudonocardia sp. P1]
          Length = 235

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 109/148 (73%), Gaps = 2/148 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    G L+T+V++LV W R  SL   TFGLACCA+EMM    PRYDL RFG    RAS
Sbjct: 4   EENLPSGVLLTNVEKLVNWTRKSSLWPATFGLACCAIEMMTTGAPRYDLARFGMEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++NKMA  LR++YDQMPEPR+V++MG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSNKMAPVLRQIYDQMPEPRWVLAMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+Y+PGCPP  E LI  IL +  KI
Sbjct: 123 VPVDMYLPGCPPRPEMLIDAILKIHAKI 150


>gi|150375773|ref|YP_001312369.1| NADH dehydrogenase subunit B [Sinorhizobium medicae WSM419]
 gi|150030320|gb|ABR62436.1| NADH-quinone oxidoreductase, B subunit [Sinorhizobium medicae
           WSM419]
          Length = 167

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 110/140 (78%), Gaps = 1/140 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIV 98
           L T+ + +++W+R  +L   TFG+ACCA+EM+ A   RYDL+RFG   R SPRQSDVMI+
Sbjct: 13  LFTTAESIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMII 72

Query: 99  AGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG 158
           AGT+T K A  +RR+YDQMPEPR+VI+MG+CA  GG Y+ +Y+VV+G +  VPVD++VPG
Sbjct: 73  AGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYN-TYAVVQGSETFVPVDVHVPG 131

Query: 159 CPPTAEALIYGILLLQKKIR 178
           CPP  EAL++G LLLQ+KI+
Sbjct: 132 CPPRPEALMHGFLLLQEKIK 151


>gi|325269277|ref|ZP_08135895.1| NADH dehydrogenase I subunit B [Prevotella multiformis DSM 16608]
 gi|324988404|gb|EGC20369.1| NADH dehydrogenase I subunit B [Prevotella multiformis DSM 16608]
          Length = 297

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 115/161 (71%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +   S+++SE+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLSKMASELNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIVYGMMQLQRKVK 177


>gi|289548152|ref|YP_003473140.1| NADH-quinone oxidoreductase subunit beta [Thermocrinis albus DSM
           14484]
 gi|289181769|gb|ADC89013.1| NADH-quinone oxidoreductase, B subunit [Thermocrinis albus DSM
           14484]
          Length = 178

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 77/149 (51%), Positives = 116/149 (77%), Gaps = 1/149 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +   GF++T+V++L++W+R  +L  +T GLACCA+EMM A+  R+DL+R G   RASPRQ
Sbjct: 4   LNSNGFVLTTVEELLSWSRRNALWPVTIGLACCAIEMMHAAASRFDLDRLGVIFRASPRQ 63

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           +D++IVAGT+ NK+A  L+ +++QMP+P++ I+MG CA+ GG +  +YS ++G DRI+PV
Sbjct: 64  ADLLIVAGTVVNKVAPMLKLIWEQMPDPKWCITMGGCASAGGPFP-TYSTLQGMDRIIPV 122

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIRRVG 181
           D+Y+PGCPP  + L+YGIL LQKKI+  G
Sbjct: 123 DVYIPGCPPHPQGLLYGILQLQKKIKEQG 151


>gi|87311558|ref|ZP_01093676.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Blastopirellula
           marina DSM 3645]
 gi|87285680|gb|EAQ77596.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Blastopirellula
           marina DSM 3645]
          Length = 198

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/146 (56%), Positives = 113/146 (77%), Gaps = 2/146 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQS 93
            +  + T+++Q + WA+  S+  MTFGLACCA+EMM A   RYDL+RFG  A RA+PRQ+
Sbjct: 11  EENVVFTTLEQAINWAQQSSIWPMTFGLACCAIEMMAAGASRYDLDRFGAGAFRATPRQA 70

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCDRIVPV 152
           D+MIVAGT+T KMAS +RR+Y+ MP+P+YVI+MG+C  GGG Y+ Y Y VV+G D +VPV
Sbjct: 71  DLMIVAGTVTYKMASRVRRLYNMMPDPKYVIAMGACTVGGGPYFKYGYHVVKGVDLVVPV 130

Query: 153 DIYVPGCPPTAEALIYGILLLQKKIR 178
           D+YVPGCPP  EAL+ G++ +Q KI+
Sbjct: 131 DVYVPGCPPRPEALLEGLMRIQDKIK 156


>gi|16082574|ref|NP_394429.1| NADH dehydrogenase subunit B [Thermoplasma acidophilum DSM 1728]
          Length = 157

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G + T++DQ + WAR+ SL  +TFGLACCA+EMM       D+ RFG    R SPRQSD+
Sbjct: 10  GVVTTTLDQALEWARSNSLWPLTFGLACCAIEMMAIQASDMDISRFGSEIFRNSPRQSDL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+GT+T KMA  +RR+YD+MP P+YVI+ G C   GG Y+  YSVV G DR+VPVD+Y
Sbjct: 70  MIVSGTVTKKMAPRVRRIYDEMPYPKYVIAQGVCVIQGGPYNQGYSVVLGVDRVVPVDVY 129

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           +PGCPPT EAL  GI+LLQKKIR
Sbjct: 130 IPGCPPTPEALTNGIILLQKKIR 152


>gi|331699311|ref|YP_004335550.1| NAD(P)H-quinone oxidoreductase subunit K [Pseudonocardia
           dioxanivorans CB1190]
 gi|326954000|gb|AEA27697.1| NAD(P)H-quinone oxidoreductase subunit K [Pseudonocardia
           dioxanivorans CB1190]
          Length = 183

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 109/148 (73%), Gaps = 2/148 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    G L+T+V++LV W R  SL   TFGLACCA+EMM    PRYDL RFG    RAS
Sbjct: 4   EEKLPSGVLLTNVEKLVNWTRKSSLWPATFGLACCAIEMMTTGAPRYDLARFGMEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++NKMA  LR++YDQMPEPR+V++MG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSNKMAPVLRQIYDQMPEPRWVLAMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+Y+PGCPP  E LI  IL +  KI
Sbjct: 123 VPVDMYLPGCPPRPEMLIDAILKIHAKI 150


>gi|322421849|ref|YP_004201072.1| NADH-quinone oxidoreductase subunit B [Geobacter sp. M18]
 gi|320128236|gb|ADW15796.1| NADH-quinone oxidoreductase, B subunit [Geobacter sp. M18]
          Length = 170

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 1/145 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
            + TS+D LV WAR  S+  MTFGLACCA+EMM     ++DL+RFG   RASPRQSD +I
Sbjct: 11  IITTSLDSLVNWARKSSIWPMTFGLACCAIEMMATGAAKHDLDRFGIIFRASPRQSDCII 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+T KM   ++ VY+QMPEP++V++MG+CA  GG +  +YSVV+G D  +PVD+Y+P
Sbjct: 71  IAGTVTQKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFD-TYSVVQGIDEALPVDVYIP 129

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPP  EAL+YG++ LQ KI +  N
Sbjct: 130 GCPPRPEALLYGLMKLQDKISKEKN 154


>gi|10640284|emb|CAC12098.1| probable NADH dehydrogenase, chain B [Thermoplasma acidophilum]
          Length = 149

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G + T++DQ + WAR+ SL  +TFGLACCA+EMM       D+ RFG    R SPRQSD+
Sbjct: 2   GVVTTTLDQALEWARSNSLWPLTFGLACCAIEMMAIQASDMDISRFGSEIFRNSPRQSDL 61

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+GT+T KMA  +RR+YD+MP P+YVI+ G C   GG Y+  YSVV G DR+VPVD+Y
Sbjct: 62  MIVSGTVTKKMAPRVRRIYDEMPYPKYVIAQGVCVIQGGPYNQGYSVVLGVDRVVPVDVY 121

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           +PGCPPT EAL  GI+LLQKKIR
Sbjct: 122 IPGCPPTPEALTNGIILLQKKIR 144


>gi|39995448|ref|NP_951399.1| NADH dehydrogenase I subunit B [Geobacter sulfurreducens PCA]
 gi|81703477|sp|Q74GA7|NUOB_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|39982211|gb|AAR33672.1| NADH dehydrogenase I, B subunit [Geobacter sulfurreducens PCA]
 gi|298504447|gb|ADI83170.1| NADH dehydrogenase I, B subunit [Geobacter sulfurreducens KN400]
          Length = 170

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 82/145 (56%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+ TS+D LV WAR  S+  MTFGLACCA+EMM       DL+RFG   RASPRQSD +I
Sbjct: 11  FITTSLDSLVNWARKSSIWPMTFGLACCAIEMMATGASHNDLDRFGIIFRASPRQSDCII 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+T KM   ++ VY+QMPEP++V++MG+CA  GG +  +YSVV+G D  +PVD+Y+P
Sbjct: 71  IAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFD-TYSVVQGIDTALPVDVYIP 129

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPP  EAL+YG+L LQ KI +  N
Sbjct: 130 GCPPRPEALLYGLLKLQDKIMKDKN 154


>gi|313901777|ref|ZP_07835202.1| NADH-quinone oxidoreductase, B subunit [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467955|gb|EFR63444.1| NADH-quinone oxidoreductase, B subunit [Thermaerobacter
           subterraneus DSM 13965]
          Length = 236

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 106/144 (73%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G +   + +LV W R  SL ++ FGLACCA+EMM A   R DL+R G   RASPRQ+D+M
Sbjct: 87  GIVTARLQELVNWGRANSLWYLLFGLACCAIEMMAAGATRTDLDRIGSVFRASPRQADLM 146

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IV+GT+T KMA  ++ +YDQM EP++VISMG+CA  GG Y+  Y+VV G D+I+PVD+YV
Sbjct: 147 IVSGTVTEKMAPVVKTLYDQMAEPKFVISMGACATNGGPYYQGYNVVDGVDKIIPVDVYV 206

Query: 157 PGCPPTAEALIYGILLLQKKIRRV 180
            GCPP  EAL++ IL LQ K+R+V
Sbjct: 207 AGCPPRPEALVHAILKLQDKVRKV 230


>gi|289582900|ref|YP_003481366.1| NADH-quinone oxidoreductase subunit beta [Natrialba magadii ATCC
           43099]
 gi|289532453|gb|ADD06804.1| NADH-quinone oxidoreductase, B subunit [Natrialba magadii ATCC
           43099]
          Length = 235

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 112/161 (69%), Gaps = 2/161 (1%)

Query: 20  EKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           E VD  F S++        F++T  D+ + W R  S+  + FG+ACC++EMM     ++D
Sbjct: 27  EGVDDRFNSKLREAFGASPFILTKFDEFMNWVRGNSMFMLQFGIACCSIEMMHTYAIKHD 86

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           L+RFG   PRASPRQ+DVMIV GT+ +K    ++RVYDQMPEP++V+ MGSC   GG + 
Sbjct: 87  LDRFGAGVPRASPRQADVMIVPGTIVSKFGPRMKRVYDQMPEPKFVVGMGSCTISGGPFQ 146

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             Y+VV+G + I+P+DI+VPGCPP  EAL+YG+L LQ++I+
Sbjct: 147 EGYNVVKGAEEIIPIDIHVPGCPPRPEALLYGVLKLQERIK 187


>gi|315608360|ref|ZP_07883349.1| NADH-quinone oxidoreductase subunit B [Prevotella buccae ATCC
           33574]
 gi|315249990|gb|EFU29990.1| NADH-quinone oxidoreductase subunit B [Prevotella buccae ATCC
           33574]
          Length = 287

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +++ E+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNGTLEKMADELNEGGVNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMATGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YV+++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVVAVGGCAVSGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG D I+PVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 137 SSYHVVRGIDEIIPVDVYIPGCPPRPEAIMYGMMQLQRKVK 177


>gi|219848534|ref|YP_002462967.1| NADH dehydrogenase subunit B [Chloroflexus aggregans DSM 9485]
 gi|238065029|sp|B8GA16|NUOB2_CHLAD RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|219542793|gb|ACL24531.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus aggregans DSM
           9485]
          Length = 264

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 83/157 (52%), Positives = 112/157 (71%), Gaps = 1/157 (0%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           AD      E+  +G L+T+V++   W R  S+  M FGLACCA+EMM   + RYD+ RFG
Sbjct: 2   ADIDPNQLELERQGILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMAFGLSRYDVARFG 61

Query: 84  FAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
               RASPRQ+D+MIVAGT+T KMA  + R+Y+QM EPRYVISMG+CA  GG +   Y+V
Sbjct: 62  AELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFRDGYNV 121

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           +RG D ++PVD+YVPGCPP  EAL++ ++ LQ++I R
Sbjct: 122 LRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDR 158


>gi|288926087|ref|ZP_06420015.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Prevotella buccae D17]
 gi|288337127|gb|EFC75485.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Prevotella buccae D17]
          Length = 287

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +++ E+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNGTLEKMADELNEGGVNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMATGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YV+++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVVAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG D I+PVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 137 SSYHVVRGIDEIIPVDVYIPGCPPRPEAIMYGMMQLQRKVK 177


>gi|39998533|ref|NP_954484.1| trifunctional NADH dehydrogenase I subunit B/C/D [Geobacter
           sulfurreducens PCA]
 gi|81700831|sp|Q746S4|NUBCD_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit B/C/D; AltName:
           Full=NADH dehydrogenase I subunit B/C/D; AltName:
           Full=NDH-1 subunit B/C/D
 gi|39985480|gb|AAR36834.1| NADH dehydrogenase I, B/C/D subunits [Geobacter sulfurreducens PCA]
 gi|298507477|gb|ADI86200.1| NADH dehydrogenase I, B/C/D subunits [Geobacter sulfurreducens
           KN400]
          Length = 792

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 78/150 (52%), Positives = 110/150 (73%), Gaps = 2/150 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRAS 89
           +E+     ++ S+D L+ W R  SL  M FGL+CC VEMM +   RYD+ RFG    R +
Sbjct: 4   TEVPQNNIILASLDDLINWGRANSLWPMFFGLSCCFVEMMTSFTSRYDVSRFGAEVLRGT 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PR++D+M++AGT+  KMA ++ R+Y+QM EP++VISMGSCAN GG Y   YSVV+G ++I
Sbjct: 64  PREADLMVIAGTVFKKMAPSILRLYEQMAEPKWVISMGSCANSGGMYDV-YSVVQGVNQI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           +PVD++VPGCPP  EA + G++LLQ+KIRR
Sbjct: 123 IPVDVHVPGCPPRPEAFLQGLMLLQEKIRR 152


>gi|220904929|ref|YP_002480241.1| NADH-quinone oxidoreductase subunit B [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|238065121|sp|B8J1D6|NUOB_DESDA RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|219869228|gb|ACL49563.1| NADH-quinone oxidoreductase, B subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 183

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVM 96
           G ++  ++ LV W R GS+  +TFGLACCA+EMM      +DL+RFG   RASPRQ+D M
Sbjct: 33  GAVIGPLNALVNWGRAGSIWPVTFGLACCAIEMMATGAAHHDLDRFGIIFRASPRQADCM 92

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           +VAGTL+ KMA  LRRVYDQMPEPRYV++MGSCA  GG +  SY+V +G D++VPVD+YV
Sbjct: 93  VVAGTLSKKMAPVLRRVYDQMPEPRYVLAMGSCACSGGLFQ-SYAVTQGVDQVVPVDVYV 151

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPP  EAL  G + LQ+ I +
Sbjct: 152 PGCPPRPEALFDGFIRLQEIINK 174


>gi|320161226|ref|YP_004174450.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit family protein
           [Anaerolinea thermophila UNI-1]
 gi|319995079|dbj|BAJ63850.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit family protein
           [Anaerolinea thermophila UNI-1]
          Length = 217

 Score =  177 bits (448), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 117/161 (72%), Gaps = 2/161 (1%)

Query: 20  EKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDL 79
           E++ +    I  E+ ++   VT++D++  W+R  SL  M FGLACCA+EM+  +  R+D 
Sbjct: 4   EELHSPGYEIPPEMQNQ-VTVTTLDRIYNWSRKNSLWPMMFGLACCAIEMIATAASRFDF 62

Query: 80  ERFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHY 138
            RFG    R SPRQ+DVMIV+GT+T KM   + R+Y+QMPEP+YV++MG+CA+GGG +  
Sbjct: 63  SRFGMEVMRPSPRQADVMIVSGTVTKKMVPQIVRLYNQMPEPKYVVAMGACASGGGPFKE 122

Query: 139 SYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
            Y+VV G D+ +PVD+Y+PGCPPT +AL+ G+++LQKK+ R
Sbjct: 123 GYNVVSGIDKFIPVDVYIPGCPPTPQALLNGLIMLQKKVER 163


>gi|325857136|ref|ZP_08172426.1| NADH-quinone oxidoreductase, B subunit [Prevotella denticola CRIS
           18C-A]
 gi|327313379|ref|YP_004328816.1| NADH-quinone oxidoreductase subunit B [Prevotella denticola F0289]
 gi|325483199|gb|EGC86177.1| NADH-quinone oxidoreductase, B subunit [Prevotella denticola CRIS
           18C-A]
 gi|326945576|gb|AEA21461.1| NADH-quinone oxidoreductase, B subunit [Prevotella denticola F0289]
          Length = 297

 Score =  177 bits (448), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +++SE+   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLGKMASELNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YV+++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVVAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|258592365|emb|CBE68674.1| NADH-ubiquinone oxidoreductase 20 kDa subunit (NADH dehydrogenase
           subunit 10) [NC10 bacterium 'Dutch sediment']
          Length = 175

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 110/143 (76%), Gaps = 2/143 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVMI 97
           + T+V+ L  WAR  S   MTFGLACCA+EMM A   R+DL+R G    R SPRQSDVMI
Sbjct: 14  ITTTVEWLFNWARKSSPWPMTFGLACCAIEMMAAGASRFDLDRLGAGVFRPSPRQSDVMI 73

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCA-NGGGYYHYSYSVVRGCDRIVPVDIYV 156
           VAGT+T KMA  ++ +Y+QMP+P++VI+MG+CA +GG +Y+ +Y VV+G D +VPVD+YV
Sbjct: 74  VAGTVTEKMAPRIKTLYEQMPDPKWVIAMGACAISGGPFYYDAYHVVKGVDLLVPVDVYV 133

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPPT EALI+GIL LQ +I R
Sbjct: 134 PGCPPTPEALIFGILTLQDQIMR 156


>gi|282881432|ref|ZP_06290106.1| NADH-quinone oxidoreductase, B subunit [Prevotella timonensis CRIS
           5C-B1]
 gi|281304658|gb|EFA96744.1| NADH-quinone oxidoreductase, B subunit [Prevotella timonensis CRIS
           5C-B1]
          Length = 231

 Score =  176 bits (447), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 82/161 (50%), Positives = 109/161 (67%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    RI  E+   G  V   S+DQL+ W R  SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNESLERIVDELHEGGVNVVTGSLDQLINWGRANSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA A RR+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FARFGFEVTRNSPRQADLIMCAGTITNKMAPAFRRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG D IVPVD+++PGCPP  EA++YG++ LQ+KI+
Sbjct: 137 SSYHVVRGIDEIVPVDVFIPGCPPRPEAIMYGMMQLQRKIK 177


>gi|163847546|ref|YP_001635590.1| NADH dehydrogenase subunit B [Chloroflexus aurantiacus J-10-fl]
 gi|222525396|ref|YP_002569867.1| NADH dehydrogenase subunit B [Chloroflexus sp. Y-400-fl]
 gi|238065006|sp|A9WED9|NUOB1_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|238065008|sp|B9LGT9|NUOB1_CHLSY RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|163668835|gb|ABY35201.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus aurantiacus
           J-10-fl]
 gi|222449275|gb|ACM53541.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus sp. Y-400-fl]
          Length = 264

 Score =  176 bits (447), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 1/157 (0%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           A+      E+  +G L+T+V++   W R  S+  M FGLACCA+EMM   + RYD+ RFG
Sbjct: 2   AEIDPTQLELERQGILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMAFGLSRYDVARFG 61

Query: 84  FAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
               RASPRQ+D+MIVAGT+T KMA  + R+Y+QM EPRYVISMG+CA  GG +   Y+V
Sbjct: 62  AELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFRDGYNV 121

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           +RG D ++PVD+YVPGCPP  EAL++ ++ LQ++I R
Sbjct: 122 LRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDR 158


>gi|282877800|ref|ZP_06286613.1| NADH-quinone oxidoreductase, B subunit [Prevotella buccalis ATCC
           35310]
 gi|281300116|gb|EFA92472.1| NADH-quinone oxidoreductase, B subunit [Prevotella buccalis ATCC
           35310]
          Length = 231

 Score =  176 bits (447), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 82/161 (50%), Positives = 109/161 (67%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    RI  E+   G  V   S+DQL+ W R  SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNESLERIVDELHEGGVNVVTGSLDQLINWGRANSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA A RR+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FARFGFEVTRNSPRQADLIMCAGTITNKMAPAFRRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG D IVPVD+++PGCPP  EA++YG++ LQ+KI+
Sbjct: 137 SSYHVVRGIDEIVPVDVFIPGCPPRPEAIMYGMMQLQRKIK 177


>gi|307566084|ref|ZP_07628542.1| NADH-quinone oxidoreductase, B subunit [Prevotella amnii CRIS
           21A-A]
 gi|307345272|gb|EFN90651.1| NADH-quinone oxidoreductase, B subunit [Prevotella amnii CRIS
           21A-A]
          Length = 289

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 117/166 (70%), Gaps = 6/166 (3%)

Query: 14  QSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQAS 73
           + + +L+K+ AD +   + +     ++ ++DQL+ W R+ SL  +TF  +CC +E M   
Sbjct: 17  KDNDTLDKMAADLNDGGTNL-----VLGNLDQLINWGRSNSLWSLTFATSCCGIEFMSVG 71

Query: 74  MPRYDLERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANG 132
             RYD  RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YVI++G CA  
Sbjct: 72  CARYDFSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVIAVGGCAIS 131

Query: 133 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           GG +  SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 132 GGPFKNSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|303237657|ref|ZP_07324217.1| putative NADH dehydrogenase subunit B [Prevotella disiens
           FB035-09AN]
 gi|302482109|gb|EFL45144.1| putative NADH dehydrogenase subunit B [Prevotella disiens
           FB035-09AN]
          Length = 288

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    ++++++   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLEQMANDLNDGGTNLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YDQM EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDQMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+Y+PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 DSYHVMRGIDEIIPVDVYIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|197120286|ref|YP_002140713.1| NADH dehydrogenase I subunit B [Geobacter bemidjiensis Bem]
 gi|238065151|sp|B5EFG2|NUOB_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|197089646|gb|ACH40917.1| NADH dehydrogenase I, B subunit [Geobacter bemidjiensis Bem]
          Length = 170

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 1/147 (0%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           +  + TS+D LV WAR  S+  MTFGLACCA+EMM     ++DL+RFG   RASPRQ+D 
Sbjct: 9   ENIITTSLDSLVNWARKSSIWPMTFGLACCAIEMMATGAAKHDLDRFGIIFRASPRQADC 68

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           +I+AGT+T KM   ++ VY+QMPEP++V++MG+CA  GG +  +YSVV+G D  +PVD+Y
Sbjct: 69  IIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFD-TYSVVQGIDEALPVDVY 127

Query: 156 VPGCPPTAEALIYGILLLQKKIRRVGN 182
           +PGCPP  EAL+YG+L LQ KI    N
Sbjct: 128 IPGCPPRPEALLYGLLKLQDKIANERN 154


>gi|322369187|ref|ZP_08043752.1| NADH-quinone oxidoreductase, B subunit [Haladaptatus
           paucihalophilus DX253]
 gi|320550919|gb|EFW92568.1| NADH-quinone oxidoreductase, B subunit [Haladaptatus
           paucihalophilus DX253]
          Length = 211

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 114/160 (71%), Gaps = 2/160 (1%)

Query: 20  EKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           E VD  F S++        F++T  D+ + W R  S+  + FG+ACC++EMM     ++D
Sbjct: 3   EGVDDRFNSKLREAFGASPFILTKFDKFMNWVRGSSMFMLQFGIACCSIEMMHTYAVKHD 62

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           L+RFG   PRASPRQ+DVMIV GT+ +K A  ++RVYDQMPEP++V++MGSCA  GG + 
Sbjct: 63  LDRFGSGVPRASPRQADVMIVPGTVVSKFAPRMKRVYDQMPEPKFVVNMGSCAISGGPFQ 122

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
             Y+V++G + ++P+DI+VPGCPP  EAL+YG++ LQ+++
Sbjct: 123 EGYNVIKGAEEVIPIDIHVPGCPPRPEALVYGVVKLQERV 162


>gi|91203915|emb|CAJ71568.1| strongly similar to proton-translocating NADH dehydrogenase I chain
           B [Candidatus Kuenenia stuttgartiensis]
          Length = 155

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 114/149 (76%), Gaps = 4/149 (2%)

Query: 34  THKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           +H G   L T++  +V WAR  SL  M FGLACCA+EMM    PR+DL RFG    R SP
Sbjct: 5   SHLGDNILTTTLTTMVNWARKSSLWPMPFGLACCAIEMMAVVAPRHDLARFGAEVFRFSP 64

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSD+MIVAGTLT KMAS  +++Y+QMPEP++V++MG+CA  GG ++ +YSVV+G ++++
Sbjct: 65  RQSDLMIVAGTLTYKMASVAKKIYEQMPEPKWVVAMGACAVSGGVFN-TYSVVQGLEQVI 123

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           PVD+Y+PGCPP  EALI+ I+ +QKKI++
Sbjct: 124 PVDVYLPGCPPRPEALIHAIMEIQKKIQK 152


>gi|95928442|ref|ZP_01311190.1| NADH-quinone oxidoreductase, B subunit [Desulfuromonas acetoxidans
           DSM 684]
 gi|95135713|gb|EAT17364.1| NADH-quinone oxidoreductase, B subunit [Desulfuromonas acetoxidans
           DSM 684]
          Length = 179

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 1/151 (0%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPR 91
            +     +  S+D++V W+R+ SL  MTFGLACCA+EMM     R+DL+R G   RASPR
Sbjct: 16  HVLGNNIMTASLDKVVNWSRSRSLWPMTFGLACCAIEMMATGAARFDLDRMGVLFRASPR 75

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           Q+DV+I+AGT+T+KM   +  VY+QMPEP+YVI+MG+CA+ GG +  +YSV++G D+ +P
Sbjct: 76  QADVIIIAGTVTHKMLPVIETVYEQMPEPKYVIAMGACASSGGVFD-TYSVLQGIDQALP 134

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRRVGN 182
           VD+Y+PGCPP  E L+YG++ LQ+KI R  N
Sbjct: 135 VDVYIPGCPPRPEGLLYGLMKLQEKIMRERN 165


>gi|148657099|ref|YP_001277304.1| NADH dehydrogenase subunit B [Roseiflexus sp. RS-1]
 gi|238065018|sp|A5UXK1|NUOB1_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|148569209|gb|ABQ91354.1| NADH-quinone oxidoreductase, B subunit [Roseiflexus sp. RS-1]
          Length = 268

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 115/164 (70%), Gaps = 3/164 (1%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           +D   I  E    G  +T++ +   W R  S+  ++FGLACCA+EMM   + R+DL RFG
Sbjct: 2   SDDREIQLEAEKHGVFLTTMQRFYNWGRRSSIWPLSFGLACCAIEMMATGLARFDLARFG 61

Query: 84  FAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
               RASPRQ+D+MIVAGT+T KMA  + R+Y+QMPEPRYVISMG+CA  GG +   Y+V
Sbjct: 62  AEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFRDGYNV 121

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI--RRVGNVK 184
           +RG D ++PVD+Y+PGCPP  EAL++ ++ LQK+I  +R+  V+
Sbjct: 122 LRGIDLLIPVDVYIPGCPPRPEALLHALMTLQKQIDAQRLNQVR 165


>gi|13541946|ref|NP_111634.1| NADH dehydrogenase subunit B [Thermoplasma volcanium GSS1]
          Length = 157

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G + T+V+Q   WAR+ SL  +TFGLACCA+EMM       D+ RFG    R SPRQSD+
Sbjct: 10  GIVTTTVEQAYEWARSNSLWPLTFGLACCAIEMMAIQASDMDISRFGSEIFRNSPRQSDL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+GT+T KMA  +RR+YD+MP P+YVI+ G C   GG Y+  YSVV G D++VPVD+Y
Sbjct: 70  MIVSGTVTKKMAPRVRRIYDEMPYPKYVIAQGVCVIQGGPYNQGYSVVLGVDKVVPVDVY 129

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           VPGCPPT EAL  GI+LLQKKIR
Sbjct: 130 VPGCPPTPEALTNGIILLQKKIR 152


>gi|284164402|ref|YP_003402681.1| NADH-quinone oxidoreductase, B subunit [Haloterrigena turkmenica
           DSM 5511]
 gi|284014057|gb|ADB60008.1| NADH-quinone oxidoreductase, B subunit [Haloterrigena turkmenica
           DSM 5511]
          Length = 235

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 107/153 (69%), Gaps = 1/153 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA- 85
           S++        F++T  D+ + W R  S+  + FG+ACC++EMM     ++DL+RFG   
Sbjct: 35  SKLREAFGSTPFILTKFDKFMNWVRGNSMFMLQFGIACCSIEMMHTYAIKHDLDRFGAGV 94

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQ+DVMIV GT+ +K    ++RVYDQMPEP++V+ MGSC   GG +   Y+VV+G
Sbjct: 95  PRASPRQADVMIVPGTIVSKFGPRMKRVYDQMPEPKFVVGMGSCTISGGPFQEGYNVVKG 154

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            + I+PVDI+VPGCPP  EAL+YGI  LQ++IR
Sbjct: 155 AEEIIPVDIHVPGCPPRPEALVYGIAKLQERIR 187


>gi|223936528|ref|ZP_03628439.1| NADH-quinone oxidoreductase, B subunit [bacterium Ellin514]
 gi|223894692|gb|EEF61142.1| NADH-quinone oxidoreductase, B subunit [bacterium Ellin514]
          Length = 203

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 109/150 (72%), Gaps = 1/150 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-R 87
           + +E++ +G   TS++ L  W R  S+  M FGLACCA+EM+  +M RYDL RFG    R
Sbjct: 5   LRNELSKQGIFTTSMEALYNWGRKNSVWPMQFGLACCAIEMIATTMARYDLARFGAEVFR 64

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
            SPRQ+D+MIVAGT+T KMA  + R+Y+QMPEP+YVI+MG+CA  GG +   Y+V++G D
Sbjct: 65  PSPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPKYVIAMGACAISGGPFKQGYNVLKGID 124

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           R +PVD+++PGCPP  EALI   + LQ+KI
Sbjct: 125 RFIPVDVHIPGCPPRPEALIEAFMALQRKI 154


>gi|150017836|ref|YP_001310090.1| NADH-quinone oxidoreductase, B subunit [Clostridium beijerinckii
           NCIMB 8052]
 gi|238055288|sp|A6LXQ4|NUOB_CLOB8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|149904301|gb|ABR35134.1| NADH-quinone oxidoreductase, B subunit [Clostridium beijerinckii
           NCIMB 8052]
          Length = 169

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/148 (54%), Positives = 109/148 (73%), Gaps = 1/148 (0%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E   K  ++T +D  + + R  S   +TFGLACCA+EMM A   RYD+ RFG+   RAS
Sbjct: 12  QEQIEKNIILTKLDDTLNYFRAHSFWPLTFGLACCAIEMMAAGGARYDIARFGYEVFRAS 71

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAGT+T KMA  ++++YDQMPEP++VI+MGSCA  GG +  SY+VV G D  
Sbjct: 72  PRQADLMIVAGTITEKMAPIVKKIYDQMPEPKWVIAMGSCATSGGPFVDSYNVVPGADTF 131

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           +PVD+Y+PGCPP  EALI+G+L L++KI
Sbjct: 132 LPVDVYIPGCPPRPEALIHGLLTLKEKI 159


>gi|282860263|ref|ZP_06269333.1| NADH-quinone oxidoreductase, B subunit [Prevotella bivia
           JCVIHMP010]
 gi|282586937|gb|EFB92172.1| NADH-quinone oxidoreductase, B subunit [Prevotella bivia
           JCVIHMP010]
          Length = 301

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +++S++   G   ++ ++DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNDTLDKMASDLNDGGTSLVLGNLDQLINWGRSNSLWSLTFATSCCGIEFMSVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA AL+R+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPALKRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+RG D I+PVD+++PGCPP  EA+IYG++ LQ+K++
Sbjct: 137 NSYHVMRGIDEIIPVDVFIPGCPPRPEAIIYGMMQLQRKVK 177


>gi|300087933|ref|YP_003758455.1| NADH-quinone oxidoreductase subunit B [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527666|gb|ADJ26134.1| NADH-quinone oxidoreductase, B subunit [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 203

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 115/157 (73%), Gaps = 1/157 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-R 87
           ++ +      L+TSVD++V W+R  S+  +TFGLACCA+EMM  +  R+DL RFG    R
Sbjct: 42  LNEDALPPNVLLTSVDKVVNWSRRYSMWPVTFGLACCAIEMMSMAASRFDLARFGMEIFR 101

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MI+AGTLT KMA  LRR+YDQMP+P++V++MGSC   GG ++ SY+VV G +
Sbjct: 102 ASPRQADLMIIAGTLTWKMAPWLRRIYDQMPDPKWVVAMGSCGISGGLFNDSYAVVPGFN 161

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           R+VPVD+YVPGCPP  EAL+  I+ +  K+ ++   +
Sbjct: 162 RVVPVDVYVPGCPPRPEALMQAIMDIHAKVDKMSPTR 198


>gi|156742064|ref|YP_001432193.1| NADH dehydrogenase subunit B [Roseiflexus castenholzii DSM 13941]
 gi|238065038|sp|A7NL05|NUOB2_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|156233392|gb|ABU58175.1| NADH-quinone oxidoreductase, B subunit [Roseiflexus castenholzii
           DSM 13941]
          Length = 268

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 116/164 (70%), Gaps = 3/164 (1%)

Query: 24  ADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
           +D   I  E   +G  +T++ +   W R  S+  ++FGLACCA+EMM   + R+DL RFG
Sbjct: 2   SDDRDIQLEAEKQGVFLTTMQRFYNWGRRSSVWPLSFGLACCAIEMMATGLARFDLARFG 61

Query: 84  FAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
               RASPRQ+D+MIVAGT+T KMA  + R+Y+QMPEPRYVISMG+CA  GG +   Y+V
Sbjct: 62  AEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFRDGYNV 121

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI--RRVGNVK 184
           +RG D ++PVD+Y+PGCPP  EAL++ ++ LQK+I  +R+  V+
Sbjct: 122 LRGIDLLIPVDVYIPGCPPRPEALLHALMTLQKQIDAQRLNRVR 165


>gi|148699634|gb|EDL31581.1| NADH dehydrogenase (ubiquinone) Fe-S protein 7, isoform CRA_c [Mus
           musculus]
          Length = 167

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 92/104 (88%), Gaps = 3/104 (2%)

Query: 81  RFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSY 140
           +    PR+   ++DVMIVAGTLTNKMA ALR+VYDQMPEPRYV+SMGSCANGGGYYHYSY
Sbjct: 62  KLSHLPRS---RADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSY 118

Query: 141 SVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           SVVRGCDRIVPVDIYVPGCPPTAEAL+YGIL LQ+KI+R   +K
Sbjct: 119 SVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLK 162


>gi|253702594|ref|YP_003023783.1| NADH-quinone oxidoreductase, B subunit [Geobacter sp. M21]
 gi|259514665|sp|C6E8N4|NUOB_GEOSM RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|251777444|gb|ACT20025.1| NADH-quinone oxidoreductase, B subunit [Geobacter sp. M21]
          Length = 170

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/147 (53%), Positives = 108/147 (73%), Gaps = 1/147 (0%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           +  + TS+D LV WAR  S+  MTFGLACCA+EMM     ++DL+RFG   RASPRQ+D 
Sbjct: 9   ENIITTSLDSLVNWARKSSIWPMTFGLACCAIEMMATGAAKHDLDRFGIIFRASPRQADC 68

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           +I+AGT+T KM   ++ VY+QMPEP++V++MG+CA  GG +  +YSVV+G D  +PVD+Y
Sbjct: 69  IIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFD-TYSVVQGIDEALPVDVY 127

Query: 156 VPGCPPTAEALIYGILLLQKKIRRVGN 182
           +PGCPP  EAL+YG++ LQ KI    N
Sbjct: 128 IPGCPPRPEALLYGLMKLQDKIANERN 154


>gi|222479140|ref|YP_002565377.1| NADH-quinone oxidoreductase, B subunit [Halorubrum lacusprofundi
           ATCC 49239]
 gi|222452042|gb|ACM56307.1| NADH-quinone oxidoreductase, B subunit [Halorubrum lacusprofundi
           ATCC 49239]
          Length = 232

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 117/180 (65%), Gaps = 9/180 (5%)

Query: 7   NQKIISGQSSCSLEKVDADF--------SRISSEITHKGFLVTSVDQLVTWARTGSLMWM 58
           +Q  I+ +S    E  D+          SR+        F++T  D+ + W R  S+  +
Sbjct: 4   DQPFITDESQVVTETRDSRMTGQGDRFNSRLREAFGSSPFILTKFDKFLNWCRGSSMFML 63

Query: 59  TFGLACCAVEMMQASMPRYDLERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
            FG+ACC++EMM     ++DL+RFG   PRASPRQ+DVMIV GT+ +K A  ++RVYDQM
Sbjct: 64  QFGIACCSIEMMHTYAVKHDLDRFGSGVPRASPRQADVMIVPGTIVSKFAPRMKRVYDQM 123

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEP++V+ MGSC   GG +   Y+V++G + ++P+DI+VPGCPP  EAL+YG++ LQ+++
Sbjct: 124 PEPKFVVGMGSCTISGGPFQEGYNVIKGAEEVIPIDIHVPGCPPRPEALVYGVVKLQERV 183


>gi|94970385|ref|YP_592433.1| NADH-quinone oxidoreductase, B subunit [Candidatus Koribacter
           versatilis Ellin345]
 gi|238065024|sp|Q1IL91|NUOB2_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|94552435|gb|ABF42359.1| NADH dehydrogenase subunit B [Candidatus Koribacter versatilis
           Ellin345]
          Length = 202

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/144 (57%), Positives = 111/144 (77%), Gaps = 2/144 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQS 93
            K FL++SVD +  WAR  S+  MTFGLACCA+EM+ AS  RYD+ RFG    R SPRQS
Sbjct: 9   EKNFLLSSVDYVFNWARKSSVWPMTFGLACCAIEMITASTARYDIARFGSEVFRPSPRQS 68

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD 153
           D+MIVAGT+T KMA  ++R+Y+QMPEP++V++MG+CA+ GG ++ +Y+ ++G D+IVPVD
Sbjct: 69  DLMIVAGTVTLKMAPVVQRIYEQMPEPKWVMAMGACASVGGPFN-TYATLQGVDKIVPVD 127

Query: 154 IYVPGCPPTAEALIYGILLLQKKI 177
           +YV GCPP  E L YG+L LQ KI
Sbjct: 128 VYVVGCPPRPENLFYGLLKLQDKI 151


>gi|258651217|ref|YP_003200373.1| NADH dehydrogenase subunit B [Nakamurella multipartita DSM 44233]
 gi|258554442|gb|ACV77384.1| NADH-quinone oxidoreductase, B subunit [Nakamurella multipartita
           DSM 44233]
          Length = 199

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 107/148 (72%), Gaps = 2/148 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    G L+TSV++LV W R  SL   TFGLACCA+EMM    PRYDL RFG    RAS
Sbjct: 4   EEKLPNGVLLTSVEKLVNWTRKASLFPATFGLACCAIEMMTTGAPRYDLGRFGMEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR++YDQM EP++V+SMG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLSMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+Y+PGCPP  E LI  IL L  KI
Sbjct: 123 VPVDMYLPGCPPRPEMLIDAILKLHAKI 150


>gi|110667597|ref|YP_657408.1| NADH dehydrogenase, subunit B (ubiquinone) [Haloquadratum walsbyi
           DSM 16790]
 gi|109625344|emb|CAJ51766.1| NADH dehydrogenase, subunit B (ubiquinone) [Haloquadratum walsbyi
           DSM 16790]
          Length = 234

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 115/178 (64%), Gaps = 2/178 (1%)

Query: 2   GLTTVNQKIISGQSSCSLEKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTF 60
              T + ++ +      +   D  F S++        F++T  DQ + W R  S+  + F
Sbjct: 8   AFVTDDTQVQTDTRDARISGTDERFNSKLREAFGSSPFILTKFDQFMNWVRGSSMFMLQF 67

Query: 61  GLACCAVEMMQASMPRYDLERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPE 119
           G+ACC++EMM     ++DL+RFG   PRASPRQ+DV+IV GT+ +K A  ++RVYDQMPE
Sbjct: 68  GIACCSIEMMHTYAVKHDLDRFGAGVPRASPRQADVIIVPGTIVSKFAPRMKRVYDQMPE 127

Query: 120 PRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           P++V+ MGSC   GG +   Y+V++G + ++PVDI++PGCPP  EAL+YGI  LQ++I
Sbjct: 128 PKFVVGMGSCTVSGGPFQEGYNVIKGAEEVIPVDIHIPGCPPRPEALVYGIAKLQERI 185


>gi|15789834|ref|NP_279658.1| NADH dehydrogenase/oxidoreductase [Halobacterium sp. NRC-1]
 gi|169235555|ref|YP_001688755.1| NADH dehydrogenase-like complex subunit B [Halobacterium salinarum
           R1]
 gi|10580226|gb|AAG19138.1| NADH dehydrogenase/oxidoreductase [Halobacterium sp. NRC-1]
 gi|167726621|emb|CAP13406.1| NADH dehydrogenase-like complex subunit B [Halobacterium salinarum
           R1]
          Length = 235

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 119/177 (67%), Gaps = 2/177 (1%)

Query: 3   LTTVNQKIISGQSSCSLEKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFG 61
           +T  +  + S + +   + VD  F SR+        F++T  D+ + W R  S+  + FG
Sbjct: 10  ITDTSDPLTSTRDARMGDGVDDRFNSRLREAFGSTPFILTKFDKFMNWVRGSSMFMLQFG 69

Query: 62  LACCAVEMMQASMPRYDLERF-GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEP 120
           +ACC++EMM     ++DL+RF    PRASPRQ+DVMIV GT+ +K A  ++RVYDQMPEP
Sbjct: 70  IACCSIEMMHTYSVKHDLDRFHAGVPRASPRQADVMIVPGTIVSKFAPRMKRVYDQMPEP 129

Query: 121 RYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           ++V++MG+C+  GG +   Y+VV+G + ++PVDI++PGCPP  EAL+YG+  LQ++I
Sbjct: 130 KFVVNMGNCSTSGGPFQEGYNVVKGAEEVIPVDIHIPGCPPRPEALVYGVAKLQERI 186


>gi|326772151|ref|ZP_08231436.1| NADH dehydrogenase I, B subunit [Actinomyces viscosus C505]
 gi|326638284|gb|EGE39185.1| NADH dehydrogenase I, B subunit [Actinomyces viscosus C505]
          Length = 204

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 120/160 (75%), Gaps = 2/160 (1%)

Query: 21  KVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           K +  ++  ++E+ + GFL+T+V++L   A+  S+  +T GLACCA+EMM A  PR+D+ 
Sbjct: 14  KRNDPYAAAAAEVDNPGFLLTTVEKLAGLAQARSMWPVTMGLACCAIEMMAAGTPRFDMA 73

Query: 81  RFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           RFG+   RASPR +DVMIV+G +++KMA  +R VYD MPEP++VISMG+CA+ GG ++ +
Sbjct: 74  RFGWEVFRASPRHADVMIVSGRVSHKMAPIVRNVYDSMPEPKWVISMGACASSGGIFN-N 132

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           Y+VV+GCD IVPVDIY+PGCPP  E L+  +L L ++I +
Sbjct: 133 YAVVQGCDHIVPVDIYLPGCPPRPEMLLNAMLELTRQIEK 172


>gi|159901492|ref|YP_001547739.1| NADH dehydrogenase subunit B [Herpetosiphon aurantiacus ATCC 23779]
 gi|238065032|sp|A9B478|NUOB2_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|159894531|gb|ABX07611.1| NADH-quinone oxidoreductase, B subunit [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 250

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 1/147 (0%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           ++  +G L T++++L  W R  S+  M FGLACCA+EM+ A+  RYD+ RFG    RASP
Sbjct: 9   DLEQQGVLFTTINKLYNWGRRSSVWPMQFGLACCAIEMIAAAASRYDISRFGSELFRASP 68

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+DVMIVAGT+T KM   + R+++QMPEPRYVISMG+CA  GG +   Y+VVRG D  V
Sbjct: 69  RQADVMIVAGTVTKKMVPQVVRLFNQMPEPRYVISMGACATSGGPFRDGYNVVRGVDLYV 128

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKI 177
           PVD+Y+PGCPP  EAL++ ++ LQ +I
Sbjct: 129 PVDVYIPGCPPRPEALLHALMTLQAQI 155


>gi|257387965|ref|YP_003177738.1| NADH-quinone oxidoreductase subunit beta [Halomicrobium mukohataei
           DSM 12286]
 gi|257170272|gb|ACV48031.1| NADH-quinone oxidoreductase, B subunit [Halomicrobium mukohataei
           DSM 12286]
          Length = 229

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 74/152 (48%), Positives = 108/152 (71%), Gaps = 1/152 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA- 85
           S++        F++T  D+ + W R  S+  + FG+ACC++EMM     ++DL+RFG   
Sbjct: 29  SKLREAFGSTPFILTKFDKFMNWVRGSSMFMLQFGIACCSIEMMHTYAVKHDLDRFGAGV 88

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQ+DV+IV GT+ +K A  ++RVYDQMPEP++V+SMGSC   GG +   Y+V++G
Sbjct: 89  PRASPRQADVIIVPGTIVSKFAPRMKRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKG 148

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
            + ++PVDI+VPGCPP  EALIYG+  LQ++I
Sbjct: 149 AEEVIPVDIHVPGCPPRPEALIYGVAKLQERI 180


>gi|148266253|ref|YP_001232959.1| NADH-quinone oxidoreductase, B subunit [Geobacter uraniireducens
           Rf4]
 gi|238065155|sp|A5G9B8|NUOB_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146399753|gb|ABQ28386.1| NADH dehydrogenase subunit B [Geobacter uraniireducens Rf4]
          Length = 170

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
            +  S+D LV WAR  S+  MTFGLACCA+EMM     ++DL+RFG   RASPRQSD +I
Sbjct: 11  IVTASLDGLVNWARKSSIWPMTFGLACCAIEMMATGAAKHDLDRFGIIFRASPRQSDCII 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+T KM   ++ VY+QMPEP++VI+MG+CA  GG +  +YSVV+G D  +PVD+Y+P
Sbjct: 71  IAGTVTKKMLPVIKTVYEQMPEPKWVIAMGACACSGGVFD-TYSVVQGVDEALPVDVYIP 129

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPP  EAL+YG++ LQ KI +  N
Sbjct: 130 GCPPRPEALLYGLMKLQDKIGKERN 154


>gi|76801790|ref|YP_326798.1| NADH dehydrogenase-like complex, subunit B [Natronomonas pharaonis
           DSM 2160]
 gi|76557655|emb|CAI49238.1| NADH dehydrogenase-like complex, subunit B [Natronomonas pharaonis
           DSM 2160]
          Length = 227

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 12  SGQSSCSLEKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMM 70
           S Q +   + VD  F S++        F++T  D+ + W R  S+  + FG+ACC++EM+
Sbjct: 11  STQQARMGDGVDDRFNSKLREAFGSTPFILTKFDKFMNWVRGNSMFMLQFGIACCSIEMI 70

Query: 71  QASMPRYDLERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSC 129
                ++DL+RFG   PRASPRQ+DV+IV GT+ +K A  ++RVYDQMPEP++V+ MGSC
Sbjct: 71  HTYAIKHDLDRFGAGVPRASPRQADVIIVPGTIVSKFAPRMKRVYDQMPEPKFVVGMGSC 130

Query: 130 ANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
              GG +   Y+V++G + ++PVDI+VPGCPP  EALIYGI  LQ++IR
Sbjct: 131 TISGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGIAKLQERIR 179


>gi|222053571|ref|YP_002535933.1| NADH-quinone oxidoreductase, B subunit [Geobacter sp. FRC-32]
 gi|238065153|sp|B9LZL8|NUOB_GEOSF RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|221562860|gb|ACM18832.1| NADH-quinone oxidoreductase, B subunit [Geobacter sp. FRC-32]
          Length = 170

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/145 (55%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
            +  S+D LV WAR  S+  MTFGLACCA+EMM     ++DL+RFG   RASPRQ+D +I
Sbjct: 11  IVTASLDGLVNWARKTSIWPMTFGLACCAIEMMATGAAKHDLDRFGIIFRASPRQADCII 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+T KM   ++ VY+QMPEP++VI+MG+CA  GG +  +YSVV+G D  +PVD+YVP
Sbjct: 71  IAGTVTKKMLPVIKTVYEQMPEPKWVIAMGACACSGGVFD-TYSVVQGIDEALPVDVYVP 129

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPP  EAL+YGI+ LQ KI +  N
Sbjct: 130 GCPPRPEALLYGIMKLQDKIGKERN 154


>gi|257051791|ref|YP_003129624.1| NADH-quinone oxidoreductase, B subunit [Halorhabdus utahensis DSM
           12940]
 gi|256690554|gb|ACV10891.1| NADH-quinone oxidoreductase, B subunit [Halorhabdus utahensis DSM
           12940]
          Length = 231

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 110/160 (68%), Gaps = 2/160 (1%)

Query: 20  EKVDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           E VD  F SR+   +    F++T  DQ + WAR  S+  + FG+ACC++EMM     ++D
Sbjct: 23  EGVDDRFNSRLREALGSTPFILTKFDQFMNWARGSSMFMLQFGIACCSIEMMHTYSVKHD 82

Query: 79  LERF-GFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           L+RF    PRASPRQ+DVMIV GT+ +K A  ++RVYDQ+PEP++ I MGSC   GG + 
Sbjct: 83  LDRFHAGVPRASPRQADVMIVPGTIVSKFAPRMKRVYDQVPEPKFTIGMGSCTISGGPFQ 142

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
             Y+VV+G + ++P+DI +PGCPP  EALIYG+  LQ++I
Sbjct: 143 EGYNVVKGAEEVIPIDIQIPGCPPRPEALIYGVAKLQERI 182


>gi|323345257|ref|ZP_08085480.1| NADH-quinone oxidoreductase subunit B [Prevotella oralis ATCC
           33269]
 gi|323093371|gb|EFZ35949.1| NADH-quinone oxidoreductase subunit B [Prevotella oralis ATCC
           33269]
          Length = 242

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K ++   +I  E+   G  V   S+DQ++ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNSSLEQIVDELHEGGVNVVTGSLDQMINWGRSNSLWSLTFATSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA A +R+YD+M EP+YVI++G CA  GG + 
Sbjct: 77  FARFGFEVTRNSPRQADLIMCAGTITNKMAPAFKRLYDEMAEPKYVIAVGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG D IVPVD+++PGCPP  EA++YG++ LQ+K++
Sbjct: 137 SSYHVVRGIDEIVPVDVFIPGCPPRPEAIMYGMMQLQRKVK 177


>gi|117927477|ref|YP_872028.1| NADH dehydrogenase subunit B [Acidothermus cellulolyticus 11B]
 gi|238065066|sp|A0LRI2|NUOB_ACIC1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|117647940|gb|ABK52042.1| NADH dehydrogenase subunit B [Acidothermus cellulolyticus 11B]
          Length = 184

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 109/143 (76%), Gaps = 2/143 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           GFL+T+V++ V W R  SL   TFGLACCA+EMM     RYDL RFG    RASPRQ+D+
Sbjct: 10  GFLLTTVEKAVGWVRKSSLWPATFGLACCAIEMMATGAGRYDLARFGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQMPEP++V++MG CA+ GG ++ +Y++V+G D +VPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVCASSGGMFN-NYAIVQGVDHVVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           +PGCPP  E L++ IL L +KI+
Sbjct: 129 LPGCPPRPEMLMHAILELHEKIK 151


>gi|325067538|ref|ZP_08126211.1| NADH-quinone oxidoreductase, B subunit [Actinomyces oris K20]
          Length = 207

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 119/160 (74%), Gaps = 2/160 (1%)

Query: 21  KVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           K +  ++  ++E+   GFL+T+V++L   A+  S+  +T GLACCA+EMM A  PR+D+ 
Sbjct: 17  KRNDPYAAAAAEVDSPGFLLTTVEKLAGLAQARSMWPVTMGLACCAIEMMAAGTPRFDMA 76

Query: 81  RFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           RFG+   RASPR +DVMIV+G +++KMA  +R VYD MPEP++VISMG+CA+ GG ++ +
Sbjct: 77  RFGWEVFRASPRHADVMIVSGRVSHKMAPIVRNVYDSMPEPKWVISMGACASSGGIFN-N 135

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           Y+VV+GCD IVPVDIY+PGCPP  E L+  +L L ++I +
Sbjct: 136 YAVVQGCDHIVPVDIYLPGCPPRPEMLLNAMLELTRQIEK 175


>gi|281424343|ref|ZP_06255256.1| NADH dehydrogenase I, B subunit [Prevotella oris F0302]
 gi|281401612|gb|EFB32443.1| NADH dehydrogenase I, B subunit [Prevotella oris F0302]
          Length = 240

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGF--LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +I+ E+   G   +V S+DQ + W R+ SL  +TFG +CC +E M     RYD
Sbjct: 17  KDNDSLEKITQELNEGGVNVIVGSLDQAINWGRSNSLWSLTFGTSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA   +R+YD++ EP+YV+++G C   GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPVFKRLYDEIAEPKYVVAVGGCTISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY+VVRG D +VPVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 137 KSYNVVRGIDELVPVDVYIPGCPPRPEAILYGMMQLQRKVK 177


>gi|322370548|ref|ZP_08045106.1| NADH-quinone oxidoreductase, B subunit [Haladaptatus
           paucihalophilus DX253]
 gi|320549965|gb|EFW91621.1| NADH-quinone oxidoreductase, B subunit [Haladaptatus
           paucihalophilus DX253]
          Length = 220

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 108/152 (71%), Gaps = 1/152 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA- 85
           S++   +    F++T  D  + W R  S+  + FG+ACC++EMM     ++DL+RFG   
Sbjct: 20  SKLREALGTSPFILTKFDAFMNWVRGSSMFMLQFGIACCSIEMMHTYAVKHDLDRFGAGV 79

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQ+DV+IV GT+ +K A  ++RVYDQMPEP++V+SMGSC   GG +   Y+V++G
Sbjct: 80  PRASPRQADVIIVPGTIVSKFAPRMKRVYDQMPEPKFVVSMGSCTCSGGPFQQGYNVIKG 139

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
            + ++PVDI+VPGCPP  EALIYGI  LQ++I
Sbjct: 140 AEEVIPVDIHVPGCPPRPEALIYGIAKLQERI 171


>gi|269926648|ref|YP_003323271.1| NADH-quinone oxidoreductase, B subunit [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790308|gb|ACZ42449.1| NADH-quinone oxidoreductase, B subunit [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 175

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 110/148 (74%), Gaps = 3/148 (2%)

Query: 34  THKGFLVTSVDQLV-TWARTGSLMWMTFGLACCAVEMMQASMPRYD-LERFGFAPRASPR 91
             +G L+ +  + +  WAR  SL  MTFGLACCA+EMM AS   YD +ER G   R SPR
Sbjct: 9   NKRGNLLEATQRAIFGWARKSSLWPMTFGLACCAIEMMSASAANYDVMERSGMLFRPSPR 68

Query: 92  QSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVP 151
           QSD+MIVAG++T KMA  LRR+YDQMP+P++VISMGSCA+ GG Y  +YS ++G D++VP
Sbjct: 69  QSDLMIVAGSVTLKMAPVLRRLYDQMPDPKWVISMGSCASAGGPYP-TYSHLQGVDKVVP 127

Query: 152 VDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VD+YVPGCPP  EAL YGIL LQ  I+R
Sbjct: 128 VDVYVPGCPPVPEALFYGILQLQGMIQR 155


>gi|299140925|ref|ZP_07034063.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Prevotella oris C735]
 gi|298577891|gb|EFI49759.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Prevotella oris C735]
          Length = 247

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGF--LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +I+ E+   G   +V S+DQ + W R+ SL  +TFG +CC +E M     RYD
Sbjct: 24  KDNDSLEKITQELNEGGVNVIVGSLDQAINWGRSNSLWSLTFGTSCCGIEFMAVGCARYD 83

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA   +R+YD++ EP+YV+++G C   GG + 
Sbjct: 84  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPVFKRLYDEIAEPKYVVAVGGCTISGGPFK 143

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY+VVRG D +VPVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 144 KSYNVVRGIDELVPVDVYIPGCPPRPEAILYGMMQLQRKVK 184


>gi|228930306|ref|ZP_04093311.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
 gi|228982015|ref|ZP_04142308.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis Bt407]
 gi|229020517|ref|ZP_04177264.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1273]
 gi|229026735|ref|ZP_04183071.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1272]
 gi|229033931|ref|ZP_04188885.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1271]
 gi|229158859|ref|ZP_04286917.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus ATCC 4342]
 gi|229164245|ref|ZP_04292178.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus R309803]
 gi|229187525|ref|ZP_04314665.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BGSC 6E1]
 gi|229193551|ref|ZP_04320495.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus ATCC 10876]
 gi|228589856|gb|EEK47731.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus ATCC 10876]
 gi|228595892|gb|EEK53572.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BGSC 6E1]
 gi|228619185|gb|EEK76078.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus R309803]
 gi|228624843|gb|EEK81612.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus ATCC 4342]
 gi|228728357|gb|EEL79379.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1271]
 gi|228734566|gb|EEL85224.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1272]
 gi|228740788|gb|EEL91039.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH1273]
 gi|228777679|gb|EEM25953.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis Bt407]
 gi|228829349|gb|EEM74981.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
          Length = 133

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 97/121 (80%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCA+EMM      YDL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQM
Sbjct: 1   MTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KI
Sbjct: 61  PEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKI 120

Query: 178 R 178
           R
Sbjct: 121 R 121


>gi|225874130|ref|YP_002755589.1| NADH dehydrogenase I, B subunit [Acidobacterium capsulatum ATCC
           51196]
 gi|225792992|gb|ACO33082.1| NADH dehydrogenase I, B subunit [Acidobacterium capsulatum ATCC
           51196]
          Length = 216

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 109/147 (74%), Gaps = 1/147 (0%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           E++  G   T++++L  W R  S+  +TFGLACCA+EM+  +M RYDL RFG    R SP
Sbjct: 17  ELSKNGVFTTTLEELYNWGRRSSVWPLTFGLACCAIEMIATTMARYDLARFGAEVFRPSP 76

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+D++IV+GT+T KMA  + R+Y+QMPEP+YVI+MG+CA  GG +   Y+V++G DR +
Sbjct: 77  RQADLIIVSGTVTKKMAPQVVRLYNQMPEPKYVIAMGACAISGGPFRDGYNVLKGIDRYI 136

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKI 177
           PVD+++PGCPP  EALI+  + LQKKI
Sbjct: 137 PVDVHIPGCPPRPEALIHAFMTLQKKI 163


>gi|189426186|ref|YP_001953363.1| NADH-quinone oxidoreductase, B subunit [Geobacter lovleyi SZ]
 gi|238065152|sp|B3E9W8|NUOB_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|189422445|gb|ACD96843.1| NADH-quinone oxidoreductase, B subunit [Geobacter lovleyi SZ]
          Length = 169

 Score =  174 bits (440), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 106/143 (74%), Gaps = 1/143 (0%)

Query: 40  VTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVA 99
           VTS+D+LV W R  S+  MTFGLACCA+EMM       DL+RFG   RASPRQ+D +I+A
Sbjct: 13  VTSLDKLVNWVRKSSIWPMTFGLACCAIEMMATGASHNDLDRFGIIFRASPRQADCIIIA 72

Query: 100 GTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGC 159
           GT+T KM   ++ VY+QMPEP++VI+MG+CA  GG +  +YSVV+G D  +PVD+Y+PGC
Sbjct: 73  GTVTKKMLPVIQTVYEQMPEPKWVIAMGACACSGGIFD-TYSVVQGIDEALPVDVYIPGC 131

Query: 160 PPTAEALIYGILLLQKKIRRVGN 182
           PP  EAL+YG++ LQ KI +  N
Sbjct: 132 PPRPEALLYGLMKLQDKIMQESN 154


>gi|329944203|ref|ZP_08292462.1| NADH-quinone oxidoreductase subunit 6 [Actinomyces sp. oral taxon
           170 str. F0386]
 gi|328530933|gb|EGF57789.1| NADH-quinone oxidoreductase subunit 6 [Actinomyces sp. oral taxon
           170 str. F0386]
          Length = 204

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 119/160 (74%), Gaps = 2/160 (1%)

Query: 21  KVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           K +  ++  ++E+   GFL+T+V++L   A+  S+  +T GLACCA+EMM A  PR+D+ 
Sbjct: 14  KRNDPYAAAAAEVDSPGFLLTTVERLAGLAQARSMWPVTMGLACCAIEMMAAGTPRFDMA 73

Query: 81  RFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           RFG+   RASPR +DVMIV+G +++KMA  +R VYD MPEP++VISMG+CA+ GG ++ +
Sbjct: 74  RFGWEVFRASPRHADVMIVSGRVSHKMAPIVRNVYDSMPEPKWVISMGACASSGGIFN-N 132

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           Y+VV+GCD IVPVDIY+PGCPP  E L+  +L L ++I +
Sbjct: 133 YAVVQGCDHIVPVDIYLPGCPPRPEMLLNAMLELTRQIEK 172


>gi|288801144|ref|ZP_06406600.1| NADH dehydrogenase I, B/C/D subunit protein [Prevotella sp. oral
           taxon 299 str. F0039]
 gi|288332078|gb|EFC70560.1| NADH dehydrogenase I, B/C/D subunit protein [Prevotella sp. oral
           taxon 299 str. F0039]
          Length = 210

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +I+ E+   G  V   S+DQL+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 17  KDNETLEQIAQELHEGGVNVVTGSLDQLINWGRSNSLWSLTFATSCCGIEFMSVGCARYD 76

Query: 79  LERFGF-APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA   +R+YD+M EP+Y+I++G CA  GG + 
Sbjct: 77  FARFGFEVTRNSPRQADLIMCAGTITNKMAPVFKRLYDEMAEPKYIIAIGGCAISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VVRG + IVPVD+YVPGCPP  EA++YG++ LQ+KI+
Sbjct: 137 ASYHVVRGINEIVPVDVYVPGCPPRPEAILYGMMQLQRKIK 177


>gi|167630265|ref|YP_001680764.1| proton-translocating NADH-ubiquinone oxidoreductase, chain b
           [Heliobacterium modesticaldum Ice1]
 gi|238065157|sp|B0TH78|NUOB_HELMI RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|167593005|gb|ABZ84753.1| proton-translocating NADH-ubiquinone oxidoreductase, chain b
           [Heliobacterium modesticaldum Ice1]
          Length = 175

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 118/168 (70%), Gaps = 5/168 (2%)

Query: 21  KVDADFSRISS----EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPR 76
           ++D +   +S     E+  K  ++TS++ +  WAR  SL  ++ GLACCA+EMM     R
Sbjct: 2   EIDKNVDTLSEGQVDELIKKNIIMTSLEAVFNWARGNSLWPLSSGLACCAIEMMATGASR 61

Query: 77  YDLERFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGY 135
           +D+ RFG+   R SPRQ+D++I+AGTLT KMA A++RVY+QMPEP+++I+MGSCA  GG 
Sbjct: 62  FDMARFGYEVFRPSPRQADLIIIAGTLTWKMAPAIQRVYEQMPEPKWIIAMGSCACTGGP 121

Query: 136 YHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNV 183
           +  SY+VV G D+++PVD+YVPGCPP  EAL+ G L L+ KI+    V
Sbjct: 122 FADSYAVVPGVDKVIPVDVYVPGCPPRPEALLDGFLKLKAKIQNPAKV 169


>gi|301167766|emb|CBW27350.1| NADH dehydrogenase I chain B [Bacteriovorax marinus SJ]
          Length = 168

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 105/141 (74%), Gaps = 2/141 (1%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           ++  +D    W R  SL  MTFGLACCA+EMM     +YDLERFG  A  A+PR++D+MI
Sbjct: 14  VLMKLDDFFNWGRKNSLWPMTFGLACCAIEMMATGASKYDLERFGCGAFMATPRRADLMI 73

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGG-YYHYSYSVVRGCDRIVPVDIYV 156
           VAGT+T KMA  ++ +Y+QM EP+YVISMGSCAN GG Y+ + Y V++G D IVPVD+YV
Sbjct: 74  VAGTVTLKMAPRIKTLYEQMAEPKYVISMGSCANKGGPYWQHGYHVLKGVDEIVPVDVYV 133

Query: 157 PGCPPTAEALIYGILLLQKKI 177
           PGCPP  EALI G++ LQKKI
Sbjct: 134 PGCPPRPEALIEGLMTLQKKI 154


>gi|57234306|ref|YP_181649.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Dehalococcoides ethenogenes 195]
 gi|123618656|sp|Q3Z800|NUOB_DEHE1 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|57224754|gb|AAW39811.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Dehalococcoides ethenogenes 195]
          Length = 200

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 84/157 (53%), Positives = 114/157 (72%), Gaps = 1/157 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-R 87
           ++SE    G  VTSV++++ W+R  SL  + FGLACCA+EMM  +  R+DL RFG    R
Sbjct: 43  LNSEEPPPGVFVTSVEKVLNWSRHYSLWPVMFGLACCAIEMMCMAASRWDLARFGMDIFR 102

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIVAGTLT KMA  L+R+YDQMPEP++V++MG+C   GG +  SYSVV G +
Sbjct: 103 ASPRQADLMIVAGTLTWKMAPWLKRIYDQMPEPKWVLAMGACGTSGGLFRDSYSVVPGFN 162

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
            +VPVD+YVPGCPP  EAL+  I+ + +KI +   +K
Sbjct: 163 MVVPVDVYVPGCPPRPEALLRAIMDIHEKIDKTRIIK 199


>gi|78224544|ref|YP_386291.1| NADH dehydrogenase (ubiquinone), 20 kDa subunit [Geobacter
           metallireducens GS-15]
 gi|123570771|sp|Q39QA8|NUOB_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|78195799|gb|ABB33566.1| NADH dehydrogenase subunit B [Geobacter metallireducens GS-15]
          Length = 170

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 1/145 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           F+  S+D LV WAR  S+  MTFGLACCA+EMM       DL+RFG   RASPRQ+D +I
Sbjct: 11  FITASLDGLVNWARKSSIWPMTFGLACCAIEMMATGASHNDLDRFGIIFRASPRQADCII 70

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           +AGT+T KM   ++ VY+QMPEP++V++MG+CA  GG +  +YSVV+G D  +PVD+Y+P
Sbjct: 71  IAGTVTKKMLPVIQTVYEQMPEPKWVVAMGACACSGGVFD-TYSVVQGIDEALPVDVYIP 129

Query: 158 GCPPTAEALIYGILLLQKKIRRVGN 182
           GCPP  EAL+YG++ LQ KI +  N
Sbjct: 130 GCPPRPEALLYGLIKLQDKIMKDKN 154


>gi|282891849|ref|ZP_06300329.1| hypothetical protein pah_c198o042 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498282|gb|EFB40621.1| hypothetical protein pah_c198o042 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 157

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 2/142 (1%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVM 96
           F+V  + +L+ WAR+ SL    FGLACCA+EMM A+  RYD+ RFG    RASPRQSDVM
Sbjct: 11  FIVAPLQKLIDWARSNSLWPAQFGLACCAIEMMSAAASRYDMARFGMEVFRASPRQSDVM 70

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAG ++ KMA  LR +Y+QM EP++VI+MG CA+ GG Y+ +Y+V+ G D+IVPVD+YV
Sbjct: 71  IVAGRVSQKMAPVLRTIYEQMLEPKWVIAMGDCASTGGVYN-NYAVIPGVDQIVPVDVYV 129

Query: 157 PGCPPTAEALIYGILLLQKKIR 178
            GCPP  EALI G++LLQ KIR
Sbjct: 130 AGCPPRPEALIDGLILLQNKIR 151


>gi|229007607|ref|ZP_04165201.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus mycoides Rock1-4]
 gi|229087789|ref|ZP_04219909.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-44]
 gi|228695517|gb|EEL48382.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus Rock3-44]
 gi|228753618|gb|EEM03062.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus mycoides Rock1-4]
          Length = 133

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 97/121 (80%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCA+EMM      YDL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQM
Sbjct: 1   MTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KI
Sbjct: 61  PEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKI 120

Query: 178 R 178
           R
Sbjct: 121 R 121


>gi|229064950|ref|ZP_04200248.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH603]
 gi|229136115|ref|ZP_04264868.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BDRD-ST196]
 gi|229170007|ref|ZP_04297699.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH621]
 gi|228613432|gb|EEK70565.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH621]
 gi|228647274|gb|EEL03356.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus BDRD-ST196]
 gi|228716251|gb|EEL67963.1| Diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensors
           [Bacillus cereus AH603]
          Length = 133

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 97/121 (80%)

Query: 58  MTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           MTFGLACCA+EMM      YDL+RFG   R SPRQSDVMIV+GT+T KMA  +RR+YDQM
Sbjct: 1   MTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQM 60

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           PEP++VI+MGSCA  GG Y  SY+VV+G D+IVPVD+Y+PGCPP   ALIYGI  L++KI
Sbjct: 61  PEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKI 120

Query: 178 R 178
           R
Sbjct: 121 R 121


>gi|269794074|ref|YP_003313529.1| NADH dehydrogenase subunit B [Sanguibacter keddieii DSM 10542]
 gi|269096259|gb|ACZ20695.1| NADH dehydrogenase subunit B [Sanguibacter keddieii DSM 10542]
          Length = 183

 Score =  173 bits (439), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 111/148 (75%), Gaps = 2/148 (1%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           E    GFL+T+V+ L  + R GSL  +TFGLACCA+EMM A   R+DL RFG    RASP
Sbjct: 4   EEAPSGFLLTTVEDLAGYFRKGSLWPVTFGLACCAIEMMAAGASRFDLSRFGMEVFRASP 63

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+D+MIVAG ++ KMA  +R+VYDQMPEP++V+SMG CA+ GG ++ +Y++V+G D IV
Sbjct: 64  RQADLMIVAGRVSQKMAPVVRQVYDQMPEPKWVLSMGVCASSGGMFN-NYAIVQGVDHIV 122

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIR 178
           PVDIY+PGCPP  E LI  IL L ++I+
Sbjct: 123 PVDIYLPGCPPRPEMLINSILALHQQIQ 150


>gi|320532540|ref|ZP_08033350.1| NADH dehydrogenase subunit B [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320135245|gb|EFW27383.1| NADH dehydrogenase subunit B [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 204

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 115/151 (76%), Gaps = 2/151 (1%)

Query: 30  SSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RA 88
           ++E+   GFL+T+V++L   A+  S+  +T GLACCA+EMM A  PR+D+ RFG+   RA
Sbjct: 23  AAEVDSPGFLLTTVEKLAGLAQARSMWPVTMGLACCAIEMMAAGTPRFDMARFGWEVFRA 82

Query: 89  SPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDR 148
           SPR +DVMIV+G +++KMA  +R VYD MPEP++VISMG+CA+ GG ++ +Y+VV+GCD 
Sbjct: 83  SPRHADVMIVSGRVSHKMAPIVRNVYDSMPEPKWVISMGACASSGGIFN-NYAVVQGCDH 141

Query: 149 IVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           IVPVDIY+PGCPP  E L+  +L L ++I +
Sbjct: 142 IVPVDIYLPGCPPRPEMLLNAMLELTRQIEK 172


>gi|300711699|ref|YP_003737513.1| NADH dehydrogenase-like complex subunit B [Halalkalicoccus jeotgali
           B3]
 gi|299125382|gb|ADJ15721.1| NADH dehydrogenase-like complex subunit B [Halalkalicoccus jeotgali
           B3]
          Length = 233

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 112/158 (70%), Gaps = 2/158 (1%)

Query: 22  VDADF-SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           VD  F SR+        F++T  D+ + WAR  S+  + FG+ACC++EMM     ++DL+
Sbjct: 27  VDNRFNSRLREAFGSSPFILTKFDKFLNWARGSSMFMLQFGIACCSLEMMHTYAVKHDLD 86

Query: 81  RFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           RFG   PRASPRQ+D +I+ GT+ +K A  ++RVYDQM EP++V++MGSCA  GG +   
Sbjct: 87  RFGSGVPRASPRQADTIIIPGTIVSKFAPRMKRVYDQMAEPKFVVNMGSCAISGGPFQEG 146

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
           Y+V++G + ++PVDI+VPGCPP  EAL+YG++ LQ++I
Sbjct: 147 YNVIKGAEEVIPVDIHVPGCPPRPEALVYGVVKLQERI 184


>gi|317503351|ref|ZP_07961398.1| NADH-quinone oxidoreductase subunit B [Prevotella salivae DSM
           15606]
 gi|315665530|gb|EFV05150.1| NADH-quinone oxidoreductase subunit B [Prevotella salivae DSM
           15606]
          Length = 240

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKGF--LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +    +I+ E+   G   +V S+DQ + W R+ SL  +TFG +CC +E M     RYD
Sbjct: 17  KDNDTLEKITKELNEGGVNVIVGSLDQAINWGRSNSLWSLTFGTSCCGIEFMAVGCARYD 76

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   R SPRQ+D+++ AGT+TNKMA   +R+YD++ EP+YV+++G C   GG + 
Sbjct: 77  FSRFGFEVTRNSPRQADLIMCAGTITNKMAPVFKRLYDEIAEPKYVVAVGGCTISGGPFK 136

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY+VVRG D +VPVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 137 KSYNVVRGIDELVPVDVYIPGCPPRPEAILYGMMQLQRKVK 177


>gi|29831381|ref|NP_826015.1| NADH dehydrogenase subunit B [Streptomyces avermitilis MA-4680]
 gi|81718124|sp|Q82DY0|NUOB1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|29608496|dbj|BAC72550.1| putative NADH dehydrogenase I chain B (complex I) [Streptomyces
           avermitilis MA-4680]
          Length = 184

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E LI  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLIDAILKLHQKIQ 151


>gi|159899599|ref|YP_001545846.1| NADH dehydrogenase subunit B [Herpetosiphon aurantiacus ATCC 23779]
 gi|238065011|sp|A9B4Z5|NUOB1_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|159892638|gb|ABX05718.1| NADH-quinone oxidoreductase, B subunit [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 179

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G + T+++ +V W RT ++  M FGLACCA+EMM      YD+ RFG    RASPRQ+D+
Sbjct: 11  GIVTTTLEGVVNWGRTKAMWPMLFGLACCAIEMMAGQASNYDMSRFGLELMRASPRQADL 70

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LRR+YDQMPEP++V++MG CA+ GG Y+ +Y++V+G D IVPVD+Y
Sbjct: 71  MIVAGRVSRKMAPVLRRLYDQMPEPKWVVAMGDCASCGGVYN-NYAIVQGVDEIVPVDVY 129

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           V GCPP  EALI GIL L +KI+R
Sbjct: 130 VAGCPPRPEALIDGILQLHEKIKR 153


>gi|320095549|ref|ZP_08027213.1| NADH-quinone oxidoreductase subunit B [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977527|gb|EFW09206.1| NADH-quinone oxidoreductase subunit B [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 184

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G  +TSV++++  AR  S   +T GLACCA+EMM A  PR+D+ RFG    RASPR SD+
Sbjct: 10  GIALTSVEKVLGLARKHSQWPVTMGLACCAIEMMAAGTPRFDMARFGLEVFRASPRHSDL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+G +++KMA  +RRVYD MPEP++VISMG+CA+ GG ++ +Y+VV+GCD IVPVD+Y
Sbjct: 70  MIVSGRVSHKMAPIIRRVYDSMPEPKWVISMGACASSGGVFN-NYAVVQGCDHIVPVDVY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  EALI+ +L+L+++I
Sbjct: 129 LPGCPPRPEALIHAVLVLREQI 150


>gi|55378230|ref|YP_136080.1| NADH dehydrogenase I B subunit [Haloarcula marismortui ATCC 43049]
 gi|55230955|gb|AAV46374.1| NADH dehydrogenase I B subunit [Haloarcula marismortui ATCC 43049]
          Length = 230

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 105/141 (74%), Gaps = 1/141 (0%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA-PRASPRQSDVM 96
           F++T  D+ + W R  S+  + FG+ACC++EM+     ++DL+RFG   PRASPRQ+DV+
Sbjct: 41  FILTKFDKFMNWVRGSSMFMLQFGIACCSIEMIHTYAIKHDLDRFGSGVPRASPRQADVI 100

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IV GT+ +K A  ++RVYDQMPEP++V+SMGSC   GG +   Y+V++G + ++PVDI+V
Sbjct: 101 IVPGTIVSKFAPRMKRVYDQMPEPKFVVSMGSCTISGGPFQEGYNVIKGAEEVIPVDIHV 160

Query: 157 PGCPPTAEALIYGILLLQKKI 177
           PGCPP  EALIYG+  LQ++I
Sbjct: 161 PGCPPRPEALIYGVAKLQERI 181


>gi|270308195|ref|YP_003330253.1| NADH-quinone oxidoreductase, B subunit [Dehalococcoides sp. VS]
 gi|270154087|gb|ACZ61925.1| NADH-quinone oxidoreductase, B subunit [Dehalococcoides sp. VS]
          Length = 200

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/157 (52%), Positives = 114/157 (72%), Gaps = 1/157 (0%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-R 87
           +S + +  G  +TSV++++ W+R  SL  + FGLACCA+EMM  +  R+DL RFG    R
Sbjct: 43  LSGDESPPGVFITSVEKVLNWSRHYSLWPVMFGLACCAIEMMCMAASRWDLARFGMDIFR 102

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIVAGTLT KMA  LRR+YDQMPEP++V++MG+C   GG +  SYSVV G +
Sbjct: 103 ASPRQADLMIVAGTLTWKMAPWLRRIYDQMPEPKWVLAMGACGTSGGLFRDSYSVVPGFN 162

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
            +VPVD+YVPGCPP  EAL+  I+ + +KI +   +K
Sbjct: 163 LVVPVDVYVPGCPPRPEALMRAIMDIHEKIDKTRIIK 199


>gi|332669450|ref|YP_004452458.1| NADH-quinone oxidoreductase subunit B [Cellulomonas fimi ATCC 484]
 gi|332338488|gb|AEE45071.1| NADH-quinone oxidoreductase, B subunit [Cellulomonas fimi ATCC 484]
          Length = 183

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 110/148 (74%), Gaps = 2/148 (1%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           E    GFL+T+V+ LV + R GSL  +TFGLACCA+EMM A  PRYDL RFG    RASP
Sbjct: 4   EEAPSGFLLTTVEDLVGYFRKGSLWPVTFGLACCAIEMMAAGAPRYDLSRFGMEVFRASP 63

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQ+D+MIVAG ++ KMA  +R+VYDQM  P++V+SMG CA+ GG ++ +Y++V+G D +V
Sbjct: 64  RQADLMIVAGRVSQKMAPVVRQVYDQMSAPKWVLSMGVCASSGGMFN-NYAIVQGVDHVV 122

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIR 178
           PVDIY+PGCPP  E LI  IL L  +I+
Sbjct: 123 PVDIYLPGCPPRPEMLINAILTLHDQIQ 150


>gi|319950452|ref|ZP_08024366.1| NADH dehydrogenase subunit B [Dietzia cinnamea P4]
 gi|319435875|gb|EFV91081.1| NADH dehydrogenase subunit B [Dietzia cinnamea P4]
          Length = 184

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (73%), Gaps = 2/151 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+QL  + R GSL   TFGLACCA+EMM  S  RYDL RFG    RAS
Sbjct: 4   EEKLPAGFLLTTVEQLAGYMRKGSLWPATFGLACCAIEMMATSGGRYDLARFGTEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQM EP++V+SMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMAEPKWVLSMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRRV 180
           VPVDIY+PGCPP  E L++ I+ L  KI+ +
Sbjct: 123 VPVDIYLPGCPPRPEMLMHAIITLHDKIQNM 153


>gi|227497895|ref|ZP_03928075.1| NADH dehydrogenase (quinone) [Actinomyces urogenitalis DSM 15434]
 gi|226832687|gb|EEH65070.1| NADH dehydrogenase (quinone) [Actinomyces urogenitalis DSM 15434]
          Length = 209

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           GFL+TSV++L   A+  SL  +T GLACCA+EMM  + PR+DL RFG+   RASPR +DV
Sbjct: 35  GFLLTSVEKLSALAQARSLWPVTMGLACCAIEMMATAAPRFDLSRFGWEVFRASPRHADV 94

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           M+V+G +++KMA  +R VYD MPEP++VISMG+CA+ GG ++ +Y++V+GCD IVPVDIY
Sbjct: 95  MLVSGRVSHKMAPIVRNVYDAMPEPKWVISMGACASSGGIFN-NYAIVQGCDHIVPVDIY 153

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           +PGCPP  E LI  +L L ++I R
Sbjct: 154 LPGCPPRPEMLINAMLELTRQIER 177


>gi|256371181|ref|YP_003109005.1| NADH-quinone oxidoreductase, B subunit [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256007765|gb|ACU53332.1| NADH-quinone oxidoreductase, B subunit [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 180

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (72%), Gaps = 2/143 (1%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDVM 96
           FL   ++ LV WAR  S+   TFGLACCA+EMM A    +DL RFG    RASPRQ+D+M
Sbjct: 10  FLTARLEDLVNWARKSSVWPATFGLACCAIEMMAAGAADFDLARFGMEVFRASPRQADLM 69

Query: 97  IVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYV 156
           IVAG ++ KMA  LR+VYDQMPEP++VISMG CA+ GG ++ +Y++V+G D IVPVD+Y 
Sbjct: 70  IVAGRVSQKMAPVLRQVYDQMPEPKWVISMGVCASSGGMFN-NYAIVQGVDEIVPVDVYA 128

Query: 157 PGCPPTAEALIYGILLLQKKIRR 179
           PGCPP  E LI  IL L +KIR 
Sbjct: 129 PGCPPGPETLIRAILTLHEKIRH 151


>gi|313156901|gb|EFR56339.1| NADH-quinone oxidoreductase, B subunit [Alistipes sp. HGB5]
          Length = 218

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 113/161 (70%), Gaps = 6/161 (3%)

Query: 19  LEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           LEK+ A+    ++ +     +V  +D+L+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 23  LEKMVAELRDNNTNV-----IVGCLDELIEWGRSNSLWPLTFATSCCGIEFMAVGAARYD 77

Query: 79  LERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
             RFGF   RASPRQ+D ++VAGT+T+KMA  LRR+YDQM +P+YVI++G CA  GG + 
Sbjct: 78  FARFGFEVARASPRQADFIMVAGTITHKMAPVLRRLYDQMADPKYVIAVGGCAISGGPFK 137

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY V+ G DRI+PVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 138 KSYHVLNGVDRILPVDVYIPGCPPRPEAMLYGLMQLQRKVK 178


>gi|188996814|ref|YP_001931065.1| NADH-quinone oxidoreductase, B subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|238065219|sp|B2V988|NUOB_SULSY RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|188931881|gb|ACD66511.1| NADH-quinone oxidoreductase, B subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 171

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 75/142 (52%), Positives = 109/142 (76%), Gaps = 1/142 (0%)

Query: 33  ITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQ 92
           +T  G ++T+V+++++W R  SL  ++ GLACCA+EMM  +  R+D +R G   R SPRQ
Sbjct: 3   MTSSGIILTTVEEVLSWGRRNSLWPVSVGLACCAIEMMHTAASRFDTDRLGIIFRGSPRQ 62

Query: 93  SDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPV 152
           SDV+IVAGT+ NK+A  LR +Y+QMP+P++VISMG CA+ GG +  +Y  ++G DRI+PV
Sbjct: 63  SDVLIVAGTVVNKVAPMLRLIYEQMPDPKWVISMGGCASAGGPFP-TYPTLQGVDRIIPV 121

Query: 153 DIYVPGCPPTAEALIYGILLLQ 174
           D+Y+PGCPPT +AL++GIL LQ
Sbjct: 122 DVYIPGCPPTPQALLWGILELQ 143


>gi|291285958|ref|YP_003502774.1| NADH-quinone oxidoreductase, B subunit [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290883118|gb|ADD66818.1| NADH-quinone oxidoreductase, B subunit [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 158

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 105/142 (73%), Gaps = 1/142 (0%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDV 95
           +  L TS+D ++ + R GS+  +TFGLACCA+EMM     ++DL+R G   RA+PRQ+D+
Sbjct: 10  ENVLTTSIDNVINYCRKGSIWPVTFGLACCAIEMMATGAAKFDLDRMGIIFRATPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGT+T KMA  +R+VY QMPEP++VI+MGSCA  GG Y  +YS V+G D ++PVD Y
Sbjct: 70  MIVAGTVTRKMAPVVRKVYVQMPEPKWVIAMGSCATSGGIYD-TYSTVQGVDEVIPVDFY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           VPGCPP  EAL+  I+ LQ KI
Sbjct: 129 VPGCPPRPEALLDAIVALQSKI 150


>gi|328884313|emb|CCA57552.1| NADH-ubiquinone oxidoreductase chain B [Streptomyces venezuelae
           ATCC 10712]
          Length = 184

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLLDAILKLHQKIQ 151


>gi|198276152|ref|ZP_03208683.1| hypothetical protein BACPLE_02341 [Bacteroides plebeius DSM 17135]
 gi|198270964|gb|EDY95234.1| hypothetical protein BACPLE_02341 [Bacteroides plebeius DSM 17135]
          Length = 193

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 105/143 (73%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDV 95
           G ++ +VD+L+ W R+ SL  +TFG +CCA+E M     RYD+ RFGF   R SPRQ+D+
Sbjct: 36  GIVLGTVDELINWGRSNSLWSLTFGTSCCAIEFMALGAARYDMARFGFEVTRNSPRQADM 95

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           ++V GT+T+KMA  L+R+YDQM EP+YV+++G C   GG +  SY VV G D+I+PVD+Y
Sbjct: 96  IMVLGTITHKMAPVLKRLYDQMAEPKYVVAVGGCTISGGPFIKSYHVVNGIDKIIPVDVY 155

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           +PGCPP  EA  YG++ LQ+KI+
Sbjct: 156 IPGCPPRPEAFFYGMMQLQRKIK 178


>gi|298246351|ref|ZP_06970157.1| NADH-quinone oxidoreductase, B subunit [Ktedonobacter racemifer DSM
           44963]
 gi|297553832|gb|EFH87697.1| NADH-quinone oxidoreductase, B subunit [Ktedonobacter racemifer DSM
           44963]
          Length = 200

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 110/144 (76%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L T V +++ W+R+ SL    FGLACCA+EMM  S  R+DL RFG    RASPRQ+D+
Sbjct: 32  GVLTTQVSKILDWSRSSSLWPALFGLACCAIEMMSTSASRFDLARFGAEVYRASPRQADL 91

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG  + KMA  LR++YDQMPEP++VISMG+CA+ GG ++ +Y++V+G D+IVPVD++
Sbjct: 92  MIVAGRCSVKMAPVLRQIYDQMPEPKWVISMGACASCGGVFN-NYAIVQGVDKIVPVDVF 150

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           +PGCPPT + L++G   LQ+KIR 
Sbjct: 151 IPGCPPTPDMLLFGFNELQRKIRE 174


>gi|315605129|ref|ZP_07880180.1| NADH-quinone oxidoreductase subunit B [Actinomyces sp. oral taxon
           180 str. F0310]
 gi|315313165|gb|EFU61231.1| NADH-quinone oxidoreductase subunit B [Actinomyces sp. oral taxon
           180 str. F0310]
          Length = 184

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G  +TSV++++  AR  S   +T GLACCA+EMM A  PR+D+ RFG    RASPR SD+
Sbjct: 10  GIALTSVEKVLGLARKYSQWPVTMGLACCAIEMMAAGTPRFDMARFGLEVFRASPRHSDM 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+G +++KMA  +RRVYD MPEP++VISMG+CA+ GG ++ +Y+VV+GCD IVPVD+Y
Sbjct: 70  MIVSGRVSHKMAPIIRRVYDSMPEPKWVISMGACASSGGVFN-NYAVVQGCDHIVPVDVY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  EALI+ +L+L+++I
Sbjct: 129 LPGCPPRPEALIHAVLVLREQI 150


>gi|297201624|ref|ZP_06919021.1| NADH dehydrogenase subunit B [Streptomyces sviceus ATCC 29083]
 gi|197711005|gb|EDY55039.1| NADH dehydrogenase subunit B [Streptomyces sviceus ATCC 29083]
          Length = 184

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|295837124|ref|ZP_06824057.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. SPB74]
 gi|318057842|ref|ZP_07976565.1| NADH dehydrogenase subunit B [Streptomyces sp. SA3_actG]
 gi|318078940|ref|ZP_07986272.1| NADH dehydrogenase subunit B [Streptomyces sp. SA3_actF]
 gi|333025118|ref|ZP_08453182.1| putative NADH dehydrogenase subunit B [Streptomyces sp. Tu6071]
 gi|197697234|gb|EDY44167.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. SPB74]
 gi|332744970|gb|EGJ75411.1| putative NADH dehydrogenase subunit B [Streptomyces sp. Tu6071]
          Length = 184

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSMFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E LI  IL L +K++
Sbjct: 123 VPVDIYLPGCPPRPEMLIDAILKLHQKVQ 151


>gi|313126885|ref|YP_004037155.1| NADH dehydrogenase subunit b [Halogeometricum borinquense DSM
           11551]
 gi|312293250|gb|ADQ67710.1| NADH dehydrogenase subunit B [Halogeometricum borinquense DSM
           11551]
          Length = 236

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 113/182 (62%), Gaps = 11/182 (6%)

Query: 7   NQKIISGQSSCSLEKVDADF----------SRISSEITHKGFLVTSVDQLVTWARTGSLM 56
           NQ  ++  +    E  DA            S++        F++T  D  + W R  S+ 
Sbjct: 6   NQPFVTDDTQVQTETRDARMTGSGADNRFNSKLREAFGSSPFILTKFDNFMNWVRGSSMF 65

Query: 57  WMTFGLACCAVEMMQASMPRYDLERFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYD 115
            + FG+ACC++EMM     ++DL+RF    PRASPRQ+DV+IV GT+ +K A  ++RVYD
Sbjct: 66  MLQFGIACCSIEMMHTYSVKHDLDRFAAGVPRASPRQADVIIVPGTIVSKFAPRMKRVYD 125

Query: 116 QMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQK 175
           QMPEP++V+ MGSC   GG +   Y+V++G + ++PVDI+VPGCPP  EALIYG+  LQ+
Sbjct: 126 QMPEPKFVVGMGSCTVSGGPFQEGYNVIKGAEEVIPVDIHVPGCPPRPEALIYGVAKLQQ 185

Query: 176 KI 177
           +I
Sbjct: 186 RI 187


>gi|322435876|ref|YP_004218088.1| NADH-quinone oxidoreductase, B subunit [Acidobacterium sp.
           MP5ACTX9]
 gi|321163603|gb|ADW69308.1| NADH-quinone oxidoreductase, B subunit [Acidobacterium sp.
           MP5ACTX9]
          Length = 205

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 109/144 (75%), Gaps = 2/144 (1%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSD 94
           +G ++ S+D  + W R  S+  MTFGLACCA+EMM     RYD+ RFG    R SPRQSD
Sbjct: 50  EGIVLASLDAAINWVRKNSVWPMTFGLACCAIEMMSMGGSRYDIARFGAEVFRPSPRQSD 109

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           +MI+AG ++ KMA  +RR+Y+QMPEP++VISMG+CA  GG ++ +Y++++G ++I+PVDI
Sbjct: 110 LMIIAGRVSQKMAPVIRRLYEQMPEPKWVISMGACATSGGVFN-NYALLQGVNQIIPVDI 168

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           YVPGCPP  E L+Y I LLQ+KI+
Sbjct: 169 YVPGCPPRPEQLLYAITLLQEKIQ 192


>gi|294630797|ref|ZP_06709357.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. e14]
 gi|292834130|gb|EFF92479.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. e14]
          Length = 184

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|290958259|ref|YP_003489441.1| NADH dehydrogenase subunit NuoB [Streptomyces scabiei 87.22]
 gi|260647785|emb|CBG70890.1| NuoB, NADH dehydrogenase subunit [Streptomyces scabiei 87.22]
          Length = 184

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|284992924|ref|YP_003411478.1| NADH-quinone oxidoreductase subunit B [Geodermatophilus obscurus
           DSM 43160]
 gi|284066169|gb|ADB77107.1| NADH-quinone oxidoreductase, B subunit [Geodermatophilus obscurus
           DSM 43160]
          Length = 226

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (71%), Gaps = 2/148 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    G L+TSV++LV W R  SL   TFGLACCA+EMM     RYDL RFG    RAS
Sbjct: 4   EEKLPSGVLLTSVEKLVNWTRKSSLWPATFGLACCAIEMMATGAGRYDLARFGMEVFRAS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR++YDQMPEPR+V++MG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQIYDQMPEPRWVLAMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKI 177
           VPVD+Y+PGCPP  E L   IL L  KI
Sbjct: 123 VPVDMYLPGCPPRPEMLTDAILKLHHKI 150


>gi|317123870|ref|YP_004097982.1| NADH dehydrogenase subunit B [Intrasporangium calvum DSM 43043]
 gi|315587958|gb|ADU47255.1| NADH dehydrogenase subunit B [Intrasporangium calvum DSM 43043]
          Length = 221

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGT 101
           +  L+ W R  SL    FGLACCA+E +  SM R+D  R G  P A  PRQ+D+MIV+GT
Sbjct: 30  IKVLLNWGRRYSLWVFNFGLACCAIEFIATSMARHDFMRLGVIPFAPGPRQADLMIVSGT 89

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +T+KMA A+RR+YDQMPEP+YVIS G+CAN GG Y  SYSV +G D ++PVD+YVPGCPP
Sbjct: 90  VTDKMAPAIRRLYDQMPEPKYVISFGACANSGGPYWDSYSVTKGVDTVIPVDVYVPGCPP 149

Query: 162 TAEALIYGILLLQKKI 177
             EAL++GI+ LQ++I
Sbjct: 150 RPEALLHGIIRLQEQI 165


>gi|219847965|ref|YP_002462398.1| NADH dehydrogenase subunit B [Chloroflexus aggregans DSM 9485]
 gi|238065007|sp|B8G705|NUOB1_CHLAD RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|219542224|gb|ACL23962.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus aggregans DSM
           9485]
          Length = 174

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 111/152 (73%), Gaps = 2/152 (1%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA-PR 87
           I  +  + G + T+++ +V W RT ++  + FGLACCA+EMM A    YDL RFG    R
Sbjct: 3   IEEKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMGAQASNYDLSRFGMELNR 62

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIVAG ++ KMA  +RR+YDQMPEP++VI+MG CA  GG ++ +Y++V+G D
Sbjct: 63  ASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDCAACGGIFN-NYAIVQGVD 121

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
            +VPVD+YV GCPP  EALI GI++L +K+ R
Sbjct: 122 EVVPVDVYVAGCPPRPEALIDGIMMLHQKVMR 153


>gi|163848441|ref|YP_001636485.1| NADH dehydrogenase subunit B [Chloroflexus aurantiacus J-10-fl]
 gi|222526369|ref|YP_002570840.1| NADH dehydrogenase subunit B [Chloroflexus sp. Y-400-fl]
 gi|238065028|sp|A9WFB2|NUOB2_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|238065030|sp|B9LAU1|NUOB2_CHLSY RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|163669730|gb|ABY36096.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450248|gb|ACM54514.1| NADH-quinone oxidoreductase, B subunit [Chloroflexus sp. Y-400-fl]
          Length = 174

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 111/152 (73%), Gaps = 2/152 (1%)

Query: 29  ISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA-PR 87
           I  +  + G + T+++ +V W RT ++  + FGLACCA+EMM A    YDL RFG    R
Sbjct: 3   IEEKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMGAQASNYDLSRFGMELNR 62

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
           ASPRQ+D+MIVAG ++ KMA  +RR+YDQMPEP++VI+MG CA  GG ++ +Y++V+G D
Sbjct: 63  ASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDCAACGGIFN-NYAIVQGVD 121

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
            +VPVD+YV GCPP  EALI GI++L +K+ R
Sbjct: 122 EVVPVDVYVAGCPPRPEALIDGIMMLHQKVMR 153


>gi|328953790|ref|YP_004371124.1| NAD(P)H-quinone oxidoreductase subunit K [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454114|gb|AEB09943.1| NAD(P)H-quinone oxidoreductase subunit K [Desulfobacca acetoxidans
           DSM 11109]
          Length = 174

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/145 (56%), Positives = 109/145 (75%), Gaps = 2/145 (1%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSD 94
              L TS++++V WAR  SL   TFGLACCA+EM+  +  RYD+ RFG  A RASPRQ+D
Sbjct: 9   NNILTTSLEKMVDWARKNSLWPATFGLACCAIEMIVTAANRYDIARFGMEAFRASPRQAD 68

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           +MIVAGT+T KM  A+ R+Y+QM EP++VI+MG+CA+ GG +  SY+VV+G D+ +PVD+
Sbjct: 69  LMIVAGTVTKKMVPAVVRIYEQMTEPKWVIAMGACASSGGIFR-SYAVVQGIDQYLPVDV 127

Query: 155 YVPGCPPTAEALIYGILLLQKKIRR 179
           YVPGCPP  E L+YGIL L  KI +
Sbjct: 128 YVPGCPPRPEGLLYGILKLHDKILK 152


>gi|297192787|ref|ZP_06910185.1| NADH dehydrogenase subunit B (NuoB) [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721026|gb|EDY64934.1| NADH dehydrogenase subunit B (NuoB) [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 184

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|254391138|ref|ZP_05006345.1| NADH dehydrogenase beta subunit [Streptomyces clavuligerus ATCC
           27064]
 gi|294814395|ref|ZP_06773038.1| NADH-quinone oxidoreductase subunit B [Streptomyces clavuligerus
           ATCC 27064]
 gi|326442785|ref|ZP_08217519.1| NADH dehydrogenase subunit B [Streptomyces clavuligerus ATCC 27064]
 gi|197704832|gb|EDY50644.1| NADH dehydrogenase beta subunit [Streptomyces clavuligerus ATCC
           27064]
 gi|294326994|gb|EFG08637.1| NADH-quinone oxidoreductase subunit B [Streptomyces clavuligerus
           ATCC 27064]
          Length = 184

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|304382881|ref|ZP_07365364.1| NADH-quinone oxidoreductase subunit B [Prevotella marshii DSM
           16973]
 gi|304336066|gb|EFM02313.1| NADH-quinone oxidoreductase subunit B [Prevotella marshii DSM
           16973]
          Length = 207

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 117/181 (64%), Gaps = 7/181 (3%)

Query: 1   MGLTTVNQKIISGQSSCSLEKVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWM 58
           MG+   N K I  +      K +    +I+ E+   G   ++ ++D L+ W R+ SL  +
Sbjct: 1   MGMKKPNIKSIPYKEF----KDNESLEKIAQELHEGGTNVVLGTLDDLINWGRSNSLWSL 56

Query: 59  TFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMIVAGTLTNKMASALRRVYDQM 117
           TF  +CC +E M     RYD  RFGF   R SPRQ+D+++ AGT+TNKMA   +R+YD+M
Sbjct: 57  TFATSCCGIEFMSVGCARYDFARFGFEVTRNSPRQADLIMCAGTITNKMAPVFKRLYDEM 116

Query: 118 PEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
            EP+YVI++G CA  GG +  SY VVRG + IVPVD+Y+PGCPP  EA++YG++ LQ+KI
Sbjct: 117 AEPKYVIAVGGCAISGGPFKSSYHVVRGINEIVPVDVYIPGCPPRPEAILYGMMQLQRKI 176

Query: 178 R 178
           +
Sbjct: 177 K 177


>gi|239929613|ref|ZP_04686566.1| NADH dehydrogenase subunit B [Streptomyces ghanaensis ATCC 14672]
 gi|291437937|ref|ZP_06577327.1| NuoB [Streptomyces ghanaensis ATCC 14672]
 gi|291340832|gb|EFE67788.1| NuoB [Streptomyces ghanaensis ATCC 14672]
          Length = 184

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLLDAILKLHQKIQ 151


>gi|302559106|ref|ZP_07311448.1| NADH-quinone oxidoreductase, B subunit [Streptomyces griseoflavus
           Tu4000]
 gi|302476724|gb|EFL39817.1| NADH-quinone oxidoreductase, B subunit [Streptomyces griseoflavus
           Tu4000]
          Length = 184

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSMFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|73748692|ref|YP_307931.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Dehalococcoides sp. CBDB1]
 gi|289432718|ref|YP_003462591.1| NADH-quinone oxidoreductase subunit beta [Dehalococcoides sp. GT]
 gi|123619736|sp|Q3ZXS0|NUOB_DEHSC RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|73660408|emb|CAI83015.1| proton-translocating NADH-quinone oxidoreductase, B subunit
           [Dehalococcoides sp. CBDB1]
 gi|288946438|gb|ADC74135.1| NADH-quinone oxidoreductase, B subunit [Dehalococcoides sp. GT]
          Length = 200

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 5/180 (2%)

Query: 6   VNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACC 65
           V Q   +G +S   +  D     ++ E    G  +TSV++++ W+R  SL  + FGLACC
Sbjct: 24  VIQSFRTGHTSPYPDPADW----LNGEEPPPGVFITSVEKVLNWSRHYSLWPVMFGLACC 79

Query: 66  AVEMMQASMPRYDLERFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVI 124
           A+EMM  +  R+DL RFG    RASPRQ+D+MIVAGTLT KMA  L+R+YDQMPEP++V+
Sbjct: 80  AIEMMCMAASRWDLARFGMDIFRASPRQADLMIVAGTLTWKMAPWLKRIYDQMPEPKWVL 139

Query: 125 SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           +MG+C   GG +  SYSVV G + +VPVD+YVPGCPP  EAL+  I+ + +KI +   +K
Sbjct: 140 AMGACGTSGGLFRDSYSVVPGFNLVVPVDVYVPGCPPRPEALMRAIMDIHEKIDKTRILK 199


>gi|292655139|ref|YP_003535036.1| NADH dehydrogenase-like complex subunit B [Haloferax volcanii DS2]
 gi|291372435|gb|ADE04662.1| NADH dehydrogenase-like complex subunit B [Haloferax volcanii DS2]
          Length = 233

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 106/152 (69%), Gaps = 1/152 (0%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA- 85
           S++        F++T  D+ + W R  S+  + FG+ACC++EMM     ++DL+RF    
Sbjct: 33  SKLREAFGSSPFILTKFDKFMNWVRGSSMFMLQFGIACCSIEMMHTYSVKHDLDRFAAGV 92

Query: 86  PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
           PRASPRQ+DV+IV GT+ +K A  ++RVYDQMPEP++V+ MGSC   GG +   Y+V++G
Sbjct: 93  PRASPRQADVIIVPGTIVSKFAPRMKRVYDQMPEPKFVVGMGSCTISGGPFQEGYNVIKG 152

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKI 177
            + ++PVDI++PGCPP  EALIYGI  LQ++I
Sbjct: 153 AEEVIPVDIHIPGCPPRPEALIYGIAKLQERI 184


>gi|189459784|ref|ZP_03008569.1| hypothetical protein BACCOP_00413 [Bacteroides coprocola DSM 17136]
 gi|189433513|gb|EDV02498.1| hypothetical protein BACCOP_00413 [Bacteroides coprocola DSM 17136]
          Length = 200

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 3/156 (1%)

Query: 26  FSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
             R+  E+   G   ++ +VDQL+ W R+ SL  +TFG +CCA+E M     RYD+ RFG
Sbjct: 22  LQRMVDELNRDGAGVVIGTVDQLIEWGRSNSLWSLTFGTSCCAIEFMALGAARYDMARFG 81

Query: 84  F-APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           F   R SPRQ+D+++V GT+T KMA  L+R+YDQM EP+YV+++G C   GG +  SY V
Sbjct: 82  FEVTRNSPRQADMIMVLGTITYKMAPVLKRLYDQMAEPKYVVAVGGCTISGGPFIKSYHV 141

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           V G D+I+PVD+Y+PGCPP  EA  YG++ LQ+KI+
Sbjct: 142 VNGIDKIIPVDVYIPGCPPRPEAFYYGMMQLQRKIK 177


>gi|325280124|ref|YP_004252666.1| NAD(P)H-quinone oxidoreductase subunit K [Odoribacter splanchnicus
           DSM 20712]
 gi|324311933|gb|ADY32486.1| NAD(P)H-quinone oxidoreductase subunit K [Odoribacter splanchnicus
           DSM 20712]
          Length = 201

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           +V  +D L+ W R+ S+  +TF  +CC +E M     RYD  RFGF   RASPRQ+DV+I
Sbjct: 31  IVGCLDDLINWGRSNSVWPLTFATSCCGIEFMAVGAARYDFARFGFEVTRASPRQADVII 90

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+  KMA  LRR+YDQM EP+YVI+MG CA  GG +  SY VV+G ++I+PVD+YVP
Sbjct: 91  VAGTIVYKMAPVLRRLYDQMAEPKYVIAMGGCAISGGPFKKSYHVVKGVNQILPVDVYVP 150

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  E+L+YG++ LQ+KI+
Sbjct: 151 GCPPRPESLLYGMMQLQRKIK 171


>gi|311897891|dbj|BAJ30299.1| putative NADH-quinone oxidoreductase subunit B [Kitasatospora setae
           KM-6054]
          Length = 184

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 104/144 (72%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           GFL+TSV+    W R  SL   TFGLACCA+EMM     RYDL RFG    R SPRQ+D+
Sbjct: 10  GFLLTSVEAAAGWVRKASLFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGSPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D IVPVDIY
Sbjct: 70  MIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHIVPVDIY 128

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           +PGCPP  E L+  I+ L +KI+ 
Sbjct: 129 LPGCPPRPEMLLDAIIKLHEKIQH 152


>gi|289641426|ref|ZP_06473590.1| NADH-quinone oxidoreductase, B subunit [Frankia symbiont of Datisca
           glomerata]
 gi|289508762|gb|EFD29697.1| NADH-quinone oxidoreductase, B subunit [Frankia symbiont of Datisca
           glomerata]
          Length = 267

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+T+V+++  W+R  SL   TFGLACCA+EMM     RYDL RFG    RASPRQ+D+
Sbjct: 10  GLLLTTVEKMANWSRRSSLWPATFGLACCAIEMMSTGAGRYDLARFGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQMPEP++V+SMG CA+ GG ++ +Y++V+G D IVPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVCASSGGMFN-NYAIVQGVDHIVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E L+  IL L +KI
Sbjct: 129 LPGCPPRPEMLMDAILKLHEKI 150


>gi|291515382|emb|CBK64592.1| NADH dehydrogenase subunit B [Alistipes shahii WAL 8301]
          Length = 218

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 109/156 (69%), Gaps = 3/156 (1%)

Query: 26  FSRISSEITHKGFLVTS--VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFG 83
             ++  E+   G  V +  +D+++ W R+ SL  +TF  +CC +E M     RYD  RFG
Sbjct: 22  LEQMVRELRENGTHVVAGCLDEVINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFG 81

Query: 84  FA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSV 142
           F   RASPRQ+D ++VAGT+T+KMA  LRR+YDQM +P+YVI++G CA  GG +  SY V
Sbjct: 82  FEVARASPRQADFIMVAGTITHKMAPVLRRLYDQMADPKYVIAVGGCAISGGPFKKSYHV 141

Query: 143 VRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           V G DRI+PVD+Y+PGCPP  EA++YG++ LQ+K++
Sbjct: 142 VNGVDRILPVDVYIPGCPPRPEAMLYGLMQLQRKVK 177


>gi|320009203|gb|ADW04053.1| NADH-quinone oxidoreductase, B subunit [Streptomyces flavogriseus
           ATCC 33331]
          Length = 184

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GF++T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFVLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPSPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E LI  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLIDAILKLHQKIQ 151


>gi|284034118|ref|YP_003384049.1| NADH-quinone oxidoreductase subunit B [Kribbella flavida DSM 17836]
 gi|283813411|gb|ADB35250.1| NADH-quinone oxidoreductase, B subunit [Kribbella flavida DSM
           17836]
          Length = 178

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGT 101
           V  L+ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+M+V+GT
Sbjct: 19  VRYLLNWGRKYSLWVFNFGLACCAIEFIAASMGRHDFIRLGVIPFAPGPRQADLMVVSGT 78

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +T+KMA A++R+YDQMPEP+YVIS GSC+N GG Y  SY V +G D+I+PVD+YVPGCPP
Sbjct: 79  VTDKMAPAIKRLYDQMPEPKYVISFGSCSNSGGPYWDSYCVTKGVDQIIPVDVYVPGCPP 138

Query: 162 TAEALIYGILLLQKKI 177
             EAL+ GIL LQ+KI
Sbjct: 139 RPEALLQGILKLQEKI 154


>gi|21222946|ref|NP_628725.1| NADH dehydrogenase subunit B [Streptomyces coelicolor A3(2)]
 gi|256785940|ref|ZP_05524371.1| NADH dehydrogenase subunit B [Streptomyces lividans TK24]
 gi|329935996|ref|ZP_08285796.1| NADH dehydrogenase subunit B [Streptomyces griseoaurantiacus M045]
 gi|81625663|sp|Q9XAQ5|NUOB1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|5042276|emb|CAB44530.1| NuoB, NADH dehydrogenase subunit [Streptomyces coelicolor A3(2)]
 gi|329304474|gb|EGG48352.1| NADH dehydrogenase subunit B [Streptomyces griseoaurantiacus M045]
          Length = 184

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D +
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHV 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|167752198|ref|ZP_02424325.1| hypothetical protein ALIPUT_00440 [Alistipes putredinis DSM 17216]
 gi|167660439|gb|EDS04569.1| hypothetical protein ALIPUT_00440 [Alistipes putredinis DSM 17216]
          Length = 219

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (0%)

Query: 43  VDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFA-PRASPRQSDVMIVAGT 101
           +D+++ W R+ SL  +TF  +CC +E M     RYD  RFGF   RASPRQ+D ++VAGT
Sbjct: 41  LDEVINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFGFEVARASPRQADFIMVAGT 100

Query: 102 LTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPP 161
           +T+KMA  LRR+YDQM +P+YVI+ GSCA  GG +  SY VV G D+I+PVD+Y+PGCPP
Sbjct: 101 ITHKMAPVLRRLYDQMADPKYVIATGSCAVSGGPFKKSYHVVNGVDKILPVDVYIPGCPP 160

Query: 162 TAEALIYGILLLQKKIR 178
             EA++YG++ LQ+K++
Sbjct: 161 RPEAMLYGMMQLQRKVK 177


>gi|116622878|ref|YP_825034.1| NADH-quinone oxidoreductase subunit B [Candidatus Solibacter
           usitatus Ellin6076]
 gi|122253898|sp|Q020B6|NUOB1_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|116226040|gb|ABJ84749.1| NADH-quinone oxidoreductase, B subunit [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 188

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 109/144 (75%), Gaps = 2/144 (1%)

Query: 35  HKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQS 93
            + F+ T+VD +  WAR  +L  +TFGLACCA+EM+ +S  R+D+ RFG    R SPRQS
Sbjct: 10  EQNFITTNVDHVFNWARKSALWPLTFGLACCAIEMIASSTSRFDIARFGAEVFRPSPRQS 69

Query: 94  DVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVD 153
           D+MIVAGT+T KMA  L+R++DQMP+P++ ISMG+C++ GG ++ +Y+V++G D+IVPVD
Sbjct: 70  DLMIVAGTVTLKMAPVLKRIWDQMPDPKWCISMGACSSVGGPFN-TYAVLQGVDKIVPVD 128

Query: 154 IYVPGCPPTAEALIYGILLLQKKI 177
           +YV GCPP  E L Y +L LQ KI
Sbjct: 129 VYVTGCPPRPENLFYALLKLQDKI 152


>gi|302536169|ref|ZP_07288511.1| NADH dehydrogenase subunit B [Streptomyces sp. C]
 gi|302445064|gb|EFL16880.1| NADH dehydrogenase subunit B [Streptomyces sp. C]
          Length = 184

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPAPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHQKIQ 151


>gi|330465203|ref|YP_004402946.1| NADH dehydrogenase subunit B [Verrucosispora maris AB-18-032]
 gi|328808174|gb|AEB42346.1| NADH dehydrogenase subunit B [Verrucosispora maris AB-18-032]
          Length = 225

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (76%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+TSV++LV W+R  S+   TFGLACCA+EMM A  P YD+ R+G    RASPRQ+D+
Sbjct: 10  GVLLTSVEKLVNWSRKSSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQM EPR+V+SMG CA+ GG ++ +Y++V+G D +VPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFN-NYAIVQGVDHVVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E LI  IL L++KI
Sbjct: 129 LPGCPPRPEMLIDAILKLREKI 150


>gi|238062212|ref|ZP_04606921.1| NADH-quinone oxidoreductase, B subunit [Micromonospora sp. ATCC
           39149]
 gi|237884023|gb|EEP72851.1| NADH-quinone oxidoreductase, B subunit [Micromonospora sp. ATCC
           39149]
          Length = 225

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/142 (57%), Positives = 109/142 (76%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+TSV++LV W+R  S+   TFGLACCA+EMM A  P YD+ R+G    RASPRQ+D+
Sbjct: 10  GVLLTSVEKLVNWSRKSSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQM EPR+V+SMG CA+ GG ++ +Y++V+G D IVPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFN-NYAIVQGVDHIVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E LI  IL L++KI
Sbjct: 129 LPGCPPRPEMLIDAILKLREKI 150


>gi|268317701|ref|YP_003291420.1| NADH-quinone oxidoreductase, B subunit [Rhodothermus marinus DSM
           4252]
 gi|262335235|gb|ACY49032.1| NADH-quinone oxidoreductase, B subunit [Rhodothermus marinus DSM
           4252]
          Length = 194

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 110/144 (76%), Gaps = 2/144 (1%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSD 94
           +GFL T +D L+ WAR+ SLM M  GLACCA+EMM  + P+YD+ RFG  A R SPRQ+D
Sbjct: 6   EGFLTTRLDVLLNWARSNSLMPMPMGLACCAIEMMAFAGPKYDVARFGSEAMRFSPRQAD 65

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           +MIVAG  + KMA A+RRV+DQMP+P++ I+MG+CA+ GG  H  Y VV+G D  +PVD+
Sbjct: 66  LMIVAGWCSYKMAHAIRRVWDQMPDPKWCIAMGACASTGG-MHRCYGVVQGVDNFLPVDV 124

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           Y+PGCPP  EA+++ ++ +Q+KIR
Sbjct: 125 YIPGCPPRPEAVLHALMDIQEKIR 148


>gi|147669451|ref|YP_001214269.1| NADH-quinone oxidoreductase, B subunit [Dehalococcoides sp. BAV1]
 gi|238055291|sp|A5FQY4|NUOB_DEHSB RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|146270399|gb|ABQ17391.1| NADH dehydrogenase subunit B [Dehalococcoides sp. BAV1]
          Length = 200

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 5/180 (2%)

Query: 6   VNQKIISGQSSCSLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACC 65
           V Q   +G +S   +  D     ++ E    G  +TSV++++ W+R  SL  + FGLACC
Sbjct: 24  VIQSFRTGHTSPYPDPADW----LNGEEPPPGVFITSVEKVLNWSRHYSLWPVMFGLACC 79

Query: 66  AVEMMQASMPRYDLERFGFAP-RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVI 124
           A+EMM  +  R+DL RFG    RASPRQ+D+MIVAGTLT KMA  L+R+YDQMPEP++V+
Sbjct: 80  AIEMMCMAASRWDLARFGMDIFRASPRQADLMIVAGTLTWKMAPWLKRIYDQMPEPKWVL 139

Query: 125 SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIRRVGNVK 184
           +MG+C   GG +  SYSVV G + +VPVD+YVPGCPP  EAL+  I+ + +KI +   +K
Sbjct: 140 AMGACGTSGGLFRDSYSVVPGFNLVVPVDVYVPGCPPRPEALMRAIMDIHEKIDKTCILK 199


>gi|307696866|gb|ADN85879.1| NADH-ubiquinone oxidoreductase subunit 10 [Nyctotherus ovalis]
          Length = 155

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 100/128 (78%)

Query: 38  FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRASPRQSDVMI 97
           FL T    L++WAR G++  +TFGLACCA+EMM  +  RYD++RFGF  R SPR  D +I
Sbjct: 4   FLTTRSTALISWARGGAMWPLTFGLACCAIEMMHMTASRYDMDRFGFLFRPSPRHVDFLI 63

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           ++GT+T KM+  ++R+Y Q+ +P++VISMGSCAN GG Y+YSY+VVRG D I+PVD+Y+P
Sbjct: 64  ISGTVTYKMSYTVKRLYSQLLDPKWVISMGSCANTGGLYYYSYAVVRGVDNIIPVDVYIP 123

Query: 158 GCPPTAEA 165
           GCPP AE+
Sbjct: 124 GCPPHAES 131


>gi|320106231|ref|YP_004181821.1| NADH-quinone oxidoreductase subunit B [Terriglobus saanensis
           SP1PR4]
 gi|319924752|gb|ADV81827.1| NADH-quinone oxidoreductase, B subunit [Terriglobus saanensis
           SP1PR4]
          Length = 205

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 110/145 (75%), Gaps = 2/145 (1%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSD 94
           +G ++ S+D  + W R  S+  MTFGLACCA+EMM     RYD+ RFG    R SPRQSD
Sbjct: 50  EGIVLASMDAAINWVRKNSVWPMTFGLACCAIEMMSMGGSRYDIARFGAEVFRPSPRQSD 109

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           +MI+AG ++ KMA  +RR+Y+QMPEP++VISMG+CA  GG ++ +Y++++G ++I+PVD+
Sbjct: 110 LMIIAGRVSQKMAPVIRRLYEQMPEPKWVISMGACATSGGVFN-NYALLQGVNQIIPVDL 168

Query: 155 YVPGCPPTAEALIYGILLLQKKIRR 179
           YVPGCPP  E L+Y I LLQ+KI++
Sbjct: 169 YVPGCPPRPEQLLYAITLLQEKIQQ 193


>gi|282860763|ref|ZP_06269829.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. ACTE]
 gi|282564499|gb|EFB70035.1| NADH-quinone oxidoreductase, B subunit [Streptomyces sp. ACTE]
          Length = 211

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+M+V+GT+T+
Sbjct: 41  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFMRMGVIPFAPGPRQADLMVVSGTVTD 100

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A+RR+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 101 KMAPAVRRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 160

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 161 ALLQGILKLQEKIAR 175


>gi|297192751|ref|ZP_06910149.1| NADH dehydrogenase subunit I B [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297151481|gb|EDY64969.2| NADH dehydrogenase subunit I B [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 232

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 48  ILNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 107

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 108 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 167

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 168 ALLQGILKLQEKIAR 182


>gi|332885916|gb|EGK06160.1| NADH-quinone oxidoreductase subunit B [Dysgonomonas mossii DSM
           22836]
          Length = 194

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 102/141 (72%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           +V  +D L+ W R+ S+  + F  +CC +E M ++  RYDL RFG    R SPRQ+D M+
Sbjct: 37  IVGKLDDLINWGRSNSVWPLAFATSCCGIEFMASAAARYDLARFGMEVTRNSPRQADTMV 96

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+ +KMA  L+RVYDQM EP+YV++MGSCA  GG +  SY VV+G D I+PVD+YVP
Sbjct: 97  VAGTIVHKMAPLLKRVYDQMAEPKYVVAMGSCAISGGPFVDSYHVVKGIDEIIPVDVYVP 156

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL YG++ LQ+KI+
Sbjct: 157 GCPPRPEALFYGLMQLQRKIK 177


>gi|297159509|gb|ADI09221.1| NADH dehydrogenase subunit B [Streptomyces bingchenggensis BCW-1]
          Length = 184

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/144 (57%), Positives = 105/144 (72%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           GFL+T+V+Q    AR  S+   TFGLACCA+EMM     RYDL RFG    R SPRQ+D+
Sbjct: 10  GFLLTTVEQAAGLARKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGSPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D IVPVDIY
Sbjct: 70  MIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHIVPVDIY 128

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           +PGCPP  E L+  IL L +KIR 
Sbjct: 129 LPGCPPRPEMLLDAILKLHQKIRE 152


>gi|254883413|ref|ZP_05256123.1| NADH-quinone oxidoreductase [Bacteroides sp. 4_3_47FAA]
 gi|254836206|gb|EET16515.1| NADH-quinone oxidoreductase [Bacteroides sp. 4_3_47FAA]
          Length = 205

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (73%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           LV  +D L+ W R+ SL  +TF  +CC +E M     RYD  RFGF   RASPRQ+D+++
Sbjct: 44  LVGCLDDLINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFGFEVARASPRQADMIM 103

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+T+KMA  L+R+YDQM +P+YVI++G CA  GG +  SY V+ G D+I+PVD+Y+P
Sbjct: 104 VAGTITHKMAPVLKRLYDQMADPKYVIAVGGCAISGGPFKKSYHVLNGVDKILPVDVYIP 163

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL+YG++ LQ+K++
Sbjct: 164 GCPPRPEALLYGMIQLQRKVK 184


>gi|212693812|ref|ZP_03301940.1| hypothetical protein BACDOR_03333 [Bacteroides dorei DSM 17855]
 gi|237709340|ref|ZP_04539821.1| trifunctional NADH dehydrogenase I subunit B/C/D [Bacteroides sp.
           9_1_42FAA]
 gi|237724574|ref|ZP_04555055.1| trifunctional NADH dehydrogenase I subunit B/C/D [Bacteroides sp.
           D4]
 gi|265755015|ref|ZP_06089929.1| NADH-quinone oxidoreductase [Bacteroides sp. 3_1_33FAA]
 gi|212663701|gb|EEB24275.1| hypothetical protein BACDOR_03333 [Bacteroides dorei DSM 17855]
 gi|229437133|gb|EEO47210.1| trifunctional NADH dehydrogenase I subunit B/C/D [Bacteroides dorei
           5_1_36/D4]
 gi|229456725|gb|EEO62446.1| trifunctional NADH dehydrogenase I subunit B/C/D [Bacteroides sp.
           9_1_42FAA]
 gi|263234626|gb|EEZ20205.1| NADH-quinone oxidoreductase [Bacteroides sp. 3_1_33FAA]
          Length = 198

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (73%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           LV  +D L+ W R+ SL  +TF  +CC +E M     RYD  RFGF   RASPRQ+D+++
Sbjct: 37  LVGCLDDLINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFGFEVARASPRQADMIM 96

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+T+KMA  L+R+YDQM +P+YVI++G CA  GG +  SY V+ G D+I+PVD+Y+P
Sbjct: 97  VAGTITHKMAPVLKRLYDQMADPKYVIAVGGCAISGGPFKKSYHVLNGVDKILPVDVYIP 156

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL+YG++ LQ+K++
Sbjct: 157 GCPPRPEALLYGMIQLQRKVK 177


>gi|154508638|ref|ZP_02044280.1| hypothetical protein ACTODO_01139 [Actinomyces odontolyticus ATCC
           17982]
 gi|293191717|ref|ZP_06609274.1| NADH dehydrogenase I subunit B [Actinomyces odontolyticus F0309]
 gi|153798272|gb|EDN80692.1| hypothetical protein ACTODO_01139 [Actinomyces odontolyticus ATCC
           17982]
 gi|292820489|gb|EFF79471.1| NADH dehydrogenase I subunit B [Actinomyces odontolyticus F0309]
          Length = 184

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 112/142 (78%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G  +TSV++++  AR  S   +T GLACCA+EMM A  PR+D+ RFG    RASPR +D+
Sbjct: 10  GIALTSVEKVLGLARKYSQWPVTMGLACCAIEMMAAGTPRFDMARFGLEVFRASPRHADM 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIV+G +++KMA  +RRVYD MPEP++VISMG+CA+ GG ++ +Y+VV+GCD IVPVD+Y
Sbjct: 70  MIVSGRVSHKMAPIIRRVYDSMPEPKWVISMGACASSGGVFN-NYAVVQGCDHIVPVDVY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  EALI+ +L+L+++I
Sbjct: 129 LPGCPPRPEALIHAVLVLREQI 150


>gi|294674399|ref|YP_003575015.1| proton-translocating NADH-quinone oxidoreductase subunit B
           [Prevotella ruminicola 23]
 gi|294473976|gb|ADE83365.1| putative proton-translocating NADH-quinone oxidoreductase, B
           subunit [Prevotella ruminicola 23]
          Length = 263

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 110/159 (69%), Gaps = 3/159 (1%)

Query: 23  DADFSRISSEITHKGFLVT--SVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLE 80
           +    +I  E+   G  V   S+DQL+ W R+ SL  +TF  +CC +E M     RYD  
Sbjct: 19  NESLEKIIDELHEGGVNVVTGSLDQLINWGRSNSLWSLTFATSCCGIEFMACGCSRYDFA 78

Query: 81  RFGFA-PRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYS 139
           RFGF   R SPRQ+D+++ AGT+T+KMA AL+R+YDQM EP+YV+++G CA  GG +  S
Sbjct: 79  RFGFEVTRNSPRQADLIMCAGTITHKMAPALKRLYDQMAEPKYVVAVGGCAISGGPFKSS 138

Query: 140 YSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           Y VV+G + IVPVD+++PGCPP  EA++YG++ LQ+K++
Sbjct: 139 YHVVKGIEEIVPVDVFIPGCPPRPEAIMYGMMQLQRKVK 177


>gi|239980151|ref|ZP_04702675.1| NADH dehydrogenase subunit B [Streptomyces albus J1074]
 gi|291452006|ref|ZP_06591396.1| NuoB [Streptomyces albus J1074]
 gi|291354955|gb|EFE81857.1| NuoB [Streptomyces albus J1074]
          Length = 184

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSMFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  I+ L +K++
Sbjct: 123 VPVDIYLPGCPPRPEMLVDAIVKLHQKVQ 151


>gi|82658723|gb|ABB88530.1| menaquinone oxidoreductase [Streptomyces sp. Eco86]
          Length = 184

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+++V+Q   W R  S+   TFGLACCA E+M A   RYDL RFG    R S
Sbjct: 4   EESLPSGFLLSTVEQAAGWVRKASVFPATFGLACCAFELMAAGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR++YDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQIYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KIR
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHEKIR 151


>gi|307328622|ref|ZP_07607795.1| NADH-quinone oxidoreductase, B subunit [Streptomyces violaceusniger
           Tu 4113]
 gi|306885734|gb|EFN16747.1| NADH-quinone oxidoreductase, B subunit [Streptomyces violaceusniger
           Tu 4113]
          Length = 184

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (70%), Gaps = 2/150 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q    AR  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGLARKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIRR 179
           VPVDIY+PGCPP  E L+  IL L +KIR 
Sbjct: 123 VPVDIYLPGCPPRPEMLLDSILKLHQKIRE 152


>gi|253570156|ref|ZP_04847565.1| NADH-quinone oxidoreductase [Bacteroides sp. 1_1_6]
 gi|251840537|gb|EES68619.1| NADH-quinone oxidoreductase [Bacteroides sp. 1_1_6]
          Length = 197

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 111/162 (68%), Gaps = 6/162 (3%)

Query: 18  SLEKVDADFSRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRY 77
           SLEK+  + +   + +      +  +D LV W R+ SL  +TF  +CC +E M     RY
Sbjct: 22  SLEKLVKELNAGGANV-----FLGVLDDLVNWGRSNSLWPLTFATSCCGIEFMALGAARY 76

Query: 78  DLERFGF-APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYY 136
           D+ RFGF   RASPRQ+D+++V GT+TNKMA  L+R+YDQMP+P+YV+++G CA  GG +
Sbjct: 77  DMARFGFEVARASPRQADMIMVCGTITNKMAPVLKRLYDQMPDPKYVVAVGGCAVSGGPF 136

Query: 137 HYSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
             SY VV G D+I+PVD+Y+PGCPP  EA  YG++ LQ+K++
Sbjct: 137 KKSYHVVNGVDKILPVDVYIPGCPPRPEAFYYGMMQLQRKVK 178


>gi|302864902|ref|YP_003833539.1| NADH-quinone oxidoreductase subunit B [Micromonospora aurantiaca
           ATCC 27029]
 gi|315501187|ref|YP_004080074.1| NADH-quinone oxidoreductase, b subunit [Micromonospora sp. L5]
 gi|302567761|gb|ADL43963.1| NADH-quinone oxidoreductase, B subunit [Micromonospora aurantiaca
           ATCC 27029]
 gi|315407806|gb|ADU05923.1| NADH-quinone oxidoreductase, B subunit [Micromonospora sp. L5]
          Length = 226

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 108/142 (76%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+TSV++LV W R  S+   TFGLACCA+EMM A  P YD+ R+G    RASPRQ+D+
Sbjct: 10  GVLLTSVEKLVNWTRKTSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQM EPR+VISMG CA+ GG ++ +Y++V+G D +VPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMAEPRWVISMGVCASSGGMFN-NYAIVQGVDHVVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E LI  +L L++KI
Sbjct: 129 LPGCPPRPEMLIDAVLKLREKI 150


>gi|302536203|ref|ZP_07288545.1| NADH dehydrogenase subunit NuoB2 [Streptomyces sp. C]
 gi|302445098|gb|EFL16914.1| NADH dehydrogenase subunit NuoB2 [Streptomyces sp. C]
          Length = 203

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 38  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 97

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 98  KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 157

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 158 ALLQGILKLQEKIAR 172


>gi|291303411|ref|YP_003514689.1| NADH-quinone oxidoreductase subunit B [Stackebrandtia nassauensis
           DSM 44728]
 gi|290572631|gb|ADD45596.1| NADH-quinone oxidoreductase, B subunit [Stackebrandtia nassauensis
           DSM 44728]
          Length = 188

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 106/142 (74%), Gaps = 1/142 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDV 95
           G L   +  ++ W R  SL    FGLACCA+E + +SM R+D  R G  P A  PRQ+D+
Sbjct: 15  GVLGEPIRFVLNWGRRYSLWVFNFGLACCAIEFIASSMGRHDFMRLGVIPFAHGPRQADL 74

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           M+V+GT+T+KMA A++R+YDQMPEP+YVIS G+C+N GG Y  SYSV +G D+++PVD+Y
Sbjct: 75  MVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGACSNSGGPYWDSYSVTKGVDQLIPVDVY 134

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           VPGCPP  EAL++GI+ LQ+KI
Sbjct: 135 VPGCPPRPEALLHGIMRLQEKI 156


>gi|239943477|ref|ZP_04695414.1| NADH dehydrogenase subunit B [Streptomyces roseosporus NRRL 15998]
 gi|239989931|ref|ZP_04710595.1| NADH dehydrogenase subunit B [Streptomyces roseosporus NRRL 11379]
 gi|291446948|ref|ZP_06586338.1| NADH dehydrogenase subunit B [Streptomyces roseosporus NRRL 15998]
 gi|291349895|gb|EFE76799.1| NADH dehydrogenase subunit B [Streptomyces roseosporus NRRL 15998]
          Length = 184

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GF++T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFVLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLLDAILKLHQKIQ 151


>gi|225872572|ref|YP_002754027.1| NADH dehydrogenase I, B subunit [Acidobacterium capsulatum ATCC
           51196]
 gi|225792841|gb|ACO32931.1| NADH dehydrogenase I, B subunit [Acidobacterium capsulatum ATCC
           51196]
          Length = 186

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 108/144 (75%), Gaps = 2/144 (1%)

Query: 36  KGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSD 94
           +G  +T++D  + W R  S+  MTFGLACCA+EMM     R+D+ RFG    R SPRQ+D
Sbjct: 31  EGVFLTTLDSAINWVRKSSIWPMTFGLACCAIEMMSMGASRFDVARFGAEVFRPSPRQAD 90

Query: 95  VMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDI 154
           +M++AG ++ KMA  +RR+YDQMPEP++VISMG+CA  GG ++ +Y++++G ++++PVDI
Sbjct: 91  LMVIAGRVSQKMAPVIRRLYDQMPEPKWVISMGACATSGGVFN-NYALLQGVNQVIPVDI 149

Query: 155 YVPGCPPTAEALIYGILLLQKKIR 178
           YVPGCPP  E LIY   LLQ+KI+
Sbjct: 150 YVPGCPPRPEQLIYAFTLLQEKIQ 173


>gi|224026051|ref|ZP_03644417.1| hypothetical protein BACCOPRO_02804 [Bacteroides coprophilus DSM
           18228]
 gi|224019287|gb|EEF77285.1| hypothetical protein BACCOPRO_02804 [Bacteroides coprophilus DSM
           18228]
          Length = 200

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 104/143 (72%), Gaps = 1/143 (0%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDV 95
           G ++ ++D+L+ W R+ SL  +TFG +CCA+E M     RYD+ RFGF   R SPRQ+D+
Sbjct: 35  GIIIGTIDELIEWGRSNSLWSLTFGTSCCAIEFMALGAARYDMARFGFEVTRNSPRQADM 94

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           ++V GT+T KMA  L+R+YDQM EP+YVI++G C   GG +  SY VV G D+I+PVD+Y
Sbjct: 95  IMVLGTITYKMAPVLKRLYDQMAEPKYVIAVGGCTISGGPFIKSYHVVNGIDKIIPVDVY 154

Query: 156 VPGCPPTAEALIYGILLLQKKIR 178
           +PGCPP  EA  YG++ LQ+KI+
Sbjct: 155 IPGCPPRPEAFYYGMMQLQRKIK 177


>gi|299137549|ref|ZP_07030730.1| NADH-quinone oxidoreductase, B subunit [Acidobacterium sp.
           MP5ACTX8]
 gi|298600190|gb|EFI56347.1| NADH-quinone oxidoreductase, B subunit [Acidobacterium sp.
           MP5ACTX8]
          Length = 205

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 110/148 (74%), Gaps = 2/148 (1%)

Query: 32  EITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASP 90
           E   +G ++ S+D  + W R  S+  MTFGLACCA+EMM     RYD+ RFG    R SP
Sbjct: 46  EEQPEGVVLASLDAAINWVRKNSVWPMTFGLACCAIEMMSMGGSRYDIARFGAEVFRPSP 105

Query: 91  RQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIV 150
           RQSD+MI+AG ++ KMA  +RR+Y+QMPEP++VISMG+CA  GG ++ +Y++++G ++++
Sbjct: 106 RQSDLMIIAGRVSQKMAPVIRRLYEQMPEPKWVISMGACATSGGVFN-NYALLQGVNQVI 164

Query: 151 PVDIYVPGCPPTAEALIYGILLLQKKIR 178
           PVD+YVPGCPP  E L+Y I LLQ+KI+
Sbjct: 165 PVDVYVPGCPPRPEQLLYAITLLQEKIQ 192


>gi|182436717|ref|YP_001824436.1| putative NADH dehydrogenase chain B [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|238065043|sp|B1W4V9|NUOB2_STRGG RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|178465233|dbj|BAG19753.1| putative NADH dehydrogenase chain B [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 235

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 45  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 104

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 105 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 164

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 165 ALLQGILKLQEKIAR 179


>gi|150004312|ref|YP_001299056.1| NADH dehydrogenase subunit B [Bacteroides vulgatus ATCC 8482]
 gi|294776877|ref|ZP_06742340.1| NADH-quinone oxidoreductase, B subunit [Bacteroides vulgatus PC510]
 gi|319644247|ref|ZP_07998760.1| NADH dehydrogenase subunit I B [Bacteroides sp. 3_1_40A]
 gi|238065064|sp|A6L170|NUOB_BACV8 RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|149932736|gb|ABR39434.1| NADH dehydrogenase I chain B [Bacteroides vulgatus ATCC 8482]
 gi|294449353|gb|EFG17890.1| NADH-quinone oxidoreductase, B subunit [Bacteroides vulgatus PC510]
 gi|317384238|gb|EFV65210.1| NADH dehydrogenase subunit I B [Bacteroides sp. 3_1_40A]
          Length = 198

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (73%), Gaps = 1/141 (0%)

Query: 39  LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APRASPRQSDVMI 97
           LV  +D L+ W R+ SL  +TF  +CC +E M     RYD  RFGF   RASPRQ+D+++
Sbjct: 37  LVGCLDDLINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFGFEVARASPRQADMIM 96

Query: 98  VAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP 157
           VAGT+T+KMA  L+R+YDQM +P+YVI++G CA  GG +  SY V+ G D+I+PVD+Y+P
Sbjct: 97  VAGTITHKMAPVLKRLYDQMADPKYVIAVGGCAISGGPFKKSYHVLNGVDKILPVDVYIP 156

Query: 158 GCPPTAEALIYGILLLQKKIR 178
           GCPP  EAL+YG++ LQ+K++
Sbjct: 157 GCPPRPEALLYGMIQLQRKVK 177


>gi|332826700|gb|EGJ99522.1| NADH-quinone oxidoreductase subunit B [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 197

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 78/151 (51%), Positives = 105/151 (69%), Gaps = 3/151 (1%)

Query: 31  SEITHKGF--LVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGF-APR 87
            E+   G   +V  +D L+ W R+ S+  + F  +CC +E M ++  RYDL RFG    R
Sbjct: 34  KELNENGVPVVVGKLDDLINWGRSNSVWPLAFATSCCGIEFMASAAARYDLARFGMEVTR 93

Query: 88  ASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCD 147
            SPRQ+D M+VAGT+ +KMA  L+RVYDQM EP+YV++MGSCA  GG +  SY VV+G D
Sbjct: 94  NSPRQADTMVVAGTIVHKMAPLLKRVYDQMAEPKYVVAMGSCAISGGPFVDSYHVVKGID 153

Query: 148 RIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            I+PVD+YVPGCPP  EAL YG++ LQ+KI+
Sbjct: 154 EIMPVDVYVPGCPPRPEALFYGLMQLQRKIK 184


>gi|182436776|ref|YP_001824495.1| NADH dehydrogenase subunit B [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326777371|ref|ZP_08236636.1| NAD(P)H-quinone oxidoreductase subunit K [Streptomyces cf. griseus
           XylebKG-1]
 gi|238065022|sp|B1W518|NUOB1_STRGG RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|178465292|dbj|BAG19812.1| putative NADH dehydrogenase chain B [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657704|gb|EGE42550.1| NAD(P)H-quinone oxidoreductase subunit K [Streptomyces cf. griseus
           XylebKG-1]
          Length = 184

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GF++T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFVLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L +KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLLDAILKLHQKIQ 151


>gi|159039974|ref|YP_001539227.1| NADH-quinone oxidoreductase, B subunit [Salinispora arenicola
           CNS-205]
 gi|238065040|sp|A8M621|NUOB2_SALAI RecName: Full=NADH-quinone oxidoreductase subunit B 2; AltName:
           Full=NADH dehydrogenase I subunit B 2; AltName:
           Full=NDH-1 subunit B 2
 gi|157918809|gb|ABW00237.1| NADH-quinone oxidoreductase, B subunit [Salinispora arenicola
           CNS-205]
          Length = 226

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 109/142 (76%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+TSV++LV W+R  S+   TFGLACCA+EMM A  P YD+ R+G    RASPRQ+D+
Sbjct: 10  GVLLTSVEKLVNWSRKSSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQM EPR+V+SMG CA+ GG ++ +Y++V+G D +VPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFN-NYAIVQGVDHVVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E LI  +L L++KI
Sbjct: 129 LPGCPPRPEMLIDAVLKLREKI 150


>gi|328884356|emb|CCA57595.1| NADH-ubiquinone oxidoreductase chain B [Streptomyces venezuelae
           ATCC 10712]
          Length = 193

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 29  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 88

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 89  KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 148

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 149 ALLQGILKLQEKIAR 163


>gi|297201676|ref|ZP_06919073.1| NADH dehydrogenase subunit NuoB2 [Streptomyces sviceus ATCC 29083]
 gi|297147941|gb|EDY54985.2| NADH dehydrogenase subunit NuoB2 [Streptomyces sviceus ATCC 29083]
          Length = 234

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 79/135 (58%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+M+V+GT+T+
Sbjct: 45  ILNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMVVSGTVTD 104

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 105 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 164

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 165 ALLQGILKLQEKIAR 179


>gi|193215671|ref|YP_001996870.1| NADH-quinone oxidoreductase subunit B [Chloroherpeton thalassium
           ATCC 35110]
 gi|238065009|sp|B3QUS2|NUOB1_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit B 1; AltName:
           Full=NADH dehydrogenase I subunit B 1; AltName:
           Full=NDH-1 subunit B 1
 gi|193089148|gb|ACF14423.1| NADH-quinone oxidoreductase, B subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 186

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 110/144 (76%), Gaps = 2/144 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           GFL T++D +  W R  S+  M  GL+CCA+EMM  + PRYD+ RFG    R SPRQSD+
Sbjct: 10  GFLTTTLDAITNWGRANSIWPMPMGLSCCAIEMMAMAGPRYDIARFGAEVFRFSPRQSDL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAGT+T KMA+ +++++DQMPEP++ I+MG+C++ GG +  SY VV+G D+ +PVD+Y
Sbjct: 70  MIVAGTVTYKMATVVKKIWDQMPEPKWCIAMGACSSSGGMFR-SYPVVQGIDQFLPVDVY 128

Query: 156 VPGCPPTAEALIYGILLLQKKIRR 179
           VPGCPP  +A+I+ ++ +Q+KI+R
Sbjct: 129 VPGCPPRPDAVIHAVMEIQEKIKR 152


>gi|271962234|ref|YP_003336430.1| NADH dehydrogenase (quinone) [Streptosporangium roseum DSM 43021]
 gi|270505409|gb|ACZ83687.1| NADH dehydrogenase (quinone) [Streptosporangium roseum DSM 43021]
          Length = 173

 Score =  170 bits (430), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 77/133 (57%), Positives = 104/133 (78%), Gaps = 1/133 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E +  +M R+D  RFG  P A+ PRQ+D+MIV+GT+T+
Sbjct: 23  ILNWGRRYSLWAFNFGLACCAIEFIATTMSRHDFIRFGVIPFANGPRQADLMIVSGTVTD 82

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SY V +G D+I+PVD+YVPGCPP  E
Sbjct: 83  KMAPAVKRLYEQMPEPKYVISFGACSNSGGPYWDSYCVTKGVDQIIPVDVYVPGCPPRPE 142

Query: 165 ALIYGILLLQKKI 177
           AL++GI+LLQ+KI
Sbjct: 143 ALLHGIMLLQEKI 155


>gi|254382442|ref|ZP_04997801.1| NuoB [Streptomyces sp. Mg1]
 gi|194341346|gb|EDX22312.1| NuoB [Streptomyces sp. Mg1]
          Length = 184

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 105/149 (70%), Gaps = 2/149 (1%)

Query: 31  SEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RAS 89
            E    GFL+T+V+Q   W R  S+   TFGLACCA+EMM     RYDL RFG    R S
Sbjct: 4   EEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGS 63

Query: 90  PRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRI 149
           PRQ+D+MIVAG ++ KMA  LR+VYDQMP P++VISMG CA+ GG ++ +Y++V+G D I
Sbjct: 64  PRQADLMIVAGRVSQKMAPVLRQVYDQMPAPKWVISMGVCASSGGMFN-NYAIVQGVDHI 122

Query: 150 VPVDIYVPGCPPTAEALIYGILLLQKKIR 178
           VPVDIY+PGCPP  E L+  IL L  KI+
Sbjct: 123 VPVDIYLPGCPPRPEMLMDAILKLHHKIQ 151


>gi|158317835|ref|YP_001510343.1| NADH dehydrogenase subunit B [Frankia sp. EAN1pec]
 gi|238065147|sp|A8LCA0|NUOB_FRASN RecName: Full=NADH-quinone oxidoreductase subunit B; AltName:
           Full=NADH dehydrogenase I subunit B; AltName: Full=NDH-1
           subunit B
 gi|158113240|gb|ABW15437.1| NADH-quinone oxidoreductase, B subunit [Frankia sp. EAN1pec]
          Length = 264

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 2/142 (1%)

Query: 37  GFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP-RASPRQSDV 95
           G L+T+V++L  W+R  SL   TFGLACCA+EMM     RYDL RFG    RASPRQ+D+
Sbjct: 10  GVLLTTVEKLANWSRRSSLWPATFGLACCAIEMMSTGAGRYDLSRFGMEVFRASPRQADL 69

Query: 96  MIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIY 155
           MIVAG ++ KMA  LR++YDQMPEP++V+SMG CA+ GG ++ +Y++V+G D IVPVD+Y
Sbjct: 70  MIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVCASSGGMFN-NYAIVQGVDHIVPVDMY 128

Query: 156 VPGCPPTAEALIYGILLLQKKI 177
           +PGCPP  E L+  I+ L +KI
Sbjct: 129 LPGCPPRPEMLMDAIVKLHEKI 150


>gi|294814429|ref|ZP_06773072.1| NADH dehydrogenase I chain B [Streptomyces clavuligerus ATCC 27064]
 gi|326442819|ref|ZP_08217553.1| putative NADH dehydrogenase chain B [Streptomyces clavuligerus ATCC
           27064]
 gi|294327028|gb|EFG08671.1| NADH dehydrogenase I chain B [Streptomyces clavuligerus ATCC 27064]
          Length = 239

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 56  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 115

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 116 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 175

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 176 ALLQGILKLQEKIAR 190


>gi|239943528|ref|ZP_04695465.1| putative NADH dehydrogenase chain B [Streptomyces roseosporus NRRL
           15998]
 gi|239989982|ref|ZP_04710646.1| putative NADH dehydrogenase chain B [Streptomyces roseosporus NRRL
           11379]
          Length = 226

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRAS-PRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 47  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 106

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 107 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 166

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 167 ALLQGILKLQEKIAR 181


>gi|254391175|ref|ZP_05006382.1| NADH dehydrogenase I chain B [Streptomyces clavuligerus ATCC 27064]
 gi|197704869|gb|EDY50681.1| NADH dehydrogenase I chain B [Streptomyces clavuligerus ATCC 27064]
          Length = 237

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 46  LVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAPRA-SPRQSDVMIVAGTLTN 104
           ++ W R  SL    FGLACCA+E + ASM R+D  R G  P A  PRQ+D+MIV+GT+T+
Sbjct: 54  VLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTD 113

Query: 105 KMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAE 164
           KMA A++R+Y+QMPEP+YVIS G+C+N GG Y  SYSV +G D+I+PVD+YVPGCPP  E
Sbjct: 114 KMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPE 173

Query: 165 ALIYGILLLQKKIRR 179
           AL+ GIL LQ+KI R
Sbjct: 174 ALLQGILKLQEKIAR 188


>gi|260885204|ref|ZP_05734514.2| NADH dehydrogenase I subunit B [Prevotella tannerae ATCC 51259]
 gi|260853160|gb|EEX73029.1| NADH dehydrogenase I subunit B [Prevotella tannerae ATCC 51259]
          Length = 214

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 21  KVDADFSRISSEITHKG--FLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYD 78
           K +  + ++ +E+   G   +V  +D L+ W R+ SL  +TF  +CC +E M     RYD
Sbjct: 19  KDNETYEKLVAELNANGANVIVKPLDDLINWGRSNSLWPLTFATSCCGIEFMAVCAARYD 78

Query: 79  LERFGF-APRASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYH 137
           + RFGF   R SPRQ+DV++V+GT+TNKMA  L+R+YDQM +P+YV+++G CA  GG + 
Sbjct: 79  IARFGFEVTRNSPRQADVILVSGTITNKMAPVLKRLYDQMADPKYVVAIGGCATTGGPFV 138

Query: 138 YSYSVVRGCDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            SY VV+G D I+PV++YVPGCPP  EA +YG++ LQ+ ++
Sbjct: 139 KSYHVVKGVDEIIPVNVYVPGCPPRPEAFLYGMMQLQRIVK 179


>gi|322417697|ref|YP_004196920.1| NADH dehydrogenase I subunit D [Geobacter sp. M18]
 gi|320124084|gb|ADW11644.1| NADH dehydrogenase I, D subunit [Geobacter sp. M18]
          Length = 794

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/153 (52%), Positives = 110/153 (71%), Gaps = 2/153 (1%)

Query: 27  SRISSEITHKGFLVTSVDQLVTWARTGSLMWMTFGLACCAVEMMQASMPRYDLERFGFAP 86
           S    E   +  L+TS+D L+ W R  SL  M FGL+CC VEMM +   RYD+ RFG   
Sbjct: 2   SERDDEKIPENVLLTSLDDLINWGRANSLWPMFFGLSCCFVEMMTSFTSRYDVSRFGAEV 61

Query: 87  -RASPRQSDVMIVAGTLTNKMASALRRVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRG 145
            R +PR+SD+M++AGT+  KMA ++ R+Y+QM EP++VISMGSCAN GG Y   YSVV+G
Sbjct: 62  LRGTPRESDLMVIAGTVFKKMAPSILRLYEQMAEPKWVISMGSCANSGGMYDV-YSVVQG 120

Query: 146 CDRIVPVDIYVPGCPPTAEALIYGILLLQKKIR 178
            ++I+PVD+Y+PGCPP  E+ + G++LLQKKIR
Sbjct: 121 VNQILPVDLYIPGCPPRPESFLEGLMLLQKKIR 153


>gi|302543443|ref|ZP_07295785.1| NADH dehydrogenase I, B subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302461061|gb|EFL24154.1| NADH dehydrogenase I, B subunit [Strep